MUSCLE (3.8) multiple sequence alignment

TBLA0A07130        -MLKSAATLRQ---PVVSLNIFRNCQRS--FSITPVSHSIADLQGTRTETDSFGEIQVPA
TBLA0G01000        ------------------------------------------MPETRIEVDGFGELEVPA
KAFR0B06520        MMINISSKGSIVHLVKLTSYTSRFYTMS------------SIKSSFRAETDSFGEINVPN
KNAG0E02750        -MIRSVFNSSGKASVKVALLRNNLRRNM--------SASAITNQEFRVETDSFGEINVPA
ZYRO0C07964g       -MLRLSSNVLK-NSCVCQVSSPRLTSKTPMSQISQLHTTTPWLQEHRVETDAFGEIKVPA
NDAI0I02470        -MSTNSKTPSN-------------------------------ESSFRVETDSFGEIKVPS
NCAS0D02620        -MLKLKLANPT----ILRLQASRMSLST---------TTAASQQQYRIETDSFGEIKVPA
Suva_16.43         -MLRFSNSSCK---AILQSSYKVNIRRM--------------NSTFRTETDAFGEINVPA
Skud_16.16         -MLRFSNFNCK---AVLQSSYKVNLRRM--------------NSTFRIETDAFGEINVPA
YPL262W            -MLRFTNCSCK---TFVKSSYKLNIRRM--------------NSSFRTETDAFGEIHVPA
Smik_6.470         -MLRLTNSSCK---AFVQSSYKFNIRRM--------------NSTFRTETDAFGEINVPA
CAGL0A01045g       -MLRASSRAKT---SLIGYSARMM--------------------HYRVETDTFGEIKVPA
ACR013C            -MLRLSRGCVG------SSAARRLMSTA------------GAPQQFRVETDAFGEIRVPA
TPHA0J00270        -MSSVIRNVPRGVKSVAKVQKTGMHQSM---------RCLSDEAGFRIETDGFGEIKVPA
Kpol_1045.76       -MLRSAIRPNT----------VRVQTRY-----------ISNLKGFRVETDGFGEIKVPA
Kpol_1032.4        MSF---------------------------------------PNGFRLETDGFGEIKVPA
KLLA0D00902g       -MLRNSIVSRGLAQTRVSAKVNRLASLR--------------MVSYRVETDAFGEIQVPS
TDEL0G04580        -MLRTGLLSRP-------LSVVKMSTKA---------------GQFRVETDAFGEIKVAA
Ecym_3016          -MFSASKKIPA------KRIADRMMSTT-----------AGLNQKFRIETDAFGEIKVPA
SAKL0E00946g       -MLRITAAANR---NLLPSSSIRMLSTS----------SSLAQQKYRIETDAFGEIKVPA
KLTH0C11462g       -MFKLTAEVAN--KSLSGSPKTRLISTS-----------SAISQKCRVETDAFGEINVPA
Kwal_56.22362      -MFKVTTEAAN--KALISGSKARLISTS-----------SSLGQKYRVETDAFGEIKVPT
                                                                 * *.* ***: *. 

TBLA0A07130        NKYWGAQTQRSFMNFKIGGERERMPEPIIRAFGQQKKAAAIVNNSLGTLDDTLKDAIVQA
TBLA0G01000        NKYWGAQTQRALNNFHIGGERERMPEPLILAYGILKKSVAIVNESLGTLDPKISKAIQEA
KAFR0B06520        DKYWGAQTQRSLQNFKIGGEREKIPIPIIEAFGILKKSAAIVNERLGTLDSELAKNIIIA
KNAG0E02750        DRYWGAQTQRSFQNFKIGGDREKIPEPVVRAFGILKKSAATVNENLGTLDKSIAAKIKLA
ZYRO0C07964g       DKYWGAQTQRSFENFRIGGQRERMPEAVVHAFGILKKATATVNEANGQLDPKLAVAIKQA
NDAI0I02470        NKYWGAQTQRSFQNFKIGGEREKIPLPIIKAFGILKKSAAIVNQSLGTLDPSIATPIIKA
NCAS0D02620        DKYWGAQTQRSFQNFKIGGSRERIPDPIITAFGILKKSAAIVNESLGTLDPKVADPIKKA
Suva_16.43         DKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAIVNESLGGLDPKVSKAIQQA
Skud_16.16         DKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAVVNESLGGLDPKISKAIQQA
YPL262W            DKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAIVNESLGGLDPKISKAIQQA
Smik_6.470         DKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAIVNESLGGLDPKISKAIQEA
CAGL0A01045g       DKYWGAQTQRSFQNFKIGGARERMPEPIVRAFGVLKKSAAIVNEKLGTLDSEIAGPIQQA
ACR013C            DKYWGAQTQRSLENFRIGGARERMPEPVVRAFGVLKKSAAVVNEQLGTLEPGIAKAIQQA
TPHA0J00270        NKYWGAQTERSFENFRIGGPRERMPDPVVKAFGVLKKSAAIVNEGYGTLDPQISKVIQEA
Kpol_1045.76       NKYWGAQTERSFENFKIGGSRERMPEAVVRAFGVLKKCAAIVNTELGGLDPATSKLIQQA
Kpol_1032.4        DKYWGAQTQRSYENFKIGGPRERMPEPVVKAFGVLKKSAAIVNEEFGILDAGISKLIQQA
KLLA0D00902g       DKYWGAQTQRSLQNFKIGGPRERMPEPIVKAFGVLKKSAAVVNERLGTLDPEIAKPIKQA
TDEL0G04580        DRYWGAQTQRSLENFRIGGPRERMPEPIVRAFGVLKKSAAVVNESLGTLDPKVAEPIKQA
Ecym_3016          NKYWGAQTQRSLENFKIGGPRERMPEPIIKAFGILKKSAAIVNESLGTLDPKISKPIQQA
SAKL0E00946g       DKYWGAQTQRSFENFKIGGARERMPEAVVRAFGVLKKSAAIVNESLGTLDPEISKPIQKA
KLTH0C11462g       DKYWGAQTQRSLENFKIGGARERMPEPVVRAFGILKKSAAIVNESLGTLDPKISKPIQQA
Kwal_56.22362      DKLWGAQTQRSLENFKIGGQRERMPEPIVKAFGILKKSAAIVNESLGTLDPKVSKPIQDA
                   :. *****:*:  **.*** **.:* .:: *:*  **..* **   * *:      *  *

TBLA0A07130        AEEVSQGLLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGTLGSKQVHPNNHVNQS
