MUSCLE (3.8) multiple sequence alignment

KNAG0E02790            -------------------MSAYWKKAGITYATYLNVTAKTLRSALKNELQTQNVLSRGT
NCAS0D02200            MLHYKKTLQRISTTTNPMPLSATLRKAGVTYAQYLCVASRTLRASLKTELQTPVVMARSN
KAFR0B06490            -------------------MSSVWRKAGLTYASYLSIASKTLREVLKTEYQTAAVASRSV
CAGL0A01111g           -------------MSAVANASTAWRKAGLSYSSFLAIAARTVRESLKKELQTPAVMGRGK
NDAI0I02740            -----------------MSSSAVWRKAGITYSAYLSIAARTLRAALKPELQTATVMARSH
ACR021W                --------------------MSAWRKAGLTYNSYLAVAARTVRAALKKELQSPAVLNRSV
Ecym_3008              --------------------MSAWRKAGLSYNTYMAVAARAVRSALKPELKNAAVLSRSN
ZYRO0F00418g           --------------------MSAWRKAGLTYNAYLSVAAKTVRSALKPEAQTAAVLSRDR
Kpol_1045.82           --------------------MSAWRKAGITYNGYVNIAAQTVRKALKNELKTNTVLARSK
TDEL0G04650            --------------------MAAWRKAGLTYNTYLSVAARTVRAALKPELQDARVLARSK
TBLA0A07200            --------------------MSAWRKAGITYNAYIAIAAKTVRNALKPELQTAAVIDRSF
Kwal_56.22333          --------------------MSAWRKAGLTYNNYMAIAAQTVRSALKKEAQTARVLDRSK
Kthe_YGOB_Anc_6.6      --------------------MSAWRKAGLTYNNYMAIAAQTVRSALKNDLQTAQVLGRSK
Klac_YGOB_Anc_6.6      --------------------MSTWRKAGLTFNNYVSVAANTVRAALKPELQTNSVLARSK
Sklu_YGOB_Anc_6.6      --------------------MSAWRKAGLTYNNYLSIAAKTVRAALKTEFQTAQVLSRSK
TPHA0J00230            --------------------MSTWRKAGLTYSNYLAVAAKTVRQSLKNDLKTNSVLSRSK
Suva_16.34             --------------------MSAWRKAGVSYAAYLNVAAQTIRSSLKTELQTANVLSRSR
YPL271W                --------------------MSAWRKAGISYAAYLNVAAQAIRSSLKTELQTASVLNRSQ
Smik_6.479             --------------------MSAWRKAGISYAAYLNVAAKAIRSSLKTELQTASVLSRSK
Skud_16.6              --------------------MSAWRKAGISYAAYLNVAAQTIRSSLKTELQTASVLSRSK
                                            :  .***:::  :: :::.::*  ** : :   *  *. 

KNAG0E02790            TDAAYTVYEKGTPKADPQPLQETS-
NCAS0D02200            TDAYYTKYEKGSPIADPAPLQTSRD
KAFR0B06490            TEAHVTNYKNGSPLSDPEPLQKSDS
CAGL0A01111g           TDAAYTKYEKGSPKSDPIPLQE---
NDAI0I02740            TDAYFTKYKDGAPASEPESLQKK--
ACR021W                TEAKVIDYASKGSAAEAVPLRK---
Ecym_3008              TEAKVINYKDGAA-SDAVPLKK---
ZYRO0F00418g           VDSKYTKFEKGEPQGEPKPLVN---
Kpol_1045.82           TEAKFVSFENGAPKGEPVPIQQ---
TDEL0G04650            TDARYVKYEKGSAASDSVPLQE---
TBLA0A07200            TEARFTKYTKGSPDADPALLKELPN
Kwal_56.22333          TEARFVKYENGTATAESQPLKE---
Kthe_YGOB_Anc_6.6      TEARFIKYEKGTPVAEAQPLKN---
Klac_YGOB_Anc_6.6      SEAKFIKFENGVA-SEPVPLKK---
Sklu_YGOB_Anc_6.6      SEAKFIKFENGTP-SDPIPLKK---
TPHA0J00230            TDIKYTIFEKGTAKSEPTSISD---
Suva_16.34             TDAYYTKYKNGTAASEPVSITK---
YPL271W                TDAFYTQYKNGTAASEPTPITK---
Smik_6.479             TDAFYTQYKNGAAASEPTPITK---
Skud_16.6              TDAFYTKYKNGAAASEPTPITK---
                        :     : .  . .:.  :     

