MUSCLE (3.8) multiple sequence alignment

Kpol_1068.7        -MRVPIEELIRNQPDEVLVSDGGLGTLLESRGINVSSPLWSTVPFLKDDFWD-SETKTSD
TPHA0I00260        -MRVPFRKFIDEHPNEILVLDGGQGTELENRGVNINSPLWSTISFVNDKFWD-ENIENTE
ZYRO0G14212g       -MRQQLLEVLRDT-DRVLVMDGGQGTELENRGMNISGPIWSTVPFTKEEFWN-FDQPYTD
TBLA0B03260        -MRQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQ-KDEKSQN
ABL125W            MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQ--QPDSRE
Ecym_4612          MVRASVKQLLQSNPDQILIMDGGQGTELENRGINVANPVWSTIPFINDSFWS--DRSSRD
KLTH0C03850g       MPRPSVKEYLASNPEEVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWTANDSSSKD
Kwal_27.10255      MVRTSIKEFLEKNPREVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSAEDQSSKD
NCAS0D04940        MTRQSIKEYLQQNPDKVLVLDGGQGTELENRGINVANPVWSTIPFVSESFWS--DKSSND
Suva_16.32         MSK--------NKPRK--------------------------------------------
Smik_6.484         MARLPLKQLLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWS--DESSSS
YPL273W            MARLPLKQFLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWS--DESSAN
KLLA0D01551g       -MRVPIKKYFEENPDVVLVMDGGQGTELENRGINVANPVWSTVPFINESFWS--SDASKD
SAKL0D01452g       MARQPIKQFFQEHPDEILVMDGGQGTELENRGIKVANPVWSTIPFISESFWS--NESSRD
                     .                                                         

Kpol_1068.7        RNIIEGIYRDYITSGSRILSTITYQTSFALISTHTEVKTIEGYKQLIRNITSFCRSAIGE
TPHA0I00260        RKCIREMFNDFKDAGANVFSTLTYQTSFSSVSENTDIKSLQEYHELLRKITGFCRRCISD
ZYRO0G14212g       RDVVNSMFKAYVDAGAQLLSTVTYQTSYKTICAHTDIHTRTQYDQLLDRIVGFCRRCIGD
TBLA0B03260        ISIVKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGN
ABL125W            RAIVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGD
Ecym_4612          RQIVAGMFEEYIAAGANLLMTITYQSSFKSVSENTDIKTLEEYNQLLDRIVAFSRTCIGA
KLTH0C03850g       RQIVKEMYEDFLKAGARVLMTVTYQASFKSVSENTSITTLEEYDALLSRIVSFSRSCIGD
Kwal_27.10255      RQIVKEMYSDFLKAGARVLMTVTYQASFKSVSENTRIKTLEEYDSLLNRIVTFSRECIGD
NCAS0D04940        RQIVKEMFEDFLAAGAEILMTTTYQTSFKSVSENTDIKTLQEYNELLNRIVSFSRDCIGE
Suva_16.32         ----------------NSLMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGE
Smik_6.484         RKIVKEMFNDFLDAGAEILMTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRGCIGE
YPL273W            RKIVKEMFNDFLNAGAEILMTTTYQTSYKSVSENTPIRTLSEYNNLLNRIVDFSRNCIGE
KLLA0D01551g       RIIVKQMFEDFIEAGADILMTITYQTSFKSVSENTPIRTLEEYNGLLDRIVSFSRSCIGE
SAKL0D01452g       RQIVKEMFDDFIKVGSRILMTTTYQTSFKSVSENTPIKTLKEYNQLLERIVAFSRECIGE
                                     : : *** *:  :  :* : :   *  *: .*. *.*  :. 

