MUSCLE (3.8) multiple sequence alignment

KLTH0C10516g      MSTGIPSVPHKKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQG--DPATLP
Kwal_23.6537      MVATGADVPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVD--GPLSFY
Smik_15.561       MASSVPNIPSYKRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDRSSSSSFP
Suva_8.436        MASSGSNPQPYKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEED--GPLASS
Skud_15.546       MVSSGSNSQPYKRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVD--GSSTSP
YOR380W           MASPGSTALPHKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYIDGR--VPSASP
                  * :  .     ** *.****:***:***.*:.  ** ** :*.* *:* :     . :  

KLTH0C10516g      -APLIPEIPDST--RSISPPRTRMVAKPPSIRTKILLNSTQCAADQGVFDAAKSRYMGLS
Kwal_23.6537      -----EKRPSPKQSTSPSTIQKKEVERPSML--------SPCSSERGIFDPSKSRYMSLH
Smik_15.561       -VQKLDELPHAPESKPFAASNIHGNE-VSSV-------DTQTVTNQSITDPVKSRYTIQH
Suva_8.436        RMNQVEELPHDTKNRPYVPLDIIGNG-THST-------DSQHVTNGNIIDRTKSRYTIQH
Skud_15.546       ---RVDETPYGTDNRPYSLPNILRNE-ARSV-------DAQNVTNQNIIDPIKSRYTIQH
YOR380W           QVQQVGETSPDTESRPFVLPGIHRNEQPQPI-------NTQNVTSQNIVDPTKSRYTIQH
                        : .      .                       :   :. .: *  ****    

KLTH0C10516g      SAVAFARSLGIELQSANPPHLHSFAWNCGLRSEEKSNTHCALHDLITKEETFHFTQIYFS
Kwal_23.6537      SAVAFPRYLGLELQSVNPPHLHSFAWNCGIRPEENSTSHPDLANIISKDDCNRFTDVYFE
Smik_15.561       SAVAFPRCLGLELRSANPPRLHSFAWHCGIRPEENPSSHVLLSELITKEEYYRVSKVYFS
Suva_8.436        SAVAFPRSLGLELRSTNPPRLHCFAWHCGIRPEEKPSFHVPLSDIVTKEEYYRISKVYFS
Skud_15.546       SAVAFPRCLGLELRSTNPPRLHSFAWHCGIRPEENPNSHILLSGLVTKEEYYRISKVYFS
YOR380W           SAVAFPRCLGLELRSTNPPRLHSFAWHCGIRPEENPNSHVLLSDLVTKEEYYRISKVYFS
                  *****.* **:**.*.***.**.***:**:*.**:.. *  *  :::*::  ..:.:**.

KLTH0C10516g      AIHPVFDVVDPEHFKKSVESYWNDGCKVSAFGAVVGGIIALGSLFSGRPGHPRELEIVQY
Kwal_23.6537      VVHPMFDIIDPSQFRQSLDSYWGGARNVSAFDAVIGGVVALGSFFSRNFGHARELDIVQY
Smik_15.561       VVHPIFDVVDPKQLAKNVEEYWAGNISNFEYGAVIAGVVALGSFFLGSIGHPREMDVVQY
Suva_8.436        VVHPIFDIVDPEQLGKNVEKYWNGDAETSEYGAVIAGVIALGSFFLGSLGHPREMDIIQY
Skud_15.546       VVHPIFDVVDPEQLAKNVERYWDGDVKMLEYGAVIAGVIALGSFFLGSLGHPREMDVVQY
YOR380W           VVHPIFDVVNPEQLAKNVEKYWDGDVKTLEYGAVIAGVIALGSFFMGSLGHPREMDIVQY
                  .:**:**:::*.:: :.:: ** .  .   :.**:.*::****:*    **.**::::**