TBLA0G01000        ADEVAKGSLNEHFPLVVFQTGSGTQTNMNVNEVISNRAIEILGGQLGSKTVHPNNHVNQS
KAFR0B06520        ADEVSQGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELMGGKLGSKTVHPNNHVNQS
KNAG0E02750        ADEVAEGKLSDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGELGSKQVHPNNHVNQS
ZYRO0C07964g       ADEVASGKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGKLGSKSVHPNNHINMS
NDAI0I02470        SDEVIQGKLNDHFPLVVFQTGSGTQTNMNANEVISNRANELIGAELGSKKIHPNNHVNQS
NCAS0D02620        ADEVVQGKLKDHFPLVVFQTGSGTQTNMNVNEVISNRAIELVGGKLGSKQIHPNNHCNQS
Suva_16.43         ADEVAAGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGKIGSKQVHPNNDCNQS
Skud_16.16         ADEVTSGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGKIGSKEVHPNNHCNQS
YPL262W            ADEVASGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGKIGSKQVHPNNHCNQS
Smik_6.470         ADEVASGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGKIGSKEVHPNNHCNQS
CAGL0A01045g       ADEVAKGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGELGSKKIHPNNHCNQA
ACR013C            ADEVAQGQLMEHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGELGSKQVHPNNHCNQA
TPHA0J00270        ADEVIQGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGTLGSKQVHPNNHVNQA
Kpol_1045.76       ADEVATGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGVLGSKEIHPNNHCNMA
Kpol_1032.4        ADEVIEGKLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGIMGSKEIHPNNHCNMA
KLLA0D00902g       ADEVAQGKLMEHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGELGSKKIHPNNHCNQA
TDEL0G04580        ADEVAQGKLTAHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGELGSKQIHPNNHCNQA
Ecym_3016          ADEVIEGKLLDHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGELGTKQIHPNNHCNQA
SAKL0E00946g       ADEVIQGKLMDHFPLVVFQTGSGTQSNMNANEVISNRAIEIIGGEKGSKQVHPNNHCNQA
KLTH0C11462g       ADEVISGKLVDHFPLVVFQTGSGTQSNMNANEVISNRAIEIVGGKMGTKSIHPNNHCNQA
Kwal_56.22362      ADEVISGKLIDHFPLVVFQTGSGTQSNMNANEVISNRAIQLVGGEVGSKSIHPNNHCNQA
                   ::**  * *  **************:***.******** :: *.  *:* :****  * :

TBLA0A07130        QSSNDTFPTVMHIAALTEITNTLLPNLIVLRETLDSKAKEFEKIIKIGRTHLQDATPLTL
TBLA0G01000        QSTNDSFPTAMHISAVREVVFKLLPELEKLRDALKDKSIEFNKIVKIGRTHLQDATPLTL
KAFR0B06520        QSSNDTFPTVMHIAAMLEITRKLLPELNSLKNSLDKKSNEFNDIVKIGRTHLQDATPLTL
KNAG0E02750        QSSNDTFPTVMHIAATTEIANKLIPELQNLKDALQHKVEEFSSIVKIGRTHLQDATPLTL
ZYRO0C07964g       QSSNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTL
NDAI0I02470        QSSNDTFPSVMHIAAVLELNNNLIPQLTELKNSLDNKAKEYANIVKIGRTHLQDATPLTL
NCAS0D02620        QSSNDTFPSVMHIAAVLEITNSLIPELTKLKDALDVKAKEFADIVKIGRTHLQDATPLTL
Suva_16.43         QSSNDTFPTVMHIAASLQIEKELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTL
Skud_16.16         QSSNDTFPTVMHIAASLQIQNELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTL
YPL262W            QSSNDTFPTVMHIAASLQIQNELIPELTNLKNALEAKSKEFDHIVKIGRTHLQDATPLTL
Smik_6.470         QSSNDTFPTVMHIAASLQIQNELIPELANLKNALEAKSKEFDHIVKIGRTHLQDATPLTL
CAGL0A01045g       QSSNDTFPSVMHIAAVTEITNSLLPEITQLKDALHKKAEEFQDIVKIGRTHLQDATPLTL
ACR013C            QSSNDTFPSVMHIAAVTEITRSLLPELEALRVSFQRKTDEFAHIVKIGRTHLQDATPLTL
TPHA0J00270        QSSNDSFPTVMHIAAVTEITDHLIPEVANLRDALESKSKDFAHIVKIGRTHLQDATPLTL
Kpol_1045.76       QSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTL
Kpol_1032.4        QSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFEHIVKIGRTHLQDATPLTL
KLLA0D00902g       QSSNDTFPSVMHIAAVTEITHHLLPELEGLKVALKQKSDEFQHIVKIGRTHLQDATPLTL
TDEL0G04580        QSSNDTFPSVMHIAAVTEITRHLLPELAHLRDSLDAKSKEFSDIVKIGRTHLQDATPLTL
Ecym_3016          QSSNDTFPSVMHIAAVTEITNTLLPELTALRDSFQKKTEEFSHIVKIGRTHLQDATPLTL
SAKL0E00946g       QSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTL
KLTH0C11462g       QSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFATKSKEFESIVKIGRTHLQDATPLTL
Kwal_56.22362      QSSNDTFPSVMHIAAVTEVTHLLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTL
                   **:**:**:.***:*   :   *:*::  *. ::  *  ::  *:***************

TBLA0A07130        GQEFSGYTQQLTNAIKRIEKNLPELQYIAQGGTAVGTGLNTKIGFAEQFARQLSNQTNLS
TBLA0G01000        GQEFSGYVQQVENGITRVQNSLTNLKFIAQGGTAVGTGINTKKDFDILVAKQISLETGIE
KAFR0B06520        GQEFSGYVQQMTNGIRRIETALYHLKFLAQGGTAVGTGLNTKAGFDKLIAEQISEETGIN
KNAG0E02750        GQEFSGYVQQVENGIQRVQSSLYHLHFLAQGGTAVGTGLNTKVGFDKLVAEEVSKETGLH
ZYRO0C07964g       GQEFSGYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTKIGWAENVAAEVAKETGID
NDAI0I02470        GQEFSGYVQQLTNGIERIQASLYHLKFLAQGGTAVGTGLNTKVGFDKMIAQEVSKETGID
NCAS0D02620        GQEFSGYVQQLENGIYRIESSLYHLKFLAQGGTAVGTGLNTKIGFDKLIAEEVSKETGIE
Suva_16.43         GQEFSGYVQQVENGIQRVAHTLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLK
Skud_16.16         GQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGFDIKIAEQISSETGLK
YPL262W            GQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLK
Smik_6.470         GQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLK
CAGL0A01045g       GQEFSGYVQQLVNGIARIENTLPHLKYLAQGGTAVGTGLNTKEGFDKLIAEQISKETGID
ACR013C            GQEFSGYTQQIANGIARVEHAQESLRFLAQGGTAVGTGLNTRRGFAEQIAAQVSRETGLE
TPHA0J00270        GQEFSGYVQQLTNGIGRIEHSLINLKFLAQGGTAVGTGLNTRIGFAEKIAEQISKETGVA
Kpol_1045.76       GQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGTGLNTKNGWAERIAAEISKETGLA
Kpol_1032.4        GQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVGTGLNTKIGFAERIAEQVSKETGIE
KLLA0D00902g       GQEFSGYVQQVENGIARVKQSLYHLKFLAQGGTAVGTGLNTKVGFAEDIAEQVSKETGID
TDEL0G04580        GQEFSGYVQQVSNGIDRVEGSLHRLKYLAQGGTAVGTGLNTKIGFAEKIAEQVSKETGLD
Ecym_3016          GQEFGGYTQQITNGITRVEQSLHHLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETNIE
SAKL0E00946g       GQEFSGYVQQLTNGIARVEQSLHHLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGID
KLTH0C11462g       GQEFSGYVQQLTNGISRVEQSLIHLKFLAQGGTAVGTGLNTKVGFGEKIAEQVSKETGID
Kwal_56.22362      GQEFSGYVQQLTNGISRVEHSLHNLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGID
                   ****.**.**: *.* *:      *  :**********:**. .:   .* ::: :*.: 

TBLA0A07130        FLTSPNKFESLAAHDAIVNVHASLNTLACSLFKISQDIRYLASGPRCGYGELSIPENEPG
TBLA0G01000        FKTAPNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLGSGPRCGYGELSLPENEPG
KAFR0B06520        FETAPNKFEALAAHDAIVEVSGALNTLACSLFKIAQDIRYLGSGPRCGYGELSLPENEPG
KNAG0E02750        FETAPNKFEALAAHDAIVEASGALNTLACSLFKIAQDIRYLGSGPRCGYGELILPANEPG
ZYRO0C07964g       FQTAPNKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPG
NDAI0I02470        FETAPNKFEALAAHDAIVFASSAITTVAGSLFKIAQDIRYLGSGPRCGYGELQLPENEPG
NCAS0D02620        FKTAPNKFEALAAHDAIVFASGALNTVAGSLFKIAQDIRYLGSGPRCGYGELQLPENEPG
Suva_16.43         FQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLPENEPG
Skud_16.16         FQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPG
YPL262W            FQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPG
Smik_6.470         FQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPG
CAGL0A01045g       FKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELHLPENEPG
ACR013C            FRTAPNKFEALAAHDAVVEASGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPG
TPHA0J00270        FKTAPNKFEALAAHDAIVEASGAITTVATSLFKIAQDIRYLGSGPRCGYGELSLPENEPG
Kpol_1045.76       FKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPG
Kpol_1032.4        FKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPG
KLLA0D00902g       FKTAPNKFEALAAHDAVVEASGALNTLAVSLFKIANDIRYLGSGPRCGYGELSLPENEPG
TDEL0G04580        FKTAPNKFEALAAHDAVVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPG
Ecym_3016          FKTAPNKFEALAAHDAVVECSGALNTVACSLFKIANDIRYLGSGPRCGYGELSLPENEPG
SAKL0E00946g       FKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPG
KLTH0C11462g       FKTAPNKFEALAAHDAIVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPG
Kwal_56.22362      FKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPG
                   * *:*****:**:***:*   .::.*:* *****::***:*.******* ** :* ****