Kpol_1068.7        DNYLIGSIGPFGARLGAEYTGNYGDSPSNINYLEYFKPQLEEFNNNDDIDIIGFETVPNK
TPHA0I00260        DDYLLGCIGAYAASIGAEYDGNYGLFAGKIDYLKYFKPQLDEFNNDMNIDIIGFETIPNK
ZYRO0G14212g       DHYLVGSIGPYAAHVGAEYTGDYGPKPEEIDYWQYFEPQVANFNRNETIDIIGLETVPNV
TBLA0B03260        SKYLIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQLDNFNDNDDIDLIAMETVPNK
ABL125W            DKYLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNA
Ecym_4612          DNYLVGCIGSWGAHICAEFSGDYGEHPERIPYLDYFRPQLNNFNLQEDIDVIGFETIPNI
KLTH0C03850g       DKWLVGCIGPWGAHNCSEFTGDYGSEPEKIDYLQYFKPQLDNFTVNDDLDLIGFETIPNI
Kwal_27.10255      DKFLVGCIGAWGAHNCSEFTGDYGAEPEKIDFLQYFKPQLDNFTNNENIDLIGFETIPNI
NCAS0D04940        QKYLIGCIGPWGAHVCAEFNGDYGAHPENIDYYQYFKPQLDNFFANENLDLIGFETVPNV
Suva_16.32         EKHLIGCIGPWGAHVCCEFTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNI
Smik_6.484         DKYLIGCIGPWGAHICREFTGDYGANPESIDFYQYFKPQLDNFNKNDNLDLIGFETIPNI
YPL273W            DKYLIGCIGPWGAHICREFTGDYGAEPENIDFYQYFKPQLENFNKNDKLDLIGFETIPNI
KLLA0D01551g       DRYLIGCIGAWGAHVCSEFTGDYGPHPDQIDYFEYFRPQLGNFVQSKDIDIIGFETIPNI
SAKL0D01452g       DKYLIGCIGAWGAHVCCEFTGDYGANPERIDFLEYFRPQLQNFNSSEQIDLIGFETIPNV
                   .  *:*.**.:.:    *: *:**  .  : :  ** **: :*  .  :*::.:**:** 

Kpol_1068.7        YELEAILSWDKSVISKPYYVSLSLLDNGGLRDGTSFEEIATIFKKYSN--NDNLILTGAN
TPHA0I00260        HELEAILSWDEDIINRPFFIALSLSDKNGLRDGTSFEEMGRLFAKYKGR-NKNLVYVGGN
ZYRO0G14212g       HELKSILSWDETKISKPFYVSLCVGDDGNLRDGTPLEQLVPLF---ANRSNKNLLLVGIN
TBLA0B03260        YELKALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVK-NPNLMMVGVN
ABL125W            HELRAILSWDESVIAKPFYVALSVHDAGTLRDGTPMADVAAIVAA-AAPLNPNFLGLGIN
Ecym_4612          HELTAILSWDESIIKKPFYIGMSVHEHGTLRDGTTMSQVAQLFRSLGKKLNPNFLALGIN
KLTH0C03850g       HELRAILSWDTTILPKPFYIGLSVHEHGVLRDGTTMHEVAELIKSLGDKINPNFVLLGIN
Kwal_27.10255      HELRAILSWDESIINKPFYIGLSVHENGLLRDGTTMHQVAELIKSFGDRLNPNFTLLGIN
NCAS0D04940        NELKAILSWDEKILSKPFYIGLSVHENGVLRDGTTMEEIGNIFKSLGNKVNPNLLLLGIN
Suva_16.32         HELKAILSWDESILSKPFYIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGIN
Smik_6.484         HELKAILSWDESVLSKPFYIGLSVHEHGVLRDGTTMQEVAKVIKDLGDKINPNFSLLGIN
YPL273W            HELKAILSWDESILSRPFYIGLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFSFLGIN
KLLA0D01551g       HELRAILSWDETVLSKPFYIGLSVHEYGVLRDGTSMQQIADLISSLGDKLNSNLMFIGIN
SAKL0D01452g       HELKAILSWDESIISKPFYIGLSVHENGVLRDGTTMKEVADIIKSLGDKLNPNLMLLGIN
                    ** ::****   : .*:::.:.: : . *****.:  :  :.       * *:   * *

