MUSCLE (3.8) multiple sequence alignment

Suva_16.42         --------------------------MAKKSKKDKEAKKARSELKSQKNQKKQEKKFHKN
Skud_16.14         --------------------------MAKKAKKDKEAKKARTELKNQKNQKKQEKKFHKN
Smik_6.471         --------------------------MAKKSKKDKEAKKARAELKNQKNQKKQEKKFHKN
YPL263C            --------------------------MAKKNKKDKEAKKARAELKNQKNQKKQEKKFQKN
KNAG0E02780        --------------------------MAKKTKKDKDAKKARSEAKSKKNLLKAASKDQKR
KAFR0B06500        --------------------------MAKKSKKDKEAKKARAELKNKKNQAKSQQKQQKK
KLLA0D00836g       --------------------------MAK--KKDKESKKARTEAKNKKALEKAAVKDKKK
CAGL0A01067g       --------------------------MAKK-KKDKEAKKARAEQKLKKNQAKAESKDKKR
ZYRO0F00484g       --------------------------MAKKGKKDKEAKKARGEQKLKKNQGKAELKDKKK
TDEL0G04610        --------------------------MAKKNKKDKEAKKARAELKSKKSQGKAAEKEKKK
NDAI0I02750        --------------------------MAKKSKKDKDAKKARAEQKLKKNQAKAEQKDKKK
NCAS0D02190        --------------------------MAKKGKKDKEAKKARAEQKAKKNQSKAEQKDKKK
KLTH0C11528g       --------------------------MAKKNKKDKEAKKARAELKNKKNLEKAEVKDKKR
Kwal_56.22350      MDKRLLKSSSYLPWHRQENSGREFYLAMAKKKKDKEAKKARAEQKNKKNLEKSENKDKKR
TBLA0G01110        --------------------------MAKKNKKDKDAKKARAEAKAKKNQAKAEQKDKKL
Kpol_1045.77       --------------------------MAKKNKKDKDAKKARAAEKAKKNQVKADQKDKKK
TPHA0M00200        --------------------------MAKKTKKDKDAKKARAEAKAKKNQSKAEIKDKKK
ACR016W            --------------------------MAKKGKKDKDAKKARAEAKSKKSLLKAEQKDKKK
SAKL0E00880g       --------------------------MAKKNKKDKEAKKARAELKSKKSQGKAELKNKKK
                                                  ****::****   * :*   *   * :* 

Suva_16.42         KNKALDGDDDDESDQDLDEILSSFTKKQTELEHVDITAVERP-----SCRVHPLMFANP-
Skud_16.14         KNKALDGDDEDESDQDLDEILSSFTKKQTELEHVDITAVERL-----SCRTHPLMFANP-
Smik_6.471         KNKSLDGDDDDESDQDLDEILSSFTKKQTELEHVDITAVERP-----SCRTHPLMFANP-
YPL263C            KNKSLNGEEDDESDQDLDEILSSFSKKQIELEHVDITSVEKP-----SCRTHPLMFANP-
KNAG0E02780        -VKKFGLDSDDEEDLDIDTILQNFKLEQEQFEKVVVELVPHP-----TPRNNACLVTNA-
KAFR0B06500        -QQK-LD-SDDEDDGNIEEILENFKKEQENYEKINIESVEKP-----SIRNNGSIISST-
KLLA0D00836g       -AKKLSQ-DEEEDDMDIEEMLANFKREQENFEKINVENVDRP-----DQRINPCMFVNP-
CAGL0A01067g       -AKKL---DEDDDDMDIEEVLANFKKEQEQFEKVAVDSVDKV-----NKRLNPCMVGNPS
ZYRO0F00484g       -AKKVLADDDEDDDMDLEEVLASFKKEQEQFEKVVVESVDKP-----SARINPCLVSNP-
TDEL0G04610        -SKKLLG-AEEDDDLDIEQVLANFKKEQEQFEKVVVENIERP-----SRRINPSMIANP-
NDAI0I02750        LSKNQNV-DGDDDDLDIETVLANFKMEQEKFEKINVELLPQGQHNHISPRSNSSMITAAS
NCAS0D02190        -SKKFND-DEDDDDMDIDQVLANFKLQQEQFEHVNVESISKP-----AQRLNSCMITTP-
KLTH0C11528g       -SKK-LN-SEDDDDLDIDEILENFRKEQELFQEVVVTPVKRP-----SPRSNVCMVPNP-
Kwal_56.22350      -SKK-LG-SEDDDDLDIDEVLANFKKEQELFQEVLVTPVERP-----SQRINSCMVANP-
TBLA0G01110        -SKKNQL-EEEDDDMAIEDILENFKKQQEQFEKINIETVSKP-----TKRINSCMISNP-
Kpol_1045.77       -AKK-SG-FEDDDDMDIEEVLANFKKEQELFEQINIESVERP-----SRRINPCMIENP-
TPHA0M00200        -AKKNLD-GEDEDDMDIEEVLANFKKEQEQFEQINVESVDKP-----TRRINSCMIANP-
ACR016W            -AKK-LG-ADDDDDMDIEEVLANFKRQQAEFEAVNVETVERP-----HQRSSSSLVANP-
SAKL0E00880g       -AKK-LG-IEEEDDVDIEEVLANFKREQEKFEEVVVSTVDRP-----TRRINSSMVANP-
                     :       ::.*  :: :* .*  :*   : : :  : .        *    :.  . 

Suva_16.42         -QHNK--HELFIFGGEFTDPETKLTHFYNDLYSYSIKNNSWKKYVSQNAPLPRSSGAVAV
Skud_16.14         -QHNK--RELFIFGGEFTDPETKLTHFYNDLYSYSIKNNSWKKYVSKNAPLPRSSAAVAV
Smik_6.471         -QHNK--HELFIFGGEFTDSETKLTHFYNDLYSYSIKNNSWKKYVSQNAPLPRSSAAVAV
YPL263C            -QHNK--HELFIFGGEFTDPETKLTHFYNDLYSYSIKNNSWKKYVSQNAPLPRSSAAVAV
KNAG0E02780        ---SK--PELLLFGGERTNNETNMTKFYNDLHVYNPQNNQWKKFTSQNSPMPRSSAAMCS
KAFR0B06500        ---TK--KELLLFGGEHTSKELQTTKFYNDLYTFSPDNNQWKRITSQNSPMPRSSAAMAA
KLLA0D00836g       -AHGK--RELMMFGGESTTQETGTTHFYNDLFVYSLDTDTWKRYTSQNSPMPRSSAAVAS
CAGL0A01067g       ASSSK--KELIVFGGEFTNPQTSTTTFYNDLHTFTPENNQWKRYTSQNAPMPRSSAAMAA
ZYRO0F00484g       -AHGK--KELILFGGEYTNQSNSTTHFYNELFTFTPDNDQWRKISSQNAPMPRSSAAMAA
TDEL0G04610        -IHGK--SELIMFGGEHTIQSTSTTHFFNDLVVFSPDNEQWKRISSQNSPMPRSSAAMVG
NDAI0I02750        -AHNKKGKELLMFGGEYTSPETGMTHFYNDLLSYTPDTQQWRKITSQNSPMPRSSAAMCY
NCAS0D02190        -NHSK--KELLIFGGEFTNPETSMTHFYNELITYSPDNGQWRKITSQNSPMPRSSAAMCA
KLTH0C11528g       -SHGK--RELLIFGGEYTNQTSSTTTFYNELFTYSLDTDQWKKITSRNAPMPRSSAAAAG
Kwal_56.22350      -IHGK--RELLIFGGEHTNSTNSLTAFYNELFTYSLDSDQWRKITSRNSPMPRSSAAAAA
TBLA0G01110        -IHGK--NELILFGGENT---STTTTFYNDLFTYNPENDQWKKYTSQNSPMPRSSSAMIS
Kpol_1045.77       -NHGK--SELILFGGESTNKDTSTTQFFNDLYSYTPENDQWRRYTSKNSPMPRSSAAMAA
TPHA0M00200        -NHGK--KELLLFGGENTSQEQGVTHFYNDLYTFTPDNDLWKKITSQNSPMPRSSAAMAA
ACR016W            -LHNK--RELILFGGEYTNQSTGMTHFYNDLFIYSLDTDQWKKYTSQNSPMPRSSAAIAA
SAKL0E00880g       -LHGK--RELLLFGGENTNSTNSTTAFYNDLFTYSLDGDQWRKISSQNSPMPRSSAAIAA
                       *   **::**** *      * *:*:*  :. .   *..  *.*:*:****.*   