KLTH0C10516g      AKNVLEDPTFSRLPSAEQVSAWVLRTLYLRATTRPHAAWLASCVTIHLAEASALHHEVEN
Kwal_23.6537      AKDILEDPTFSSQPSIEQISAWVLRSIYLRATARPHVAWLASCMTMHLVEATALHHEVDK
Smik_15.561       AKGILDDPTFSRIPTVEHVSAWVLRTIYLRATSRPHVAWLASCVTIHLSEAIGLHQDIDK
Suva_8.436        AKGILDDPTFSRIPSVEQISAWVLRTIYLRATARPHVAWLASCLTIHLSEAIGLHHEIDR
Skud_15.546       AKGILDDPTFCRIPTVEQVSAWVLRTIYLRATSRPHVAWLASCITIHLSEAIGLHHEIDR
YOR380W           AKGILDDPTFSRIPTVEQVSAWVLRTIYLRATSRPHVAWLASCVTIHLSEAIGLHHEIDR
                  **.:*:****.  *: *::******::*****:***.******:*:** ** .**::::.

KLTH0C10516g      VEL-TANDKALPPRTKKITERARRLFWCAWSINSILSYDYGRSSASLGGISCKLPTKSDG
Kwal_23.6537      VELATRNDAPLPPRANSVCERARRLFWCAWCINTIISYEYGRSCVTLNKISCKLLKESTK
Smik_15.561       GEFSMTSGVTL-RRTAGFNEHTKRLFWCAWSINTILSYDYGRSSVALNRITCKPVEETEG
Suva_8.436        EDLALTNNVPL-KRTTEVSEHTRRLFWSAWSINTILSYDYGRSSVTLNRITCKPVKETDG
Skud_15.546       EDLVMTSNVPL-RRTTEVSEHTRRLFWCAWSINTILSYDYGRSSVTLNRITCKSVKETEG
YOR380W           EDIAISNNVP-PKRTTVVSEHTRRLFWCAWSINTILSYDYGRSSVTLNRITCKPVKETDG
                   ::   .. .   *:  . *.:.****.**.**:*:**:****..:*. *:**   ::  

KLTH0C10516g      NYTAQLVDLALIIPPANTEASKETRVADLLQALTLVYETPDEHNFLSLVKADLCNSFYRR
Kwal_23.6537      NYTAEMVELARMIPTTSQCSDPASQVAALIEAIDRVYKAADVHPFLSLTKADLCHSFYRR
Smik_15.561       SYTIHLVALAQTIPQGTVNTD----LTQLLNALTAIHKSPNAHPFLLLTKCDICLSLYRR
Suva_8.436        NYTVNLVSLAQLVPQESVNAN----VTQLLQALAAVHESPDAHPFLSLTKADICLSFYRR
Skud_15.546       NHTVHLVALAQLIPQDCVNAN----ATQLLQALAAVHKSPNAHPFLSLTKSDICLSLYRR
YOR380W           NFTAHLVALAHLIPQDSVNAN----AAQLLQALAAVHESPNAHPFLSLTKGDICLSLYRR
                  ..*  :* **  :*     :.     : *::*:  ::::.: * ** *.* *:* *:***

KLTH0C10516g      LRLFNYTLDSEVVFQLTTVCNHALSAAYDLVERKLPWWNVLSAPFQYICVLLAINTSESL
Kwal_23.6537      LRLLNHVLDRSVVLQIINIGTSALSAAEDLVRKNHTWWNVLSTVFHYFCVLLAIDSPDSL
Smik_15.561       LRLLNHVLDKSVVLQIIDIGNAALSAAYALVKLGQSWWNVLSTSFQYVCVLLAIDTPESL
Suva_8.436        LRLLNHILDKSVVSQIIDIGNTALAAAYALVKIDQAWWNVLSTSFQYVCVLLAIDTPESL
Skud_15.546       LRLLNHILDKSVVLQIIDIGNTALSAAYALVKLDQAWWNVLSTSFQYVCVLLAIDTPESL
YOR380W           LRLLNHILDKNVVLQIIDIGNTALSAAYALVKLDQAWWNVLSTSFQYVCVLLAIDTPESL
                  ***:*: ** .** *:  : . **:**  **    .******: *:*.******::.:**