Kpol_1068.7        CISFKYASENISKLHQAIPTLP--LIVYPNSGEIYDPLTKKWTI-D--QTFGLTWEDLIK
TPHA0I00260        CISYAYSIDNIRKLHDIVPHLN--LIAYPNSGEIYDQKSKQWSS-T--SAIKISWEEVVN
ZYRO0G14212g       CCSLSVSSQALSHLNEILASTPMGLLVYPNSGEIYDHKTQTWSRPTGLDSHRLSWPSLVQ
TBLA0B03260        CVSYDKTLMIIKKLQIAVPDLP--LVCYPNSGEVYDQITQSWKTNN--DIKLDSWETLVK
ABL125W            CSSLSRTPAILAELHALLPALP--MTIYPNSGEIYDPVKKVWNA----SPHVVDWGAVVA
Ecym_4612          CCSFRYSHMILESLHEELPYIP--LIAYPNSGELYDTVKKIWLK-N--ENCIVTWDEIVK
KLTH0C03850g       CVSYNHSPEILRSLHQEIPELP--LIAYPNSGEVYDTVKKIWNP-K--GDHTLTWDQVVK
Kwal_27.10255      CVSYNQSHDILRSLHEELPEMP--LIAYPNSGEVYDTVKKIWNP-K--NSQTLSWEQIVK
NCAS0D04940        CVSFNHSPSILEDIHKNLPDMP--LIAYPNSGEVYDTVKKIWLPQN--SENSLTWEQVVK
Suva_16.32         CVSFNQSPDILESLHRALPNMP--LLAYPNSGEVYDTEKKIWLP-N--SDKLNSWDTVVK
Smik_6.484         CVSFNQSPDILESLHQALPDMA--LLAYPNSGEVYDTEKKIWLP-N--SDKLNSWDAVVK
YPL273W            CVSFNQSPDILESLHQALPNMA--LLAYPNSGEVYDTEKKIWLP-N--SDKLNSWDTVVK
KLLA0D01551g       CCAFNQSHMILESLHNSCPNMP--LIVYPNSGEIYDTVKKIWLK-N--ENQLCTWDDVVK
SAKL0D01452g       CVSFNHSHLILSSLHKELPDMP--MIVYPNSGEIYDTVKKIWLH-N--ENQKVTWDDVVK
                   * :   :   :  ::   .     :  ******:**  .: *            *  :: 

Kpol_1068.7        ELRTSNVRIVGGCCRTTPDDINKIKDMITKVK-------------
TPHA0I00260        EYADAGVKIIGGCCRTTPDDIKQIKKAVDAL--------------
ZYRO0G14212g       EYRKFGARAIGGCCRTTPLDIQEICKVVDRN--------------
TBLA0B03260        DLVANGVRMVGGCCRTTPDDIHKIAQAVSHLSH------------
ABL125W            SYIRSGARIIGGCCRTIPNDIRQIADAVRTHARASSTDVPGHASP
Ecym_4612          SYLQSGARIIGGCCRTTPNDIRQIVTAVKKYKP------------
KLTH0C03850g       SYIDSGARIIGGCCRTSPKDIAAINAAVNKYRPN-----------
Kwal_27.10255      SYIDSGARIIGGCCRTSPKDIEAIHEAVQKYRPN-----------
NCAS0D04940        RYIEAGARIIGGCCRTTPKDILEISKAVKKFSK------------
Suva_16.32         QYIGSGARIIGGCCRTTPKDIQEVSAAVKKYT-------------
Smik_6.484         RYISSGARIIGGCCRTSPKDIQEIFTAVKKYT-------------
YPL273W            QYISSGARIIGGCCRTSPKDIQEISAAVKKYT-------------
KLLA0D01551g       SYIENGARIIGGCCRTTVDDIKEVRLAVNKYAKQTTSSL------
SAKL0D01452g       SYIENGARIIGGCCRTSPQDIKDIVQAIEKYKSQ-----------
                        ... :******   **  :   :                 

FASTA FORMAT for MUSCLE Version 3.6

>Kpol_1068.7
-MRVPIEELIRNQPDEVLVSDGGLGTLLESRGINVSSPLWSTVPFLKDDFWD-SETKTSD
RNIIEGIYRDYITSGSRILSTITYQTSFALISTHTEVKTIEGYKQLIRNITSFCRSAIGE
DNYLIGSIGPFGARLGAEYTGNYGDSPSNINYLEYFKPQLEEFNNNDDIDIIGFETVPNK
YELEAILSWDKSVISKPYYVSLSLLDNGGLRDGTSFEEIATIFKKYSN--NDNLILTGAN
CISFKYASENISKLHQAIPTLP--LIVYPNSGEIYDPLTKKWTI-D--QTFGLTWEDLIK