Suva_16.42         HSSGIALLHGGEFSSPKQSKFYHYSDTWLFDCHEKKFTKLEFGGRDSSPSARSGHRIIAW
Skud_16.14         HPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCAERKFTKLEFGGRDSSPSARSGHRIIAW
Smik_6.471         HPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVERKFNKLEFGGRDSSPSARSGHRIIAW
YPL263C            HPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVERKFTKLEFGGRDSSPSARSGHRIIAW
KNAG0E02780        HQSGVTILFGGEFSSPKQNTFYHYNDTWLLDNTTREWSKLD---FKNGPSARSGHRITTW
KAFR0B06500        HPSGIALLNGGEFSSPKQSTFYHYSDTWILDLTTKEWTKIE---GKVKPVGRSGHRITTW
KLLA0D00836g       HPTGVALIHGGEFSSPKQNTFYHYSDSWLFDCSSKEWTKVE---QKNGPSARSGHRMAIW
CAGL0A01067g       HPSGIALLHGGEFSSPKQNTFYHYSDTWILDCNTKEWAKVD---AKVGPSARSGHRITVW
ZYRO0F00484g       HPSGIALLHGGEFSSPKQNTFYHYSDTWLLDCTTKEWTKLD---QKNGPASRSGHRMTVW
TDEL0G04610        HPSGVALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWTKIE---QKNGPSARSGHRMAVW
NDAI0I02750        HPSGIAILHGGEFSSPKQNTFYHYSDTWILDTSTKEWTKVD---IKKSPVARSGHRIVHW
NCAS0D02190        HPSGIALLHGGEFSSPKQNTFYHYSDTWLLDTHTKEWTKMD---SAKGPPGRSGHRITIW
KLTH0C11528g       HPSGVVLIHGGEFSSPKQNTFYHYSDSWLLDCSSKEWTKID---QKNGPSARSGHRMTVW
Kwal_56.22350      HSSGVALIHGGEFSSPKQNTFYHYSDTWLLDCTTKEWTKME---QKNGPSARSGHRMTIW
TBLA0G01110        HPTGIALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWSKVE---NKNGPSARSGHRMTVW
Kpol_1045.77       HPSGVALIHGGEFSSPKQNTFYHYSDTWLLDCSTKEWTKVE---QKNGPSARSGHRISIW
TPHA0M00200        HPSGIALLHGGEFSSPKQNTFYHYSDTWLLDCTTREWTKVE---QKNGPSARSGHRITVW
ACR016W            HPSGVVLIHGGEFSSPKQNTFYHYSDTWLFDCATHEWTKIE---QKNGPSSRSGHRMTVW
SAKL0E00880g       HPSGVVLIHGGEFSSPKQNTFYHYSDTWLLDCNTKEWTKIE---QKNGPTARSGHRLTVW
                   * :*:.:: *********..****.*:*::*   .:: *::       * .*****:  *

Suva_16.42         KNYFILFGGFRDLGSGQTSYLNDLWCFDISNYKWTKLE---TNTKPDARSGHCFVPTDNS
Skud_16.14         KNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWTKLE---TNTKPEARSGHCFIPTDNS
Smik_6.471         KNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWSKIE---TNSKPDARSGHCFIPTDNS
YPL263C            KNYFILFGGFRDLGNGQTSYLNDLWCFDISTYKWTKLE---TNSKPDARSGHCFIPTDNS
KNAG0E02780        KNYFILFGGFKDLNQG-TSYFNDVWLFNVVDFKWTKWE-TTNKNQPDPRSGHSWIGSNEG
KAFR0B06500        KNYFILFGGFKDLGHS-TTYYNDVWLFDITTYKWKQVEFPKNHTLPDARSGHSLIPTSEG
KLLA0D00836g       KNFIILHGGFRDLGTS-TTYLNDLWVFDITNYKWKQVELPANHPIPDARSGHSLISTAEG
CAGL0A01067g       KNFFILHGGFRDLGTS-TTYLSDCWLFDITTYKWKQVEFPSNHQVPDARSGHSFIPTAEG
ZYRO0F00484g       KNFFIMYGGFRDLGTS-TTYLNDCWLFDITTHKWTQVEFPRNHLIPDARSGHSFIPDQEG
TDEL0G04610        KNFIILHGGFRDLGTS-TTYLNDCWLFDITTYKWKQVEFPQNHPVPDARSGHSLIADQEG
NDAI0I02750        KNYFVLFGGFKDIGNNQTNYFNDVWCFDILNYKWTQVEFPKNHPLPDPRSGHSWIPVEEG
NCAS0D02190        KNYFILSGGFKDLGHS-TSYFNDCWCFDITTYKWKQIEFPPNHPIPDARSGHSWIPTEEG
KLTH0C11528g       KNFFVMHGGFRDLGTS-TTYLNDCWLFDITTYKWKQVEFPPNHPVPDARSGHSLIPTQEG
Kwal_56.22350      KNFFILHGGFRDLGTS-TTYLNDLWIFDITTYKWKQVEFPPNHPIPDARSGHSIIPTQDG
TBLA0G01110        KNFIILHGGFRDLGTS-TTYLKDLWLFDVTKYKWTQVEFPPNHAIPDARSGHSLIPTQDG
Kpol_1045.77       KNYFMLHGGFRDLGTS-TTYLNDCWLFDITNYKWKQIEFPPNHPIPDARSGHSFIPTQEG
TPHA0M00200        KNYFILHGGFRDLGST-TSYLNDSWLFDITSYKWRQIEFPPNHPVPDARSGHSLIPTQEG
ACR016W            KNYIILHGGFRDLGTS-TTYLNDCWLFDITTYKWQQLQFPANHPIPDARSGHSLLPTPEG
SAKL0E00880g       KNYFILHGGFRDLGTM-TTYLSDCWLFDITTYKWKQVDFPPNHPIPDARSGHSLVPTPDG
                   **:::: ***.*:.   *.* .* * *::  .** : :   .:  *:.****. :   :.

Suva_16.42         AILMGGYCKTIAKNNKNLMKGKILNDSWKLTLTPDPKKWQWEKLKNFKNQPSPRVGYSFN
Skud_16.14         AILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFN
Smik_6.471         AILMGGYCKTIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFN
YPL263C            AILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFN
KNAG0E02780        PIVYGGYCKVKAKNNKSLHKGKTLTDCWILKMSQNVNEIKWERRAKKGQQPSPRVGCSMA
KAFR0B06500        CIVYGGYCKIKA--KKGLQKGKLLSGCWNLKMKADVEAIRWERRRKQGFQPSPRVGCSMA
KLLA0D00836g       AVLYGGYTKVKA--GKGLQKGKILSDCWYLKMKSDLGSIRWERRKKQGSQPSPRVGCSMV
CAGL0A01067g       AILWGGYCKVKA-NKKGYQKGKILSDCWYLKMKSDISGIRWERRRKQGFQPSPRVGCSMA
ZYRO0F00484g       AILWGGYCKVKA--GKGLQKGKILTDCWYLKMNSTPSAIRWERRKKQGFQPSPRVGCSMV
TDEL0G04610        AILWGGYCKVKA--GKGLQKGKILTDCWYLKMSSNTSAIRWDRKKRQGFQPSPRVGCSMV
NDAI0I02750        CILWGGYTKVKSKLKSGQQKGKILNDCWYLKMKSDLSSIRWERRKKLGFQPSPRVGCSMA
NCAS0D02190        CILWGGYCKVKA--GKGLQKGKILNDCWYLKMKSDLSQVRWERRKKQGFQPSPRVGCSMA
KLTH0C11528g       AIVWGGYCKIKA--KKGLQKGKILTDCWYLRMKSDITGIRWERRKKQGFQPSPRVGCSMA
Kwal_56.22350      AVLWGGYCKVKA--GKGLQKGKTLTDCWYLKMKSDVSAIRWERRKKQGFQPSPRVGCSMV
TBLA0G01110        ALLWGGYCKVKA--GKGLQKGKILSDCWYLKMKSDVSGIRWERRKKQGFQPSPRVGCSMV
Kpol_1045.77       AVLWGGYCKVKA--GKGLQKGKILTDCWYLKMKADPTAIRWERRKKQGFQPSPRVGCSMV
TPHA0M00200        AVLWGGYCKVKA--GKGLQKGKILGDCWYLKMKADPSAVRWERRKKQGFQPSPRVGCSMV
ACR016W            AILWGGYCKVKA--GKGLQKGKILTDCWYLKMKSDVTAIRWERRKKQGFQPSSRAGCSMV
SAKL0E00880g       AVLWGGYCKVKA--GKGLQKGKILTDCWYLKMKSDIGAIRWERRKKQGFQPSPRVGCSMV
                    :: *** *  :   ..  *** * ..* * :.      .*:.  .   ***.*.* *: 