TBLA0A07130        SSIMPGKVNPTQNEAMCQACVQVMGNNSTISFAGASGQFELNTYKPLMIANLLSSTRLLS
TBLA0G01000        SSIMPGKVNPTQNEAMCQACIQVMGNNSAITFAGASGQFELNTYKPLMISNLLNSIRLLT
KAFR0B06520        SSIMPGKVNPTQNEAMTQVCIQVMGNHSTITFAGSQGQFELNVYKPLLISNLLSSIRLLT
KNAG0E02750        SSIMPGKVNPTQNEAMTQVCVQVMGNNSTITFAGSQGQFELNVYKPLMISNLLSSIRLLT
ZYRO0C07964g       SSIMPGKVNPTQNEALTQVCVQVFGNHSAITFAGASGQFELNVFKPVMISNLLSSINLLS
NDAI0I02470        SSIMPGKVNPTQNEAMTQVALQIMGNNQTIVMAGSQGQFELNVYKPLMIANLLNSIRLMS
NCAS0D02620        SSIMPGKVNPTQNEAMTQVCVQIMGNNQTISIAGSQGQFELNVYKPLMIANLLNSIRLMT
Suva_16.43         SSIMPGKVNPTQNEALTQVCVQVMGNNAAITFGGSQGQFELNVFKPVMIANLLNSIRLIA
Skud_16.16         SSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFELNVFKPVMIANLLNSIRLIT
YPL262W            SSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFELNVFKPVMIANLLNSIRLIT
Smik_6.470         SSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFELNVFKPVMIANLLNSIRLIT
CAGL0A01045g       SSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGANGQFELNVFKPVMISNLLSSIRLLA
ACR013C            SSIMPGKVNPTQNEALTQACVQVMGNNAAITFAGASGQFELNVFKPVMIANLLSSVRLLA
TPHA0J00270        SSIMPGKINPTQNEAVTQVCAQIIGNNQTIIFAGTQGQFELNVFKPVMISNLLSSIRLLG
Kpol_1045.76       SSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGASGQFELNVFKPVLISNLLSSVQLLG
Kpol_1032.4        SSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSIRLLG
KLLA0D00902g       SSIMPGKVNPTQNEAMTQVCVQVMGNHAAITFAGASGQFELNVFKPVMISNLLSSIRLLG
TDEL0G04580        SSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLA
Ecym_3016          SSIMPGKVNPTQNEAMTQACVQVMGNNSTITFAGASGQFELNVFKPVMISNLLNSIRLLA
SAKL0E00946g       SSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLA
KLTH0C11462g       SSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLG
Kwal_56.22362      SSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSIRLLG
                   *******:*******: *.. *::**: :: :.*:.******.:**::*:***.* .*: 

TBLA0A07130        DAIFSFNLHCATGIQANKDKIDRLLHESLMLVTSLNPKIGYDAASKVAKNAHHKGITLKQ
TBLA0G01000        DSCNSFRIHCIVGIRANEDKINKLLNESLMLVTALNPKIGYDAATAIAKDAHKNGLTLKE
KAFR0B06520        DASYSFRVHCIDGLKANRENITENLNKSLMLVTALNPYIGYDNASKIAKNAHHKNITLKE
KNAG0E02750        DASKSFRIHCLNDLKANKDKIDENLNKSLMLVTALNPKIGYDAAAKVAKNAHHKNITLKE
ZYRO0C07964g       DASYSFRVHCVDGIQANRENIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKNGITLKE
NDAI0I02470        DACHSFKIHCVDGLKANTDKINENLHKSLMLVTALNPKIGYDAASKLAKNAHAKNITLKE
NCAS0D02620        DACKSFRIHCIDDLKANKDKINENLNKSLMLVTALNPKIGYDAASKIAKNAHLKNITLKE
Suva_16.43         DASRSFRIHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKE
Skud_16.16         DSAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKE
YPL262W            DAAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKE
Smik_6.470         DAAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKE
CAGL0A01045g       DACHSFRVHCVEGIEANREKINHNLHNSLMLVTALNPKIGYDAASKIAKNAFKKNITLKE
ACR013C            DAARSFRVHCVDGIQDNEDRIAKLLHESLMLVTALNPKIGYDAASAVAKNAHKKGITLRA
TPHA0J00270        DVSKSFRIHCVEGIKANEERIADLMNKSLMLVTALNPKIGYDEATKVAKNAHKKGITLKE
Kpol_1045.76       DASRSFRVHCVEGIKANEAKISELLHRSLMLVTALNPKIGYDAATKVAKNAHKKGITLKE
Kpol_1032.4        DACHSFTIHCVEGIQANEDKINKLLHESLMLVTALNPKIGYDSATKVAKNAHKKGITLKE
KLLA0D00902g       DASNSFRIHCVEGIKANEDRIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKE
TDEL0G04580        DASYSFRVHCVDGIIANRDRIGKLMHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKQ
Ecym_3016          DASYSFRVHCVDGIKANEDKIAKILHESLMLVTALNPKIGYDSACKVAKNAHKKNITLKE
SAKL0E00946g       DASYSFRVHCVDGIKANEDRISKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKE
KLTH0C11462g       DACYSFRVHCVDGIEANRDKIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKE
Kwal_56.22362      DACYSFRVHCVEGIQANEDKIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKE
                   *   ** :**  .:  *  .*   :  ******:*** **** *  :**:*. :.:**. 