FASTA FORMAT for MUSCLE Version 3.6

>KNAG0E02790
-------------------MSAYWKKAGITYATYLNVTAKTLRSALKNELQTQNVLSRGT
TDAAYTVYEKGTPKADPQPLQETS-
>NCAS0D02200
MLHYKKTLQRISTTTNPMPLSATLRKAGVTYAQYLCVASRTLRASLKTELQTPVVMARSN
TDAYYTKYEKGSPIADPAPLQTSRD
>KAFR0B06490
-------------------MSSVWRKAGLTYASYLSIASKTLREVLKTEYQTAAVASRSV
TEAHVTNYKNGSPLSDPEPLQKSDS
>CAGL0A01111g
-------------MSAVANASTAWRKAGLSYSSFLAIAARTVRESLKKELQTPAVMGRGK
TDAAYTKYEKGSPKSDPIPLQE---
>NDAI0I02740
-----------------MSSSAVWRKAGITYSAYLSIAARTLRAALKPELQTATVMARSH
TDAYFTKYKDGAPASEPESLQKK--
>ACR021W
--------------------MSAWRKAGLTYNSYLAVAARTVRAALKKELQSPAVLNRSV
TEAKVIDYASKGSAAEAVPLRK---
>Ecym_3008
--------------------MSAWRKAGLSYNTYMAVAARAVRSALKPELKNAAVLSRSN
TEAKVINYKDGAA-SDAVPLKK---
>ZYRO0F00418g
--------------------MSAWRKAGLTYNAYLSVAAKTVRSALKPEAQTAAVLSRDR
VDSKYTKFEKGEPQGEPKPLVN---
>Kpol_1045.82
--------------------MSAWRKAGITYNGYVNIAAQTVRKALKNELKTNTVLARSK
TEAKFVSFENGAPKGEPVPIQQ---
>TDEL0G04650
--------------------MAAWRKAGLTYNTYLSVAARTVRAALKPELQDARVLARSK
TDARYVKYEKGSAASDSVPLQE---
>TBLA0A07200
--------------------MSAWRKAGITYNAYIAIAAKTVRNALKPELQTAAVIDRSF
TEARFTKYTKGSPDADPALLKELPN
>Kwal_56.22333
--------------------MSAWRKAGLTYNNYMAIAAQTVRSALKKEAQTARVLDRSK
TEARFVKYENGTATAESQPLKE---
>Kthe_YGOB_Anc_6.6
--------------------MSAWRKAGLTYNNYMAIAAQTVRSALKNDLQTAQVLGRSK
TEARFIKYEKGTPVAEAQPLKN---
>Klac_YGOB_Anc_6.6
--------------------MSTWRKAGLTFNNYVSVAANTVRAALKPELQTNSVLARSK
SEAKFIKFENGVA-SEPVPLKK---
>Sklu_YGOB_Anc_6.6
--------------------MSAWRKAGLTYNNYLSIAAKTVRAALKTEFQTAQVLSRSK
SEAKFIKFENGTP-SDPIPLKK---
>TPHA0J00230
--------------------MSTWRKAGLTYSNYLAVAAKTVRQSLKNDLKTNSVLSRSK
TDIKYTIFEKGTAKSEPTSISD---
>Suva_16.34
--------------------MSAWRKAGVSYAAYLNVAAQTIRSSLKTELQTANVLSRSR
TDAYYTKYKNGTAASEPVSITK---
>YPL271W
--------------------MSAWRKAGISYAAYLNVAAQAIRSSLKTELQTASVLNRSQ
TDAFYTQYKNGTAASEPTPITK---
>Smik_6.479
--------------------MSAWRKAGISYAAYLNVAAKAIRSSLKTELQTASVLSRSK
TDAFYTQYKNGAAASEPTPITK---
>Skud_16.6
--------------------MSAWRKAGISYAAYLNVAAQTIRSSLKTELQTASVLSRSK
TDAFYTKYKNGAAASEPTPITK---