Suva_16.42         LWKQNKSVAFGGVYDLQETEESLDSIFYNDLYMFHLELNKWSKLRIKPQRHTNNRNAPAT
Skud_16.14         LWKQNKSVAFGGVYDLQETEESLESVFYNDLYMFHLELNKWSKLRIKPQRQTNNKNAPLT
Smik_6.471         LWKQNKSVAFGGVYDLQETEESLESVFYNDLYMFHLELNKWSKLRIKSQRQTSNRNSPAT
YPL263C            LWKQNKSVAFGGVYDLQETEESLESVFYNDLYMFHLELNKWSKLRIKPQRQTNSKNSPAT
KNAG0E02780        LHRNNRGILFGGVYDLEETEEDLSSIYYNDLYSYNIESNRWYPLKLRKVTQNSNANRNKS
KAFR0B06500        YHK-GRGILFGGVYDFDETEESLESIFYNDLFTYNIESNRWFNVTLKKRS--NATKTISS
KLLA0D00836g       HHK-GRGVLFGGVYDFEETEESLRSIFYNELYTYQIENNRWYAMSLRPQ-----RKKKNF
CAGL0A01067g       YHK-GRGILFGGVYDFEETEESLESNFFNDLFSYHIESNRWYSLSIRSRK--SNNNAVAK
ZYRO0F00484g       PHK-GRGVLFGGVYDFEETEESLDSNFYNDLFTFQIKTNRWYSLSLRPQ-----RKKQVK
TDEL0G04610        PHK-GRGVLFGGVYDFEETEESLESNFYNDVFTYQINMNRWYSLSLRPQ-----RKKQVK
NDAI0I02750        YHK-GRGILFGGVYDFDETEESLESLFYNDLFSYNVETNRWFALNLRKNQ--KGNKSLKR
NCAS0D02190        YHK-GRGILFGGVYDFEETEESLESIFYNDLFSYNVESNRWFSLSLRKAQ--KFKKVAKS
KLTH0C11528g       HHK-GRGILFGGVYDYEETEEGLSSEFFNDLLSYQVEANRWYSIKMRPQ-----KKKIVA
Kwal_56.22350      HHK-GRGMLFGGVYDFEETEEGLASEFFNDLFSYQVEANRWYSVKMRPQ------KKKTV
TBLA0G01110        HHK-GRGILFGGVFDFEETEESLDSLFYNDLFTYQIEINRWFSLSMRSQ-----RKKTIK
Kpol_1045.77       HHK-GRGILFGGVYDFEETEESLDSMFYNDLFSYQIEINRWFALQLRPQ-----RKKVVR
TPHA0M00200        HHK-GRGILFGGVYDFEETEESLDSIFYNDLFSYQIESNRWYALQLRSQ-----RKKVVR
ACR016W            HHK-GRGILFGGVYDYEETEEGLDSLFYNDLFTYHIETNRWYSVSLRAQ-----RHSKVK
SAKL0E00880g       HHK-GRGILFGGVFDFEETEESLESMFYNDLFTFQIETNRWYSASLRPQ------RKAAK
                    .. ...: ****:* :****.* * ::*::  :::: *.*    :.        .    

Suva_16.42         SKRKSNKDQEKELQDLLNSILAKSNLND-EEDD--NDDSTATTTGANSS----NDEG---
Skud_16.14         SKRKSNKDQEKELQDLLNSILAKSNLND---DD--DDDNTTTGSNSID-----GDDE---
Smik_6.471         SKRKSNKDQEKELQDLLNSILAKSNLND-DDDE--NDDYTATGSNSI------DGDE---
YPL263C            SKRKSNKDQEKELQDLLNSILAKSNLND-DDDD--NDDNSTTGPNSI------DDDE---
KNAG0E02780        SNNTVSKEQEKELQDLLNKILEQNDLKDEETNS--YSGSNTPHEETT------TDRE---
KAFR0B06500        TKNKSSKEKERELQDLLNQILEKNNLKP-DDEE--EEESSDIFGS---------------
KLLA0D00836g       VQSKSNRNKDKELEDILNQILDKANLRD--AED--DDESKVIEEQL-------NQLDLID
CAGL0A01067g       KSGKNSKEQEKELKMLLDSILEKANLQD-KSDD--DEDDEEINTAL-------AKVD---
ZYRO0F00484g       ISKSSTKDQEKELQDHLNRILQQAQLYD-QDED--KEDDKAIREQFE------DENQ---
TDEL0G04610        LNNRSTKDQEKELEDLLNKILRNAQLDD-QGEE--EEIDAAEESTAV-------------
NDAI0I02750        SNNKNSKEKEKELQDLLNQILEKNNLKD-EDDE--DDEEVNENEDGSTTASTAATSD---
NCAS0D02190        SNNKSSKEKEKELQDLLNQILEKNNLKD-DDDD--DEISTGTETETET-----AANS---
KLTH0C11528g       A-SKSAKSKDDELVGILNDILQKANLADEENEE--NESDSEIEKEL---------HR---
Kwal_56.22350      AISRNNRNKDEELENILNDILQQANLAD---DT--DDDDNEIKREL-------QR-----
TBLA0G01110        IGPKTTKDKEKELQDILNSILKKNNLTD---DD--SEDPNAIEEELKI-----NDDESN-
Kpol_1045.77       LNNKSSKDKEKELQDLLNQILEKANLNDKDDKDQEDEDAKAIETELDR-----ADHDTSD
TPHA0M00200        LNNKSSKEKELELQNILNEILEKANLKD----D--DEDANELSNGL-------GSDS---
ACR016W            SAPKSNRDKDKELEDMLNAILKKANLDD--DDG--DEDGKTIEEEL-------NKLE---
SAKL0E00880g       ATSKNNRNKDKELEDILNQILEKANLND-DENE--KETIGDVLKEL-------DEED---
                         ..:: **   *: ** : :*          .                       