TBLA0A07130        SALELDILSSKQFDEWVRPENMLGPN-
TBLA0G01000        AALKSKLLTAEQFDEWIVPESMVHPSE
KAFR0B06520        SALELGLLTEEQFSEWVIPEKMIGPKQ
KNAG0E02750        SALELGVLTEKEFDEWVIPENMISPKP
ZYRO0C07964g       SALQLNILTAEEFDHWVVPEHMIGPKP
NDAI0I02470        SALELGLLTEEEFDQWVIPENMIGPKP
NCAS0D02620        SALELKYLTAEEFDEWVVPENMIGPKP
Suva_16.43         SALELGVLTEKEFDEWVVPENMLGPK-
Skud_16.16         SALELGVLTEKEFDEWVVPENMLGPK-
YPL262W            SALELGVLTEKEFDEWVVPEHMLGPK-
Smik_6.470         SALELGVLTEKEFDEWVVPENMLGPK-
CAGL0A01045g       SALELKYLTSEEFDEWVIPENMVGPTK
ACR013C            SALELGVLTDAEFDEWVVPEKMIGPRD
TPHA0J00270        SAMQLGSLTESEFDEWVVPEKMIGPK-
Kpol_1045.76       SALELGVLTEKEFDEWVVPEKMLGPSS
Kpol_1032.4        SALELGVLTEDEFDEWVVPEKMLGPS-
KLLA0D00902g       SALELKVLSSEEFDQWVIPEKMIGPKE
TDEL0G04580        SALDLGVLTESEFDEWVVPENMIGPKP
Ecym_3016          SALELGVLSEEEFSEWVVPEKMIGPTK
SAKL0E00946g       SALQLGVLNEKEFDEWVIPEKMIGPKE
KLTH0C11462g       SALELKVLTSAEFDQWVVPENMVGPK-
Kwal_56.22362      SALELGVLSSAEFDEWVVPENMVGPKP
                   :*:.   *.  :*. *: ** *: *  

FASTA FORMAT for MUSCLE Version 3.6

>TBLA0A07130
-MLKSAATLRQ---PVVSLNIFRNCQRS--FSITPVSHSIADLQGTRTETDSFGEIQVPA
NKYWGAQTQRSFMNFKIGGERERMPEPIIRAFGQQKKAAAIVNNSLGTLDDTLKDAIVQA
AEEVSQGLLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGTLGSKQVHPNNHVNQS
QSSNDTFPTVMHIAALTEITNTLLPNLIVLRETLDSKAKEFEKIIKIGRTHLQDATPLTL
GQEFSGYTQQLTNAIKRIEKNLPELQYIAQGGTAVGTGLNTKIGFAEQFARQLSNQTNLS
FLTSPNKFESLAAHDAIVNVHASLNTLACSLFKISQDIRYLASGPRCGYGELSIPENEPG
SSIMPGKVNPTQNEAMCQACVQVMGNNSTISFAGASGQFELNTYKPLMIANLLSSTRLLS
DAIFSFNLHCATGIQANKDKIDRLLHESLMLVTSLNPKIGYDAASKVAKNAHHKGITLKQ
SALELDILSSKQFDEWVRPENMLGPN-
>TBLA0G01000
------------------------------------------MPETRIEVDGFGELEVPA
NKYWGAQTQRALNNFHIGGERERMPEPLILAYGILKKSVAIVNESLGTLDPKISKAIQEA
ADEVAKGSLNEHFPLVVFQTGSGTQTNMNVNEVISNRAIEILGGQLGSKTVHPNNHVNQS
QSTNDSFPTAMHISAVREVVFKLLPELEKLRDALKDKSIEFNKIVKIGRTHLQDATPLTL
GQEFSGYVQQVENGITRVQNSLTNLKFIAQGGTAVGTGINTKKDFDILVAKQISLETGIE
FKTAPNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLGSGPRCGYGELSLPENEPG
SSIMPGKVNPTQNEAMCQACIQVMGNNSAITFAGASGQFELNTYKPLMISNLLNSIRLLT
DSCNSFRIHCIVGIRANEDKINKLLNESLMLVTALNPKIGYDAATAIAKDAHKNGLTLKE
AALKSKLLTAEQFDEWIVPESMVHPSE
>KAFR0B06520
MMINISSKGSIVHLVKLTSYTSRFYTMS------------SIKSSFRAETDSFGEINVPN
DKYWGAQTQRSLQNFKIGGEREKIPIPIIEAFGILKKSAAIVNERLGTLDSELAKNIIIA
ADEVSQGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELMGGKLGSKTVHPNNHVNQS
QSSNDTFPTVMHIAAMLEITRKLLPELNSLKNSLDKKSNEFNDIVKIGRTHLQDATPLTL
GQEFSGYVQQMTNGIRRIETALYHLKFLAQGGTAVGTGLNTKAGFDKLIAEQISEETGIN
FETAPNKFEALAAHDAIVEVSGALNTLACSLFKIAQDIRYLGSGPRCGYGELSLPENEPG
SSIMPGKVNPTQNEAMTQVCIQVMGNHSTITFAGSQGQFELNVYKPLLISNLLSSIRLLT
DASYSFRVHCIDGLKANRENITENLNKSLMLVTALNPYIGYDNASKIAKNAHHKNITLKE
SALELGLLTEEQFSEWVIPEKMIGPKQ
>KNAG0E02750
-MIRSVFNSSGKASVKVALLRNNLRRNM--------SASAITNQEFRVETDSFGEINVPA
DRYWGAQTQRSFQNFKIGGDREKIPEPVVRAFGILKKSAATVNENLGTLDKSIAAKIKLA
ADEVAEGKLSDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGELGSKQVHPNNHVNQS
QSSNDTFPTVMHIAATTEIANKLIPELQNLKDALQHKVEEFSSIVKIGRTHLQDATPLTL
GQEFSGYVQQVENGIQRVQSSLYHLHFLAQGGTAVGTGLNTKVGFDKLVAEEVSKETGLH
FETAPNKFEALAAHDAIVEASGALNTLACSLFKIAQDIRYLGSGPRCGYGELILPANEPG
SSIMPGKVNPTQNEAMTQVCVQVMGNNSTITFAGSQGQFELNVYKPLMISNLLSSIRLLT
DASKSFRIHCLNDLKANKDKIDENLNKSLMLVTALNPKIGYDAAAKVAKNAHHKNITLKE
SALELGVLTEKEFDEWVIPENMISPKP
>ZYRO0C07964g
-MLRLSSNVLK-NSCVCQVSSPRLTSKTPMSQISQLHTTTPWLQEHRVETDAFGEIKVPA