KLTH0C10516g      ANVAKAKNIFDRIVSNLNTHMAIEAQNTIKLLLQDSIKKKRQELTDLEAADQAGTASEAP
Kwal_23.6537      SNVAAAKSIFDSIVKILDTHIAKEAQATAKLLLRDSMKKKKREIAHLEIADKEGPAPNTN
Smik_15.561       SHVAAAMKTLDNITEVLGTHIALEAQKTAKLLLEDSMKKKRQEIQQLEQATHDRSTFENT
Suva_8.436        SHVAAAMRTLDNITQVLGTHIAFEAQKTAKLLLEDSVKKKRQEIQQLEQATHQRSAPETT
Skud_15.546       SHVAAAMRTLDNITQVLGTHIAYEAQKTAKLLLEDSMKKKRQEIQQLERATHQRSTVETT
YOR380W           SHVATAMKTLDNITQILGTRIAFEAQKTAKLLLEDSMKKKRQEIQQLEQATHQRSNLETT
                  ::** *   :* *.. *.*.:* *** * **** **:***..*:  ** * :  .  :  

KLTH0C10516g      FTAEIDWDVLLDPSHALHLMQQDFSSF
Kwal_23.6537      YSPDIDWDALLDPSNSLNLMHQEYSIL
Smik_15.561       NSLDIDWDALFDPSGTLGFM-------
Suva_8.436        HLLDIDWDALLDPSDTLSFM-------
Skud_15.546       HLLDIDWDVLLDPSDTLNFM-------
YOR380W           HLLDIDWDALLDPSDTLNFM-------
                     :****.*:*** :* :*       