Suva_16.42         -DDEDDSDFENQENITISNQLPHPRFNAATCVVDDSLFIYSGVWELGEKDYPINSFYSID
Skud_16.14         -GEDDDSDLDNPENITISNQLPHPRFNAATCVVDDSLFIYSGVWELGEKDYPINSFYSID
Smik_6.471         -DEEDDSDLDNQEDITISNQLPHPRFNAATCVVGDSLFIYSGVWELGEKDYPINSFYSID
YPL263C            -DNEDDSDLDNQEDITISNQLPHPRFNAATCVVGDSLFIYSGVWELGEKDYPINSFYSID
KNAG0E02780        -QDDNEEEEKMRTNLPKLNQLPHERFNACTTVLNDTFYIYGGMWEFKDNDYTIDSFYSID
KAFR0B06500        -DDEDDEEQKNKIDIKTVTQLPHPRFNATTTVIDDMLYIYGGAWEFGEIDYSIDSFYSID
KLLA0D00836g       FDDDDESDKKSAKSYETMSTLPHARFNAATAVVDDTLFIFGGTVEIGEKDYPIDSFYSID
CAGL0A01067g       -LEDEE-EEQLAVQHTILTQLPHPRFNATTTVIDDTLFIFGGIWELGDKEFMIDSLYSID
ZYRO0F00484g       -SGDEDEEESTKKQHTISTQLPHPRFNTSLAVVNDTLFIYGGLWELGDKDYNIDSFYGID
TDEL0G04610        -EEDSDESESLDKEHVIMNELPHPRFNAATAVVDDTLFIFGGVWEFGEKDYSIDSFYGID
NDAI0I02750        -DEDTERTTQEAEGVTIMNQLPHPRYNVAMTVVDDLLFIYGGSWELGEKDYFINSFYSID
NCAS0D02190        -DDEDNKEHSKSAQVTVMSQLPHPRFNAATTVVDDSLFIYGGIWEMGEKDYAIDSLYSID
KLTH0C11528g       -LDEEELLGHQQKQYPVVAQLPHSRFNAATTVVDDTLFIFGGSWEYGERDFSIDSFYSID
Kwal_56.22350      -IDEEEALENSRKQYEVVGQLPHPRFNATTAVVDDFLFIFGGVWEFGERDFSIDSFYSID
TBLA0G01110        -SEDESKDGQVTKQYEVMNQLPHVRFNATTAVVNDTLYIFGGSWELGEKDYSIDSFYSID
Kpol_1045.77       SDADDVEDAKEKKEYKVLTQLPHPRFNATMTVVNDTLFIYGGVWELGEKDYTIDSFYSID
TPHA0M00200        -DSDDESEKVSKKEYIVRNQLPHHRFNASTTVVDDTLFIYGGVWELGEKDYSIDSMYSID
ACR016W            -NDGITETEETKKSYPIVMKLPHPRFNASTAIVDDTLFIFGGVWEQGEKDYMIDSFYSID
SAKL0E00880g       -SDSAEELNSEKKEYPIRIQLPHPRFNASTAVVDDTLFIFGGVWEIGEKDYSIDSFYAID
                                       *** *:*.   ::.* ::*:.*  *  : :: *:*:*.**

Suva_16.42         LNKLDGVKVYWEDLSTVEEAKRLGDRDSDE-EEFEYEDEDDDED--DDEEEPQDTRLLE-
Skud_16.14         LNKLDGVNVYWEDLSTIEEAKRLGDRDSDE-DDFEYEDDDDD-DGEDNDEEEQDVALLE-
Smik_6.471         LNKLDGVKVYWEELSAIEEAKRLGDRDSDE-EEFEYEDEEDD-E--DQSEEEQDAGLLE-
YPL263C            LNKLDGVKVYWEDLSAIEEAKRLGDRDSDE-DEFEYEDDEED-E--DDGEEEQDAGPLE-
KNAG0E02780        LNKLDGITQYYENLQEIEEVKRLGDVQSE--DDFEYEDDDDE-D--DGEAEPTNERLEA-
KAFR0B06500        LNKLDGVNVYWEDLNEIETAKELGEQGSED-EDED-DFEEDE-E--DGEEEVEDTKLIA-
KLLA0D00836g       MNKLDGVKVYWEELKEVERAEKLGEQDSD--DEFGDEDDDDE-D--DGEEEIVDSKLEA-
CAGL0A01067g       LNKLDGVTMYWEDLKEIERAKELGVEDSDF-EDDD--EDDDD-E--DDDEEDDNEKDEG-
ZYRO0F00484g       LNKVDGVTVYWENLAEIEKAKKLAEQGSDEDEDDEDEEDEDE-D--DDEEEVRDQVLVA-
TDEL0G04610        LNKADGVTVYWEDLTALENAKD--EDDSDE-DEGE-EDDDDE-E--DSEEEQVDQKLVA-
NDAI0I02750        LNRIDGVTCYWEDLKEIEKAKELGEQDSDEEDDEDDEEDDDE-D--DDEEEIKDQKLVA-
NCAS0D02190        LNKLDGVSCYWEDLQEIEKAKEIGEQDSDE-DEEE--EDDEE-D--DDEEEIEDKKLVA-
KLTH0C11528g       LNRTDGVRVFWEDLEEIEKAKDQGLEEDEE-EEEE--EDDDD-E--DDEEETLDEELIAE
Kwal_56.22350      LNKLDGVKVYWENLSELEKAKALGEDDEEE-FDDD--EDDDD-D--DEEEETADQKLVA-
TBLA0G01110        LNKLDGVTVYWEDMEEIEAAKELGEQFSDE-EDED-DEEEDE-D--DGEEEIVDQKLVA-
Kpol_1045.77       LNRTDGVTVLWEDLSEIEAAKEAGIVDSDE-EDDEFGDSDDE-D--DGEEEIMDQKLVA-
TPHA0M00200        LNKLDGVTVYWENLHDIEKAKELGAINSDE-EDEE--DEDDE-D--DDEEETVDQKLVA-
ACR016W            MNKVDGVKVYWEDMAAVERAKELGEEDEDD-AEDD-EDDDSE-D--DDEEEHSDRKLVA-
SAKL0E00880g       LNRLDGIKIYWEDLRDIEMAKELGDEEEDF-EDNE-EDDEED-D--DDEEEITDQKLVA-
                   :*. **:   :*::  :* .:      .:   :     .:.: :  *   *  :      

Suva_16.42         ------DDDDEESEEEDDG-QAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTWSISN
Skud_16.14         ------GDEDEEGENEDNG-QAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTWSISN
Smik_6.471         ------SDEDEESDDEDDG-QAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTWSISN
YPL263C            ------GDEDEESESDDDK-QAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTWSISN
KNAG0E02780        ------EDDDEEENEEDEG-IDEMEIPDPRPWLPHPKAFESLREFYIREGPKFLEWAISN
KAFR0B06500        ------EDVEDEKEEEEEE-YPEMEIPDPRPWLPHPKAFESLRAFYLREGPAFLEWAISN
KLLA0D00836g       ------EDEEEEEEEEEV--EEEYEIPDLRPWLPHPKAFETLRAFYVRTGPTFLELAISS
CAGL0A01067g       ------DDEESEEEEEEEI-EEELEYPDPRPWLPHPKPFETLRAFYIREGAAFLEWAISN
ZYRO0F00484g       ------EEEDAEEDEEVE--EEEMEIPDPRPWLPHPKAFESLRAFYVRAGPQFLEWAISN
TDEL0G04610        ------EDEDEEEEEFE---EEEMEIPDPRPWLPHPKAFESLRSFYVRTGATFLEWAISN
NDAI0I02750        ------DDEDEEEEEED---VQEMEIPDLRPWLPHPKPFESLRAFYIREGPAFLEWAISN
NCAS0D02190        ------EEDDEEEEEEEEE-FEEMEIPDLRPWLPHPKPFESLRAFYIREGAAFLEWAISN
KLTH0C11528g       MEDDKQEEEEQEEEEEEE--EAGPEIPDPRPWLPHPKAFETLRAFYIRTGAEFLQWAISN
Kwal_56.22350      ------EDEEEEEEEEEE--EDEPEIPDLRPWLPHPKPFETLRAFYIRTGAEFLKWAISN
TBLA0G01110        ------EEDEEEEEIEAD--EDEMEIPDPRPWLPHPKPFETLRAFYVRTGATFLEWAISN
Kpol_1045.77       ------EEEEEEEEEEEEEQVDEMEIPDPCPWLPHPKPFESLRVFYVRTGATFLEWAISN
TPHA0M00200        ------EEEEEEEEIED---ADDMEIPDPRPWLPHPKAFESLRNFYVRTGASFLEWAISN
ACR016W            ------EEEEEEEEEDN---EILPEIPDPRPWLPHPKAFESLRAFYVRTGASFLEWAITN
SAKL0E00880g       ------EDDDEEEEEED---EYEPEIPDPRPWLPHPKPFETLRGFYVRTGADFLEWAISS
                          : : * :          * **  .******.**:** **:* *. **  :*:.