ELRTSNVRIVGGCCRTTPDDINKIKDMITKVK-------------
>TPHA0I00260
-MRVPFRKFIDEHPNEILVLDGGQGTELENRGVNINSPLWSTISFVNDKFWD-ENIENTE
RKCIREMFNDFKDAGANVFSTLTYQTSFSSVSENTDIKSLQEYHELLRKITGFCRRCISD
DDYLLGCIGAYAASIGAEYDGNYGLFAGKIDYLKYFKPQLDEFNNDMNIDIIGFETIPNK
HELEAILSWDEDIINRPFFIALSLSDKNGLRDGTSFEEMGRLFAKYKGR-NKNLVYVGGN
CISYAYSIDNIRKLHDIVPHLN--LIAYPNSGEIYDQKSKQWSS-T--SAIKISWEEVVN
EYADAGVKIIGGCCRTTPDDIKQIKKAVDAL--------------
>ZYRO0G14212g
-MRQQLLEVLRDT-DRVLVMDGGQGTELENRGMNISGPIWSTVPFTKEEFWN-FDQPYTD
RDVVNSMFKAYVDAGAQLLSTVTYQTSYKTICAHTDIHTRTQYDQLLDRIVGFCRRCIGD
DHYLVGSIGPYAAHVGAEYTGDYGPKPEEIDYWQYFEPQVANFNRNETIDIIGLETVPNV
HELKSILSWDETKISKPFYVSLCVGDDGNLRDGTPLEQLVPLF---ANRSNKNLLLVGIN
CCSLSVSSQALSHLNEILASTPMGLLVYPNSGEIYDHKTQTWSRPTGLDSHRLSWPSLVQ
EYRKFGARAIGGCCRTTPLDIQEICKVVDRN--------------
>TBLA0B03260
-MRQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQ-KDEKSQN
ISIVKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGN
SKYLIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQLDNFNDNDDIDLIAMETVPNK
YELKALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVK-NPNLMMVGVN
CVSYDKTLMIIKKLQIAVPDLP--LVCYPNSGEVYDQITQSWKTNN--DIKLDSWETLVK
DLVANGVRMVGGCCRTTPDDIHKIAQAVSHLSH------------
>ABL125W
MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQ--QPDSRE
RAIVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGD
DKYLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNA
HELRAILSWDESVIAKPFYVALSVHDAGTLRDGTPMADVAAIVAA-AAPLNPNFLGLGIN
CSSLSRTPAILAELHALLPALP--MTIYPNSGEIYDPVKKVWNA----SPHVVDWGAVVA
SYIRSGARIIGGCCRTIPNDIRQIADAVRTHARASSTDVPGHASP
>Ecym_4612
MVRASVKQLLQSNPDQILIMDGGQGTELENRGINVANPVWSTIPFINDSFWS--DRSSRD
RQIVAGMFEEYIAAGANLLMTITYQSSFKSVSENTDIKTLEEYNQLLDRIVAFSRTCIGA
DNYLVGCIGSWGAHICAEFSGDYGEHPERIPYLDYFRPQLNNFNLQEDIDVIGFETIPNI
HELTAILSWDESIIKKPFYIGMSVHEHGTLRDGTTMSQVAQLFRSLGKKLNPNFLALGIN
CCSFRYSHMILESLHEELPYIP--LIAYPNSGELYDTVKKIWLK-N--ENCIVTWDEIVK
SYLQSGARIIGGCCRTTPNDIRQIVTAVKKYKP------------
>KLTH0C03850g
MPRPSVKEYLASNPEEVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWTANDSSSKD
RQIVKEMYEDFLKAGARVLMTVTYQASFKSVSENTSITTLEEYDALLSRIVSFSRSCIGD
DKWLVGCIGPWGAHNCSEFTGDYGSEPEKIDYLQYFKPQLDNFTVNDDLDLIGFETIPNI
HELRAILSWDTTILPKPFYIGLSVHEHGVLRDGTTMHEVAELIKSLGDKINPNFVLLGIN
CVSYNHSPEILRSLHQEIPELP--LIAYPNSGEVYDTVKKIWNP-K--GDHTLTWDQVVK
SYIDSGARIIGGCCRTSPKDIAAINAAVNKYRPN-----------
>Kwal_27.10255
MVRTSIKEFLEKNPREVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSAEDQSSKD
RQIVKEMYSDFLKAGARVLMTVTYQASFKSVSENTRIKTLEEYDSLLNRIVTFSRECIGD