DKYWGAQTQRSFENFRIGGQRERMPEAVVHAFGILKKATATVNEANGQLDPKLAVAIKQA
ADEVASGKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGKLGSKSVHPNNHINMS
QSSNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTL
GQEFSGYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTKIGWAENVAAEVAKETGID
FQTAPNKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPG
SSIMPGKVNPTQNEALTQVCVQVFGNHSAITFAGASGQFELNVFKPVMISNLLSSINLLS
DASYSFRVHCVDGIQANRENIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKNGITLKE
SALQLNILTAEEFDHWVVPEHMIGPKP
>NDAI0I02470
-MSTNSKTPSN-------------------------------ESSFRVETDSFGEIKVPS
NKYWGAQTQRSFQNFKIGGEREKIPLPIIKAFGILKKSAAIVNQSLGTLDPSIATPIIKA
SDEVIQGKLNDHFPLVVFQTGSGTQTNMNANEVISNRANELIGAELGSKKIHPNNHVNQS
QSSNDTFPSVMHIAAVLELNNNLIPQLTELKNSLDNKAKEYANIVKIGRTHLQDATPLTL
GQEFSGYVQQLTNGIERIQASLYHLKFLAQGGTAVGTGLNTKVGFDKMIAQEVSKETGID
FETAPNKFEALAAHDAIVFASSAITTVAGSLFKIAQDIRYLGSGPRCGYGELQLPENEPG
SSIMPGKVNPTQNEAMTQVALQIMGNNQTIVMAGSQGQFELNVYKPLMIANLLNSIRLMS
DACHSFKIHCVDGLKANTDKINENLHKSLMLVTALNPKIGYDAASKLAKNAHAKNITLKE
SALELGLLTEEEFDQWVIPENMIGPKP
>NCAS0D02620
-MLKLKLANPT----ILRLQASRMSLST---------TTAASQQQYRIETDSFGEIKVPA
DKYWGAQTQRSFQNFKIGGSRERIPDPIITAFGILKKSAAIVNESLGTLDPKVADPIKKA
ADEVVQGKLKDHFPLVVFQTGSGTQTNMNVNEVISNRAIELVGGKLGSKQIHPNNHCNQS
QSSNDTFPSVMHIAAVLEITNSLIPELTKLKDALDVKAKEFADIVKIGRTHLQDATPLTL
GQEFSGYVQQLENGIYRIESSLYHLKFLAQGGTAVGTGLNTKIGFDKLIAEEVSKETGIE
FKTAPNKFEALAAHDAIVFASGALNTVAGSLFKIAQDIRYLGSGPRCGYGELQLPENEPG
SSIMPGKVNPTQNEAMTQVCVQIMGNNQTISIAGSQGQFELNVYKPLMIANLLNSIRLMT
DACKSFRIHCIDDLKANKDKINENLNKSLMLVTALNPKIGYDAASKIAKNAHLKNITLKE
SALELKYLTAEEFDEWVVPENMIGPKP
>Suva_16.43
-MLRFSNSSCK---AILQSSYKVNIRRM--------------NSTFRTETDAFGEINVPA
DKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAIVNESLGGLDPKVSKAIQQA
ADEVAAGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGKIGSKQVHPNNDCNQS
QSSNDTFPTVMHIAASLQIEKELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTL
GQEFSGYVQQVENGIQRVAHTLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLK
FQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLPENEPG
SSIMPGKVNPTQNEALTQVCVQVMGNNAAITFGGSQGQFELNVFKPVMIANLLNSIRLIA
DASRSFRIHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKE
SALELGVLTEKEFDEWVVPENMLGPK-
>Skud_16.16
-MLRFSNFNCK---AVLQSSYKVNLRRM--------------NSTFRIETDAFGEINVPA
DKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAVVNESLGGLDPKISKAIQQA
ADEVTSGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGKIGSKEVHPNNHCNQS
QSSNDTFPTVMHIAASLQIQNELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTL
GQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGFDIKIAEQISSETGLK
FQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPG
SSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFELNVFKPVMIANLLNSIRLIT
DSAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKE
SALELGVLTEKEFDEWVVPENMLGPK-
>YPL262W
-MLRFTNCSCK---TFVKSSYKLNIRRM--------------NSSFRTETDAFGEIHVPA
DKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAIVNESLGGLDPKISKAIQQA
ADEVASGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGKIGSKQVHPNNHCNQS
QSSNDTFPTVMHIAASLQIQNELIPELTNLKNALEAKSKEFDHIVKIGRTHLQDATPLTL
GQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLK
FQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPG
SSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFELNVFKPVMIANLLNSIRLIT
DAAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKE
SALELGVLTEKEFDEWVVPEHMLGPK-
>Smik_6.470
-MLRLTNSSCK---AFVQSSYKFNIRRM--------------NSTFRTETDAFGEINVPA
DKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAIVNESLGGLDPKISKAIQEA
ADEVASGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGKIGSKEVHPNNHCNQS
QSSNDTFPTVMHIAASLQIQNELIPELANLKNALEAKSKEFDHIVKIGRTHLQDATPLTL
GQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLK
FQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPG
SSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFELNVFKPVMIANLLNSIRLIT
DAAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKE
SALELGVLTEKEFDEWVVPENMLGPK-
>CAGL0A01045g
-MLRASSRAKT---SLIGYSARMM--------------------HYRVETDTFGEIKVPA
DKYWGAQTQRSFQNFKIGGARERMPEPIVRAFGVLKKSAAIVNEKLGTLDSEIAGPIQQA
ADEVAKGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGELGSKKIHPNNHCNQA
QSSNDTFPSVMHIAAVTEITNSLLPEITQLKDALHKKAEEFQDIVKIGRTHLQDATPLTL
GQEFSGYVQQLVNGIARIENTLPHLKYLAQGGTAVGTGLNTKEGFDKLIAEQISKETGID
FKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELHLPENEPG
SSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGANGQFELNVFKPVMISNLLSSIRLLA
DACHSFRVHCVEGIEANREKINHNLHNSLMLVTALNPKIGYDAASKIAKNAFKKNITLKE
SALELKYLTSEEFDEWVIPENMVGPTK
>ACR013C
-MLRLSRGCVG------SSAARRLMSTA------------GAPQQFRVETDAFGEIRVPA
DKYWGAQTQRSLENFRIGGARERMPEPVVRAFGVLKKSAAVVNEQLGTLEPGIAKAIQQA
ADEVAQGQLMEHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGELGSKQVHPNNHCNQA
QSSNDTFPSVMHIAAVTEITRSLLPELEALRVSFQRKTDEFAHIVKIGRTHLQDATPLTL
GQEFSGYTQQIANGIARVEHAQESLRFLAQGGTAVGTGLNTRRGFAEQIAAQVSRETGLE
FRTAPNKFEALAAHDAVVEASGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPG
SSIMPGKVNPTQNEALTQACVQVMGNNAAITFAGASGQFELNVFKPVMIANLLSSVRLLA
DAARSFRVHCVDGIQDNEDRIAKLLHESLMLVTALNPKIGYDAASAVAKNAHKKGITLRA
SALELGVLTDAEFDEWVVPEKMIGPRD
>TPHA0J00270
-MSSVIRNVPRGVKSVAKVQKTGMHQSM---------RCLSDEAGFRIETDGFGEIKVPA
NKYWGAQTERSFENFRIGGPRERMPDPVVKAFGVLKKSAAIVNEGYGTLDPQISKVIQEA
ADEVIQGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGTLGSKQVHPNNHVNQA
QSSNDSFPTVMHIAAVTEITDHLIPEVANLRDALESKSKDFAHIVKIGRTHLQDATPLTL
GQEFSGYVQQLTNGIGRIEHSLINLKFLAQGGTAVGTGLNTRIGFAEKIAEQISKETGVA
FKTAPNKFEALAAHDAIVEASGAITTVATSLFKIAQDIRYLGSGPRCGYGELSLPENEPG
SSIMPGKINPTQNEAVTQVCAQIIGNNQTIIFAGTQGQFELNVFKPVMISNLLSSIRLLG
DVSKSFRIHCVEGIKANEERIADLMNKSLMLVTALNPKIGYDEATKVAKNAHKKGITLKE
SAMQLGSLTESEFDEWVVPEKMIGPK-
>Kpol_1045.76
-MLRSAIRPNT----------VRVQTRY-----------ISNLKGFRVETDGFGEIKVPA
NKYWGAQTERSFENFKIGGSRERMPEAVVRAFGVLKKCAAIVNTELGGLDPATSKLIQQA
ADEVATGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGVLGSKEIHPNNHCNMA
QSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTL
GQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGTGLNTKNGWAERIAAEISKETGLA
FKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPG
SSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGASGQFELNVFKPVLISNLLSSVQLLG
DASRSFRVHCVEGIKANEAKISELLHRSLMLVTALNPKIGYDAATKVAKNAHKKGITLKE
SALELGVLTEKEFDEWVVPEKMLGPSS
>Kpol_1032.4
MSF---------------------------------------PNGFRLETDGFGEIKVPA
DKYWGAQTQRSYENFKIGGPRERMPEPVVKAFGVLKKSAAIVNEEFGILDAGISKLIQQA
ADEVIEGKLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGIMGSKEIHPNNHCNMA
QSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFEHIVKIGRTHLQDATPLTL
GQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVGTGLNTKIGFAERIAEQVSKETGIE
FKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPG
SSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSIRLLG
DACHSFTIHCVEGIQANEDKINKLLHESLMLVTALNPKIGYDSATKVAKNAHKKGITLKE
SALELGVLTEDEFDEWVVPEKMLGPS-
>KLLA0D00902g