Suva_16.42         NR----NLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGG---IIERDATAKPS-K
Skud_16.14         NK----DLKGKHLKTKSFEICEDRWWERRDQVTLEEERLEDTGG---IIERDTTTKIS-K
Smik_6.471         NR----NLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGG---IIERDVTTKPS-K
YPL263C            NR----NLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGG---IIERDTTTKPS-K
KNAG0E02780        NK----HAKGKHLKQKSFELCQDRWWERRDQIQIEEDKLQELGVGGDIIERDAQSPPTAR
KAFR0B06500        NR----HTRGKLLKQKSFELCQDRWWERRDQISIEEDKLEEIGVVGDVVERDT-SKAVSK
KLLA0D00836g       NR----DSKGKHLKTKSFELCQDRWWERREQVRIEEDKLEELGGVEDVIEKDT-SKTQ-R
CAGL0A01067g       NK----NAKGKHLKKHSFDLCQERWWERRDQLRIEEDKLEEIGGVGDIIERDK-SASS-K
ZYRO0F00484g       NR----DARGKHLKQKSFDLCQDRWWERRDQVRIEEDKMEELGGVGDIVERNP-AQKT-K
TDEL0G04610        NR----HVKGKHLKTKSFEICESRWWERRDQVRLEEDKLEELGGVGEIIERDT-TKTK-K
NDAI0I02750        NK----HVRGKHLKKKSFELCEDRWWERRDQIRIEEDKLEELGVVGDVIEKDT-SKGASK
NCAS0D02190        NK----HVRGKHLKKKSFDLCEDRWWERRDQVRIEEDKLEELGVVGNVIEKDT-SVPTSK
KLTH0C11528g       NR----SAKGKHLKKQSFDLSQDRWWERREQVRIEEDKLEEMGGVENIIERDS-SHST-K
Kwal_56.22350      NR----DAKGKHLKKQSFDLCQDRWWERREQIRIEEDKLEELGGVENVVERDP-AQTM-K
TBLA0G01110        NR----DSKGKHLKKKSFELTEDRWWERRDQVRIEEDKMEELGGIENIVERDT-TQVN-K
Kpol_1045.77       NR----DARGKHLKKKSFDLCQDRWWQRRDQVRIEEDKMEELGGIGEVIEKDT-SKST-K
TPHA0M00200        NK----HTRGKHLKTKSFELCQDRWWERRDQVRIEEDKLEELGGVGEVIEKDT-TKST-K
ACR016W            KHNTRSDAKGKHLKKHSFDLCQERWWERREQVRIEEDKLEELGGVGEVIEKDF-TKPT-K
SAKL0E00880g       NR----DARGKHLKKKSFDLCQDRWWERRDQVRIEEDKLEELGGIGEVVEKDT-SKSK-K
                   :.      .** ** :**:: :.***:**:*: :**:.::: *    ::*.:  :    .

Suva_16.42         RR
Skud_16.14         RR
Smik_6.471         RR
YPL263C            RR
KNAG0E02780        RR
KAFR0B06500        RR
KLLA0D00836g       RR
CAGL0A01067g       RR
ZYRO0F00484g       RR
TDEL0G04610        RR
NDAI0I02750        RR
NCAS0D02190        RR
KLTH0C11528g       RR
Kwal_56.22350      RR
TBLA0G01110        RR
Kpol_1045.77       RR
TPHA0M00200        RR
ACR016W            RR
SAKL0E00880g       RR
                   **