DKFLVGCIGAWGAHNCSEFTGDYGAEPEKIDFLQYFKPQLDNFTNNENIDLIGFETIPNI
HELRAILSWDESIINKPFYIGLSVHENGLLRDGTTMHQVAELIKSFGDRLNPNFTLLGIN
CVSYNQSHDILRSLHEELPEMP--LIAYPNSGEVYDTVKKIWNP-K--NSQTLSWEQIVK
SYIDSGARIIGGCCRTSPKDIEAIHEAVQKYRPN-----------
>NCAS0D04940
MTRQSIKEYLQQNPDKVLVLDGGQGTELENRGINVANPVWSTIPFVSESFWS--DKSSND
RQIVKEMFEDFLAAGAEILMTTTYQTSFKSVSENTDIKTLQEYNELLNRIVSFSRDCIGE
QKYLIGCIGPWGAHVCAEFNGDYGAHPENIDYYQYFKPQLDNFFANENLDLIGFETVPNV
NELKAILSWDEKILSKPFYIGLSVHENGVLRDGTTMEEIGNIFKSLGNKVNPNLLLLGIN
CVSFNHSPSILEDIHKNLPDMP--LIAYPNSGEVYDTVKKIWLPQN--SENSLTWEQVVK
RYIEAGARIIGGCCRTTPKDILEISKAVKKFSK------------
>Suva_16.32
MSK--------NKPRK--------------------------------------------
----------------NSLMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGE
EKHLIGCIGPWGAHVCCEFTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNI
HELKAILSWDESILSKPFYIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGIN
CVSFNQSPDILESLHRALPNMP--LLAYPNSGEVYDTEKKIWLP-N--SDKLNSWDTVVK
QYIGSGARIIGGCCRTTPKDIQEVSAAVKKYT-------------
>Smik_6.484
MARLPLKQLLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWS--DESSSS
RKIVKEMFNDFLDAGAEILMTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRGCIGE
DKYLIGCIGPWGAHICREFTGDYGANPESIDFYQYFKPQLDNFNKNDNLDLIGFETIPNI
HELKAILSWDESVLSKPFYIGLSVHEHGVLRDGTTMQEVAKVIKDLGDKINPNFSLLGIN
CVSFNQSPDILESLHQALPDMA--LLAYPNSGEVYDTEKKIWLP-N--SDKLNSWDAVVK
RYISSGARIIGGCCRTSPKDIQEIFTAVKKYT-------------
>YPL273W
MARLPLKQFLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWS--DESSAN
RKIVKEMFNDFLNAGAEILMTTTYQTSYKSVSENTPIRTLSEYNNLLNRIVDFSRNCIGE
DKYLIGCIGPWGAHICREFTGDYGAEPENIDFYQYFKPQLENFNKNDKLDLIGFETIPNI
HELKAILSWDESILSRPFYIGLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFSFLGIN
CVSFNQSPDILESLHQALPNMA--LLAYPNSGEVYDTEKKIWLP-N--SDKLNSWDTVVK
QYISSGARIIGGCCRTSPKDIQEISAAVKKYT-------------
>KLLA0D01551g
-MRVPIKKYFEENPDVVLVMDGGQGTELENRGINVANPVWSTVPFINESFWS--SDASKD
RIIVKQMFEDFIEAGADILMTITYQTSFKSVSENTPIRTLEEYNGLLDRIVSFSRSCIGE
DRYLIGCIGAWGAHVCSEFTGDYGPHPDQIDYFEYFRPQLGNFVQSKDIDIIGFETIPNI
HELRAILSWDETVLSKPFYIGLSVHEYGVLRDGTSMQQIADLISSLGDKLNSNLMFIGIN
CCAFNQSHMILESLHNSCPNMP--LIVYPNSGEIYDTVKKIWLK-N--ENQLCTWDDVVK
SYIENGARIIGGCCRTTVDDIKEVRLAVNKYAKQTTSSL------
>SAKL0D01452g
MARQPIKQFFQEHPDEILVMDGGQGTELENRGIKVANPVWSTIPFISESFWS--NESSRD
RQIVKEMFDDFIKVGSRILMTTTYQTSFKSVSENTPIKTLKEYNQLLERIVAFSRECIGE
DKYLIGCIGAWGAHVCCEFTGDYGANPERIDFLEYFRPQLQNFNSSEQIDLIGFETIPNV
HELKAILSWDESIISKPFYIGLSVHENGVLRDGTTMKEVADIIKSLGDKLNPNLMLLGIN
CVSFNHSHLILSSLHKELPDMP--MIVYPNSGEIYDTVKKIWLH-N--ENQKVTWDDVVK
SYIENGARIIGGCCRTSPQDIKDIVQAIEKYKSQ-----------