-MLRNSIVSRGLAQTRVSAKVNRLASLR--------------MVSYRVETDAFGEIQVPS
DKYWGAQTQRSLQNFKIGGPRERMPEPIVKAFGVLKKSAAVVNERLGTLDPEIAKPIKQA
ADEVAQGKLMEHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGELGSKKIHPNNHCNQA
QSSNDTFPSVMHIAAVTEITHHLLPELEGLKVALKQKSDEFQHIVKIGRTHLQDATPLTL
GQEFSGYVQQVENGIARVKQSLYHLKFLAQGGTAVGTGLNTKVGFAEDIAEQVSKETGID
FKTAPNKFEALAAHDAVVEASGALNTLAVSLFKIANDIRYLGSGPRCGYGELSLPENEPG
SSIMPGKVNPTQNEAMTQVCVQVMGNHAAITFAGASGQFELNVFKPVMISNLLSSIRLLG
DASNSFRIHCVEGIKANEDRIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKE
SALELKVLSSEEFDQWVIPEKMIGPKE
>TDEL0G04580
-MLRTGLLSRP-------LSVVKMSTKA---------------GQFRVETDAFGEIKVAA
DRYWGAQTQRSLENFRIGGPRERMPEPIVRAFGVLKKSAAVVNESLGTLDPKVAEPIKQA
ADEVAQGKLTAHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGELGSKQIHPNNHCNQA
QSSNDTFPSVMHIAAVTEITRHLLPELAHLRDSLDAKSKEFSDIVKIGRTHLQDATPLTL
GQEFSGYVQQVSNGIDRVEGSLHRLKYLAQGGTAVGTGLNTKIGFAEKIAEQVSKETGLD
FKTAPNKFEALAAHDAVVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPG
SSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLA
DASYSFRVHCVDGIIANRDRIGKLMHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKQ
SALDLGVLTESEFDEWVVPENMIGPKP
>Ecym_3016
-MFSASKKIPA------KRIADRMMSTT-----------AGLNQKFRIETDAFGEIKVPA
NKYWGAQTQRSLENFKIGGPRERMPEPIIKAFGILKKSAAIVNESLGTLDPKISKPIQQA
ADEVIEGKLLDHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGELGTKQIHPNNHCNQA
QSSNDTFPSVMHIAAVTEITNTLLPELTALRDSFQKKTEEFSHIVKIGRTHLQDATPLTL
GQEFGGYTQQITNGITRVEQSLHHLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETNIE
FKTAPNKFEALAAHDAVVECSGALNTVACSLFKIANDIRYLGSGPRCGYGELSLPENEPG
SSIMPGKVNPTQNEAMTQACVQVMGNNSTITFAGASGQFELNVFKPVMISNLLNSIRLLA
DASYSFRVHCVDGIKANEDKIAKILHESLMLVTALNPKIGYDSACKVAKNAHKKNITLKE
SALELGVLSEEEFSEWVVPEKMIGPTK
>SAKL0E00946g
-MLRITAAANR---NLLPSSSIRMLSTS----------SSLAQQKYRIETDAFGEIKVPA
DKYWGAQTQRSFENFKIGGARERMPEAVVRAFGVLKKSAAIVNESLGTLDPEISKPIQKA
ADEVIQGKLMDHFPLVVFQTGSGTQSNMNANEVISNRAIEIIGGEKGSKQVHPNNHCNQA
QSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTL
GQEFSGYVQQLTNGIARVEQSLHHLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGID
FKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPG
SSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLA
DASYSFRVHCVDGIKANEDRISKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKE
SALQLGVLNEKEFDEWVIPEKMIGPKE
>KLTH0C11462g
-MFKLTAEVAN--KSLSGSPKTRLISTS-----------SAISQKCRVETDAFGEINVPA
DKYWGAQTQRSLENFKIGGARERMPEPVVRAFGILKKSAAIVNESLGTLDPKISKPIQQA
ADEVISGKLVDHFPLVVFQTGSGTQSNMNANEVISNRAIEIVGGKMGTKSIHPNNHCNQA
QSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFATKSKEFESIVKIGRTHLQDATPLTL
GQEFSGYVQQLTNGISRVEQSLIHLKFLAQGGTAVGTGLNTKVGFGEKIAEQVSKETGID
FKTAPNKFEALAAHDAIVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPG
SSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLG
DACYSFRVHCVDGIEANRDKIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKE
SALELKVLTSAEFDQWVVPENMVGPK-
>Kwal_56.22362
-MFKVTTEAAN--KALISGSKARLISTS-----------SSLGQKYRVETDAFGEIKVPT
DKLWGAQTQRSLENFKIGGQRERMPEPIVKAFGILKKSAAIVNESLGTLDPKVSKPIQDA
ADEVISGKLIDHFPLVVFQTGSGTQSNMNANEVISNRAIQLVGGEVGSKSIHPNNHCNQA
QSSNDTFPSVMHIAAVTEVTHLLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTL
GQEFSGYVQQLTNGISRVEHSLHNLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGID
FKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPG
SSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSIRLLG
DACYSFRVHCVEGIQANEDKIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKE
SALELGVLSSAEFDEWVVPENMVGPKP