FASTA FORMAT for MUSCLE Version 3.6

>Suva_16.42
--------------------------MAKKSKKDKEAKKARSELKSQKNQKKQEKKFHKN
KNKALDGDDDDESDQDLDEILSSFTKKQTELEHVDITAVERP-----SCRVHPLMFANP-
-QHNK--HELFIFGGEFTDPETKLTHFYNDLYSYSIKNNSWKKYVSQNAPLPRSSGAVAV
HSSGIALLHGGEFSSPKQSKFYHYSDTWLFDCHEKKFTKLEFGGRDSSPSARSGHRIIAW
KNYFILFGGFRDLGSGQTSYLNDLWCFDISNYKWTKLE---TNTKPDARSGHCFVPTDNS
AILMGGYCKTIAKNNKNLMKGKILNDSWKLTLTPDPKKWQWEKLKNFKNQPSPRVGYSFN
LWKQNKSVAFGGVYDLQETEESLDSIFYNDLYMFHLELNKWSKLRIKPQRHTNNRNAPAT
SKRKSNKDQEKELQDLLNSILAKSNLND-EEDD--NDDSTATTTGANSS----NDEG---
-DDEDDSDFENQENITISNQLPHPRFNAATCVVDDSLFIYSGVWELGEKDYPINSFYSID
LNKLDGVKVYWEDLSTVEEAKRLGDRDSDE-EEFEYEDEDDDED--DDEEEPQDTRLLE-
------DDDDEESEEEDDG-QAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTWSISN
NR----NLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGG---IIERDATAKPS-K
RR
>Skud_16.14
--------------------------MAKKAKKDKEAKKARTELKNQKNQKKQEKKFHKN
KNKALDGDDEDESDQDLDEILSSFTKKQTELEHVDITAVERL-----SCRTHPLMFANP-
-QHNK--RELFIFGGEFTDPETKLTHFYNDLYSYSIKNNSWKKYVSKNAPLPRSSAAVAV
HPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCAERKFTKLEFGGRDSSPSARSGHRIIAW
KNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWTKLE---TNTKPEARSGHCFIPTDNS
AILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFN
LWKQNKSVAFGGVYDLQETEESLESVFYNDLYMFHLELNKWSKLRIKPQRQTNNKNAPLT
SKRKSNKDQEKELQDLLNSILAKSNLND---DD--DDDNTTTGSNSID-----GDDE---
-GEDDDSDLDNPENITISNQLPHPRFNAATCVVDDSLFIYSGVWELGEKDYPINSFYSID
LNKLDGVNVYWEDLSTIEEAKRLGDRDSDE-DDFEYEDDDDD-DGEDNDEEEQDVALLE-
------GDEDEEGENEDNG-QAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTWSISN
NK----DLKGKHLKTKSFEICEDRWWERRDQVTLEEERLEDTGG---IIERDTTTKIS-K
RR
>Smik_6.471
--------------------------MAKKSKKDKEAKKARAELKNQKNQKKQEKKFHKN
KNKSLDGDDDDESDQDLDEILSSFTKKQTELEHVDITAVERP-----SCRTHPLMFANP-
-QHNK--HELFIFGGEFTDSETKLTHFYNDLYSYSIKNNSWKKYVSQNAPLPRSSAAVAV
HPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVERKFNKLEFGGRDSSPSARSGHRIIAW
KNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWSKIE---TNSKPDARSGHCFIPTDNS
AILMGGYCKTIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFN
LWKQNKSVAFGGVYDLQETEESLESVFYNDLYMFHLELNKWSKLRIKSQRQTSNRNSPAT
SKRKSNKDQEKELQDLLNSILAKSNLND-DDDE--NDDYTATGSNSI------DGDE---
-DEEDDSDLDNQEDITISNQLPHPRFNAATCVVGDSLFIYSGVWELGEKDYPINSFYSID
LNKLDGVKVYWEELSAIEEAKRLGDRDSDE-EEFEYEDEEDD-E--DQSEEEQDAGLLE-
------SDEDEESDDEDDG-QAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTWSISN
NR----NLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGG---IIERDVTTKPS-K
RR
>YPL263C
--------------------------MAKKNKKDKEAKKARAELKNQKNQKKQEKKFQKN
KNKSLNGEEDDESDQDLDEILSSFSKKQIELEHVDITSVEKP-----SCRTHPLMFANP-
-QHNK--HELFIFGGEFTDPETKLTHFYNDLYSYSIKNNSWKKYVSQNAPLPRSSAAVAV
HPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVERKFTKLEFGGRDSSPSARSGHRIIAW
KNYFILFGGFRDLGNGQTSYLNDLWCFDISTYKWTKLE---TNSKPDARSGHCFIPTDNS
AILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFN
LWKQNKSVAFGGVYDLQETEESLESVFYNDLYMFHLELNKWSKLRIKPQRQTNSKNSPAT
SKRKSNKDQEKELQDLLNSILAKSNLND-DDDD--NDDNSTTGPNSI------DDDE---
-DNEDDSDLDNQEDITISNQLPHPRFNAATCVVGDSLFIYSGVWELGEKDYPINSFYSID
LNKLDGVKVYWEDLSAIEEAKRLGDRDSDE-DEFEYEDDEED-E--DDGEEEQDAGPLE-
------GDEDEESESDDDK-QAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTWSISN
NR----NLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGG---IIERDTTTKPS-K
RR
>KNAG0E02780
--------------------------MAKKTKKDKDAKKARSEAKSKKNLLKAASKDQKR
-VKKFGLDSDDEEDLDIDTILQNFKLEQEQFEKVVVELVPHP-----TPRNNACLVTNA-
---SK--PELLLFGGERTNNETNMTKFYNDLHVYNPQNNQWKKFTSQNSPMPRSSAAMCS
HQSGVTILFGGEFSSPKQNTFYHYNDTWLLDNTTREWSKLD---FKNGPSARSGHRITTW
KNYFILFGGFKDLNQG-TSYFNDVWLFNVVDFKWTKWE-TTNKNQPDPRSGHSWIGSNEG
PIVYGGYCKVKAKNNKSLHKGKTLTDCWILKMSQNVNEIKWERRAKKGQQPSPRVGCSMA
LHRNNRGILFGGVYDLEETEEDLSSIYYNDLYSYNIESNRWYPLKLRKVTQNSNANRNKS
SNNTVSKEQEKELQDLLNKILEQNDLKDEETNS--YSGSNTPHEETT------TDRE---
-QDDNEEEEKMRTNLPKLNQLPHERFNACTTVLNDTFYIYGGMWEFKDNDYTIDSFYSID
LNKLDGITQYYENLQEIEEVKRLGDVQSE--DDFEYEDDDDE-D--DGEAEPTNERLEA-
------EDDDEEENEEDEG-IDEMEIPDPRPWLPHPKAFESLREFYIREGPKFLEWAISN
NK----HAKGKHLKQKSFELCQDRWWERRDQIQIEEDKLQELGVGGDIIERDAQSPPTAR
RR
>KAFR0B06500
--------------------------MAKKSKKDKEAKKARAELKNKKNQAKSQQKQQKK
-QQK-LD-SDDEDDGNIEEILENFKKEQENYEKINIESVEKP-----SIRNNGSIISST-
---TK--KELLLFGGEHTSKELQTTKFYNDLYTFSPDNNQWKRITSQNSPMPRSSAAMAA
HPSGIALLNGGEFSSPKQSTFYHYSDTWILDLTTKEWTKIE---GKVKPVGRSGHRITTW
KNYFILFGGFKDLGHS-TTYYNDVWLFDITTYKWKQVEFPKNHTLPDARSGHSLIPTSEG
CIVYGGYCKIKA--KKGLQKGKLLSGCWNLKMKADVEAIRWERRRKQGFQPSPRVGCSMA
YHK-GRGILFGGVYDFDETEESLESIFYNDLFTYNIESNRWFNVTLKKRS--NATKTISS
TKNKSSKEKERELQDLLNQILEKNNLKP-DDEE--EEESSDIFGS---------------
-DDEDDEEQKNKIDIKTVTQLPHPRFNATTTVIDDMLYIYGGAWEFGEIDYSIDSFYSID
LNKLDGVNVYWEDLNEIETAKELGEQGSED-EDED-DFEEDE-E--DGEEEVEDTKLIA-
------EDVEDEKEEEEEE-YPEMEIPDPRPWLPHPKAFESLRAFYLREGPAFLEWAISN
NR----HTRGKLLKQKSFELCQDRWWERRDQISIEEDKLEEIGVVGDVVERDT-SKAVSK
RR
>KLLA0D00836g
--------------------------MAK--KKDKESKKARTEAKNKKALEKAAVKDKKK
-AKKLSQ-DEEEDDMDIEEMLANFKREQENFEKINVENVDRP-----DQRINPCMFVNP-
-AHGK--RELMMFGGESTTQETGTTHFYNDLFVYSLDTDTWKRYTSQNSPMPRSSAAVAS
HPTGVALIHGGEFSSPKQNTFYHYSDSWLFDCSSKEWTKVE---QKNGPSARSGHRMAIW
KNFIILHGGFRDLGTS-TTYLNDLWVFDITNYKWKQVELPANHPIPDARSGHSLISTAEG
AVLYGGYTKVKA--GKGLQKGKILSDCWYLKMKSDLGSIRWERRKKQGSQPSPRVGCSMV
HHK-GRGVLFGGVYDFEETEESLRSIFYNELYTYQIENNRWYAMSLRPQ-----RKKKNF
VQSKSNRNKDKELEDILNQILDKANLRD--AED--DDESKVIEEQL-------NQLDLID
FDDDDESDKKSAKSYETMSTLPHARFNAATAVVDDTLFIFGGTVEIGEKDYPIDSFYSID
MNKLDGVKVYWEELKEVERAEKLGEQDSD--DEFGDEDDDDE-D--DGEEEIVDSKLEA-
------EDEEEEEEEEEV--EEEYEIPDLRPWLPHPKAFETLRAFYVRTGPTFLELAISS
NR----DSKGKHLKTKSFELCQDRWWERREQVRIEEDKLEELGGVEDVIEKDT-SKTQ-R
RR
>CAGL0A01067g
--------------------------MAKK-KKDKEAKKARAEQKLKKNQAKAESKDKKR
-AKKL---DEDDDDMDIEEVLANFKKEQEQFEKVAVDSVDKV-----NKRLNPCMVGNPS
ASSSK--KELIVFGGEFTNPQTSTTTFYNDLHTFTPENNQWKRYTSQNAPMPRSSAAMAA
HPSGIALLHGGEFSSPKQNTFYHYSDTWILDCNTKEWAKVD---AKVGPSARSGHRITVW
KNFFILHGGFRDLGTS-TTYLSDCWLFDITTYKWKQVEFPSNHQVPDARSGHSFIPTAEG
AILWGGYCKVKA-NKKGYQKGKILSDCWYLKMKSDISGIRWERRRKQGFQPSPRVGCSMA
YHK-GRGILFGGVYDFEETEESLESNFFNDLFSYHIESNRWYSLSIRSRK--SNNNAVAK
KSGKNSKEQEKELKMLLDSILEKANLQD-KSDD--DEDDEEINTAL-------AKVD---
-LEDEE-EEQLAVQHTILTQLPHPRFNATTTVIDDTLFIFGGIWELGDKEFMIDSLYSID
LNKLDGVTMYWEDLKEIERAKELGVEDSDF-EDDD--EDDDD-E--DDDEEDDNEKDEG-
------DDEESEEEEEEEI-EEELEYPDPRPWLPHPKPFETLRAFYIREGAAFLEWAISN
NK----NAKGKHLKKHSFDLCQERWWERRDQLRIEEDKLEEIGGVGDIIERDK-SASS-K
RR
>ZYRO0F00484g
--------------------------MAKKGKKDKEAKKARGEQKLKKNQGKAELKDKKK
-AKKVLADDDEDDDMDLEEVLASFKKEQEQFEKVVVESVDKP-----SARINPCLVSNP-
-AHGK--KELILFGGEYTNQSNSTTHFYNELFTFTPDNDQWRKISSQNAPMPRSSAAMAA
HPSGIALLHGGEFSSPKQNTFYHYSDTWLLDCTTKEWTKLD---QKNGPASRSGHRMTVW
KNFFIMYGGFRDLGTS-TTYLNDCWLFDITTHKWTQVEFPRNHLIPDARSGHSFIPDQEG
AILWGGYCKVKA--GKGLQKGKILTDCWYLKMNSTPSAIRWERRKKQGFQPSPRVGCSMV
PHK-GRGVLFGGVYDFEETEESLDSNFYNDLFTFQIKTNRWYSLSLRPQ-----RKKQVK
ISKSSTKDQEKELQDHLNRILQQAQLYD-QDED--KEDDKAIREQFE------DENQ---
-SGDEDEEESTKKQHTISTQLPHPRFNTSLAVVNDTLFIYGGLWELGDKDYNIDSFYGID
LNKVDGVTVYWENLAEIEKAKKLAEQGSDEDEDDEDEEDEDE-D--DDEEEVRDQVLVA-
------EEEDAEEDEEVE--EEEMEIPDPRPWLPHPKAFESLRAFYVRAGPQFLEWAISN
NR----DARGKHLKQKSFDLCQDRWWERRDQVRIEEDKMEELGGVGDIVERNP-AQKT-K
RR
>TDEL0G04610
--------------------------MAKKNKKDKEAKKARAELKSKKSQGKAAEKEKKK
-SKKLLG-AEEDDDLDIEQVLANFKKEQEQFEKVVVENIERP-----SRRINPSMIANP-
-IHGK--SELIMFGGEHTIQSTSTTHFFNDLVVFSPDNEQWKRISSQNSPMPRSSAAMVG
HPSGVALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWTKIE---QKNGPSARSGHRMAVW
KNFIILHGGFRDLGTS-TTYLNDCWLFDITTYKWKQVEFPQNHPVPDARSGHSLIADQEG
AILWGGYCKVKA--GKGLQKGKILTDCWYLKMSSNTSAIRWDRKKRQGFQPSPRVGCSMV
PHK-GRGVLFGGVYDFEETEESLESNFYNDVFTYQINMNRWYSLSLRPQ-----RKKQVK
LNNRSTKDQEKELEDLLNKILRNAQLDD-QGEE--EEIDAAEESTAV-------------
-EEDSDESESLDKEHVIMNELPHPRFNAATAVVDDTLFIFGGVWEFGEKDYSIDSFYGID
LNKADGVTVYWEDLTALENAKD--EDDSDE-DEGE-EDDDDE-E--DSEEEQVDQKLVA-
------EDEDEEEEEFE---EEEMEIPDPRPWLPHPKAFESLRSFYVRTGATFLEWAISN
NR----HVKGKHLKTKSFEICESRWWERRDQVRLEEDKLEELGGVGEIIERDT-TKTK-K
RR
>NDAI0I02750
--------------------------MAKKSKKDKDAKKARAEQKLKKNQAKAEQKDKKK
LSKNQNV-DGDDDDLDIETVLANFKMEQEKFEKINVELLPQGQHNHISPRSNSSMITAAS
-AHNKKGKELLMFGGEYTSPETGMTHFYNDLLSYTPDTQQWRKITSQNSPMPRSSAAMCY
HPSGIAILHGGEFSSPKQNTFYHYSDTWILDTSTKEWTKVD---IKKSPVARSGHRIVHW
KNYFVLFGGFKDIGNNQTNYFNDVWCFDILNYKWTQVEFPKNHPLPDPRSGHSWIPVEEG
CILWGGYTKVKSKLKSGQQKGKILNDCWYLKMKSDLSSIRWERRKKLGFQPSPRVGCSMA
YHK-GRGILFGGVYDFDETEESLESLFYNDLFSYNVETNRWFALNLRKNQ--KGNKSLKR
SNNKNSKEKEKELQDLLNQILEKNNLKD-EDDE--DDEEVNENEDGSTTASTAATSD---
-DEDTERTTQEAEGVTIMNQLPHPRYNVAMTVVDDLLFIYGGSWELGEKDYFINSFYSID
LNRIDGVTCYWEDLKEIEKAKELGEQDSDEEDDEDDEEDDDE-D--DDEEEIKDQKLVA-
------DDEDEEEEEED---VQEMEIPDLRPWLPHPKPFESLRAFYIREGPAFLEWAISN
NK----HVRGKHLKKKSFELCEDRWWERRDQIRIEEDKLEELGVVGDVIEKDT-SKGASK
RR
>NCAS0D02190
--------------------------MAKKGKKDKEAKKARAEQKAKKNQSKAEQKDKKK
-SKKFND-DEDDDDMDIDQVLANFKLQQEQFEHVNVESISKP-----AQRLNSCMITTP-
-NHSK--KELLIFGGEFTNPETSMTHFYNELITYSPDNGQWRKITSQNSPMPRSSAAMCA
HPSGIALLHGGEFSSPKQNTFYHYSDTWLLDTHTKEWTKMD---SAKGPPGRSGHRITIW
KNYFILSGGFKDLGHS-TSYFNDCWCFDITTYKWKQIEFPPNHPIPDARSGHSWIPTEEG
CILWGGYCKVKA--GKGLQKGKILNDCWYLKMKSDLSQVRWERRKKQGFQPSPRVGCSMA
YHK-GRGILFGGVYDFEETEESLESIFYNDLFSYNVESNRWFSLSLRKAQ--KFKKVAKS
SNNKSSKEKEKELQDLLNQILEKNNLKD-DDDD--DEISTGTETETET-----AANS---
-DDEDNKEHSKSAQVTVMSQLPHPRFNAATTVVDDSLFIYGGIWEMGEKDYAIDSLYSID
LNKLDGVSCYWEDLQEIEKAKEIGEQDSDE-DEEE--EDDEE-D--DDEEEIEDKKLVA-
------EEDDEEEEEEEEE-FEEMEIPDLRPWLPHPKPFESLRAFYIREGAAFLEWAISN
NK----HVRGKHLKKKSFDLCEDRWWERRDQVRIEEDKLEELGVVGNVIEKDT-SVPTSK
RR
>KLTH0C11528g
--------------------------MAKKNKKDKEAKKARAELKNKKNLEKAEVKDKKR
-SKK-LN-SEDDDDLDIDEILENFRKEQELFQEVVVTPVKRP-----SPRSNVCMVPNP-
-SHGK--RELLIFGGEYTNQTSSTTTFYNELFTYSLDTDQWKKITSRNAPMPRSSAAAAG
HPSGVVLIHGGEFSSPKQNTFYHYSDSWLLDCSSKEWTKID---QKNGPSARSGHRMTVW
KNFFVMHGGFRDLGTS-TTYLNDCWLFDITTYKWKQVEFPPNHPVPDARSGHSLIPTQEG
AIVWGGYCKIKA--KKGLQKGKILTDCWYLRMKSDITGIRWERRKKQGFQPSPRVGCSMA
HHK-GRGILFGGVYDYEETEEGLSSEFFNDLLSYQVEANRWYSIKMRPQ-----KKKIVA
A-SKSAKSKDDELVGILNDILQKANLADEENEE--NESDSEIEKEL---------HR---
-LDEEELLGHQQKQYPVVAQLPHSRFNAATTVVDDTLFIFGGSWEYGERDFSIDSFYSID
LNRTDGVRVFWEDLEEIEKAKDQGLEEDEE-EEEE--EDDDD-E--DDEEETLDEELIAE
MEDDKQEEEEQEEEEEEE--EAGPEIPDPRPWLPHPKAFETLRAFYIRTGAEFLQWAISN
NR----SAKGKHLKKQSFDLSQDRWWERREQVRIEEDKLEEMGGVENIIERDS-SHST-K
RR
>Kwal_56.22350
MDKRLLKSSSYLPWHRQENSGREFYLAMAKKKKDKEAKKARAEQKNKKNLEKSENKDKKR
-SKK-LG-SEDDDDLDIDEVLANFKKEQELFQEVLVTPVERP-----SQRINSCMVANP-
-IHGK--RELLIFGGEHTNSTNSLTAFYNELFTYSLDSDQWRKITSRNSPMPRSSAAAAA
HSSGVALIHGGEFSSPKQNTFYHYSDTWLLDCTTKEWTKME---QKNGPSARSGHRMTIW
KNFFILHGGFRDLGTS-TTYLNDLWIFDITTYKWKQVEFPPNHPIPDARSGHSIIPTQDG
AVLWGGYCKVKA--GKGLQKGKTLTDCWYLKMKSDVSAIRWERRKKQGFQPSPRVGCSMV
HHK-GRGMLFGGVYDFEETEEGLASEFFNDLFSYQVEANRWYSVKMRPQ------KKKTV
AISRNNRNKDEELENILNDILQQANLAD---DT--DDDDNEIKREL-------QR-----
-IDEEEALENSRKQYEVVGQLPHPRFNATTAVVDDFLFIFGGVWEFGERDFSIDSFYSID
LNKLDGVKVYWENLSELEKAKALGEDDEEE-FDDD--EDDDD-D--DEEEETADQKLVA-
------EDEEEEEEEEEE--EDEPEIPDLRPWLPHPKPFETLRAFYIRTGAEFLKWAISN
NR----DAKGKHLKKQSFDLCQDRWWERREQIRIEEDKLEELGGVENVVERDP-AQTM-K
RR
>TBLA0G01110
--------------------------MAKKNKKDKDAKKARAEAKAKKNQAKAEQKDKKL
-SKKNQL-EEEDDDMAIEDILENFKKQQEQFEKINIETVSKP-----TKRINSCMISNP-
-IHGK--NELILFGGENT---STTTTFYNDLFTYNPENDQWKKYTSQNSPMPRSSSAMIS
HPTGIALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWSKVE---NKNGPSARSGHRMTVW
KNFIILHGGFRDLGTS-TTYLKDLWLFDVTKYKWTQVEFPPNHAIPDARSGHSLIPTQDG
ALLWGGYCKVKA--GKGLQKGKILSDCWYLKMKSDVSGIRWERRKKQGFQPSPRVGCSMV
HHK-GRGILFGGVFDFEETEESLDSLFYNDLFTYQIEINRWFSLSMRSQ-----RKKTIK
IGPKTTKDKEKELQDILNSILKKNNLTD---DD--SEDPNAIEEELKI-----NDDESN-
-SEDESKDGQVTKQYEVMNQLPHVRFNATTAVVNDTLYIFGGSWELGEKDYSIDSFYSID
LNKLDGVTVYWEDMEEIEAAKELGEQFSDE-EDED-DEEEDE-D--DGEEEIVDQKLVA-
------EEDEEEEEIEAD--EDEMEIPDPRPWLPHPKPFETLRAFYVRTGATFLEWAISN
NR----DSKGKHLKKKSFELTEDRWWERRDQVRIEEDKMEELGGIENIVERDT-TQVN-K
RR
>Kpol_1045.77
--------------------------MAKKNKKDKDAKKARAAEKAKKNQVKADQKDKKK
-AKK-SG-FEDDDDMDIEEVLANFKKEQELFEQINIESVERP-----SRRINPCMIENP-
-NHGK--SELILFGGESTNKDTSTTQFFNDLYSYTPENDQWRRYTSKNSPMPRSSAAMAA
HPSGVALIHGGEFSSPKQNTFYHYSDTWLLDCSTKEWTKVE---QKNGPSARSGHRISIW
KNYFMLHGGFRDLGTS-TTYLNDCWLFDITNYKWKQIEFPPNHPIPDARSGHSFIPTQEG
AVLWGGYCKVKA--GKGLQKGKILTDCWYLKMKADPTAIRWERRKKQGFQPSPRVGCSMV
HHK-GRGILFGGVYDFEETEESLDSMFYNDLFSYQIEINRWFALQLRPQ-----RKKVVR
LNNKSSKDKEKELQDLLNQILEKANLNDKDDKDQEDEDAKAIETELDR-----ADHDTSD
SDADDVEDAKEKKEYKVLTQLPHPRFNATMTVVNDTLFIYGGVWELGEKDYTIDSFYSID
LNRTDGVTVLWEDLSEIEAAKEAGIVDSDE-EDDEFGDSDDE-D--DGEEEIMDQKLVA-
------EEEEEEEEEEEEEQVDEMEIPDPCPWLPHPKPFESLRVFYVRTGATFLEWAISN
NR----DARGKHLKKKSFDLCQDRWWQRRDQVRIEEDKMEELGGIGEVIEKDT-SKST-K
RR
>TPHA0M00200
--------------------------MAKKTKKDKDAKKARAEAKAKKNQSKAEIKDKKK
-AKKNLD-GEDEDDMDIEEVLANFKKEQEQFEQINVESVDKP-----TRRINSCMIANP-
-NHGK--KELLLFGGENTSQEQGVTHFYNDLYTFTPDNDLWKKITSQNSPMPRSSAAMAA
HPSGIALLHGGEFSSPKQNTFYHYSDTWLLDCTTREWTKVE---QKNGPSARSGHRITVW
KNYFILHGGFRDLGST-TSYLNDSWLFDITSYKWRQIEFPPNHPVPDARSGHSLIPTQEG
AVLWGGYCKVKA--GKGLQKGKILGDCWYLKMKADPSAVRWERRKKQGFQPSPRVGCSMV
HHK-GRGILFGGVYDFEETEESLDSIFYNDLFSYQIESNRWYALQLRSQ-----RKKVVR
LNNKSSKEKELELQNILNEILEKANLKD----D--DEDANELSNGL-------GSDS---
-DSDDESEKVSKKEYIVRNQLPHHRFNASTTVVDDTLFIYGGVWELGEKDYSIDSMYSID
LNKLDGVTVYWENLHDIEKAKELGAINSDE-EDEE--DEDDE-D--DDEEETVDQKLVA-
------EEEEEEEEIED---ADDMEIPDPRPWLPHPKAFESLRNFYVRTGASFLEWAISN
NK----HTRGKHLKTKSFELCQDRWWERRDQVRIEEDKLEELGGVGEVIEKDT-TKST-K
RR
>ACR016W
--------------------------MAKKGKKDKDAKKARAEAKSKKSLLKAEQKDKKK
-AKK-LG-ADDDDDMDIEEVLANFKRQQAEFEAVNVETVERP-----HQRSSSSLVANP-
-LHNK--RELILFGGEYTNQSTGMTHFYNDLFIYSLDTDQWKKYTSQNSPMPRSSAAIAA
HPSGVVLIHGGEFSSPKQNTFYHYSDTWLFDCATHEWTKIE---QKNGPSSRSGHRMTVW
KNYIILHGGFRDLGTS-TTYLNDCWLFDITTYKWQQLQFPANHPIPDARSGHSLLPTPEG
AILWGGYCKVKA--GKGLQKGKILTDCWYLKMKSDVTAIRWERRKKQGFQPSSRAGCSMV
HHK-GRGILFGGVYDYEETEEGLDSLFYNDLFTYHIETNRWYSVSLRAQ-----RHSKVK
SAPKSNRDKDKELEDMLNAILKKANLDD--DDG--DEDGKTIEEEL-------NKLE---
-NDGITETEETKKSYPIVMKLPHPRFNASTAIVDDTLFIFGGVWEQGEKDYMIDSFYSID
MNKVDGVKVYWEDMAAVERAKELGEEDEDD-AEDD-EDDDSE-D--DDEEEHSDRKLVA-
------EEEEEEEEEDN---EILPEIPDPRPWLPHPKAFESLRAFYVRTGASFLEWAITN
KHNTRSDAKGKHLKKHSFDLCQERWWERREQVRIEEDKLEELGGVGEVIEKDF-TKPT-K
RR
>SAKL0E00880g
--------------------------MAKKNKKDKEAKKARAELKSKKSQGKAELKNKKK
-AKK-LG-IEEEDDVDIEEVLANFKREQEKFEEVVVSTVDRP-----TRRINSSMVANP-
-LHGK--RELLLFGGENTNSTNSTTAFYNDLFTYSLDGDQWRKISSQNSPMPRSSAAIAA
HPSGVVLIHGGEFSSPKQNTFYHYSDTWLLDCNTKEWTKIE---QKNGPTARSGHRLTVW
KNYFILHGGFRDLGTM-TTYLSDCWLFDITTYKWKQVDFPPNHPIPDARSGHSLVPTPDG
AVLWGGYCKVKA--GKGLQKGKILTDCWYLKMKSDIGAIRWERRKKQGFQPSPRVGCSMV
HHK-GRGILFGGVFDFEETEESLESMFYNDLFTFQIETNRWYSASLRPQ------RKAAK
ATSKNNRNKDKELEDILNQILEKANLND-DENE--KETIGDVLKEL-------DEED---
-SDSAEELNSEKKEYPIRIQLPHPRFNASTAVVDDTLFIFGGVWEIGEKDYSIDSFYAID
LNRLDGIKIYWEDLRDIEMAKELGDEEEDF-EDNE-EDDEED-D--DDEEEITDQKLVA-
------EDDDEEEEEED---EYEPEIPDPRPWLPHPKPFETLRGFYVRTGADFLEWAISS
NR----DARGKHLKKKSFDLCQDRWWERRDQVRIEEDKLEELGGIGEVVEKDT-SKSK-K
RR