FASTA FORMAT for MUSCLE Version 3.6

>KLTH0C10516g
MSTGIPSVPHKKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQG--DPATLP
-APLIPEIPDST--RSISPPRTRMVAKPPSIRTKILLNSTQCAADQGVFDAAKSRYMGLS
SAVAFARSLGIELQSANPPHLHSFAWNCGLRSEEKSNTHCALHDLITKEETFHFTQIYFS
AIHPVFDVVDPEHFKKSVESYWNDGCKVSAFGAVVGGIIALGSLFSGRPGHPRELEIVQY
AKNVLEDPTFSRLPSAEQVSAWVLRTLYLRATTRPHAAWLASCVTIHLAEASALHHEVEN
VEL-TANDKALPPRTKKITERARRLFWCAWSINSILSYDYGRSSASLGGISCKLPTKSDG
NYTAQLVDLALIIPPANTEASKETRVADLLQALTLVYETPDEHNFLSLVKADLCNSFYRR
LRLFNYTLDSEVVFQLTTVCNHALSAAYDLVERKLPWWNVLSAPFQYICVLLAINTSESL
ANVAKAKNIFDRIVSNLNTHMAIEAQNTIKLLLQDSIKKKRQELTDLEAADQAGTASEAP
FTAEIDWDVLLDPSHALHLMQQDFSSF
>Kwal_23.6537
MVATGADVPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVD--GPLSFY
-----EKRPSPKQSTSPSTIQKKEVERPSML--------SPCSSERGIFDPSKSRYMSLH
SAVAFPRYLGLELQSVNPPHLHSFAWNCGIRPEENSTSHPDLANIISKDDCNRFTDVYFE
VVHPMFDIIDPSQFRQSLDSYWGGARNVSAFDAVIGGVVALGSFFSRNFGHARELDIVQY
AKDILEDPTFSSQPSIEQISAWVLRSIYLRATARPHVAWLASCMTMHLVEATALHHEVDK
VELATRNDAPLPPRANSVCERARRLFWCAWCINTIISYEYGRSCVTLNKISCKLLKESTK
NYTAEMVELARMIPTTSQCSDPASQVAALIEAIDRVYKAADVHPFLSLTKADLCHSFYRR
LRLLNHVLDRSVVLQIINIGTSALSAAEDLVRKNHTWWNVLSTVFHYFCVLLAIDSPDSL
SNVAAAKSIFDSIVKILDTHIAKEAQATAKLLLRDSMKKKKREIAHLEIADKEGPAPNTN
YSPDIDWDALLDPSNSLNLMHQEYSIL
>Smik_15.561
MASSVPNIPSYKRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDRSSSSSFP
-VQKLDELPHAPESKPFAASNIHGNE-VSSV-------DTQTVTNQSITDPVKSRYTIQH
SAVAFPRCLGLELRSANPPRLHSFAWHCGIRPEENPSSHVLLSELITKEEYYRVSKVYFS
VVHPIFDVVDPKQLAKNVEEYWAGNISNFEYGAVIAGVVALGSFFLGSIGHPREMDVVQY
AKGILDDPTFSRIPTVEHVSAWVLRTIYLRATSRPHVAWLASCVTIHLSEAIGLHQDIDK
GEFSMTSGVTL-RRTAGFNEHTKRLFWCAWSINTILSYDYGRSSVALNRITCKPVEETEG
SYTIHLVALAQTIPQGTVNTD----LTQLLNALTAIHKSPNAHPFLLLTKCDICLSLYRR
LRLLNHVLDKSVVLQIIDIGNAALSAAYALVKLGQSWWNVLSTSFQYVCVLLAIDTPESL
SHVAAAMKTLDNITEVLGTHIALEAQKTAKLLLEDSMKKKRQEIQQLEQATHDRSTFENT
NSLDIDWDALFDPSGTLGFM-------
>Suva_8.436
MASSGSNPQPYKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEED--GPLASS
RMNQVEELPHDTKNRPYVPLDIIGNG-THST-------DSQHVTNGNIIDRTKSRYTIQH
SAVAFPRSLGLELRSTNPPRLHCFAWHCGIRPEEKPSFHVPLSDIVTKEEYYRISKVYFS
VVHPIFDIVDPEQLGKNVEKYWNGDAETSEYGAVIAGVIALGSFFLGSLGHPREMDIIQY
AKGILDDPTFSRIPSVEQISAWVLRTIYLRATARPHVAWLASCLTIHLSEAIGLHHEIDR
EDLALTNNVPL-KRTTEVSEHTRRLFWSAWSINTILSYDYGRSSVTLNRITCKPVKETDG
NYTVNLVSLAQLVPQESVNAN----VTQLLQALAAVHESPDAHPFLSLTKADICLSFYRR
LRLLNHILDKSVVSQIIDIGNTALAAAYALVKIDQAWWNVLSTSFQYVCVLLAIDTPESL
SHVAAAMRTLDNITQVLGTHIAFEAQKTAKLLLEDSVKKKRQEIQQLEQATHQRSAPETT
HLLDIDWDALLDPSDTLSFM-------
>Skud_15.546
MVSSGSNSQPYKRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVD--GSSTSP
---RVDETPYGTDNRPYSLPNILRNE-ARSV-------DAQNVTNQNIIDPIKSRYTIQH
SAVAFPRCLGLELRSTNPPRLHSFAWHCGIRPEENPNSHILLSGLVTKEEYYRISKVYFS
VVHPIFDVVDPEQLAKNVERYWDGDVKMLEYGAVIAGVIALGSFFLGSLGHPREMDVVQY
AKGILDDPTFCRIPTVEQVSAWVLRTIYLRATSRPHVAWLASCITIHLSEAIGLHHEIDR
EDLVMTSNVPL-RRTTEVSEHTRRLFWCAWSINTILSYDYGRSSVTLNRITCKSVKETEG
NHTVHLVALAQLIPQDCVNAN----ATQLLQALAAVHKSPNAHPFLSLTKSDICLSLYRR
LRLLNHILDKSVVLQIIDIGNTALSAAYALVKLDQAWWNVLSTSFQYVCVLLAIDTPESL
SHVAAAMRTLDNITQVLGTHIAYEAQKTAKLLLEDSMKKKRQEIQQLERATHQRSTVETT
HLLDIDWDVLLDPSDTLNFM-------
>YOR380W
MASPGSTALPHKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYIDGR--VPSASP
QVQQVGETSPDTESRPFVLPGIHRNEQPQPI-------NTQNVTSQNIVDPTKSRYTIQH
SAVAFPRCLGLELRSTNPPRLHSFAWHCGIRPEENPNSHVLLSDLVTKEEYYRISKVYFS
VVHPIFDVVNPEQLAKNVEKYWDGDVKTLEYGAVIAGVIALGSFFMGSLGHPREMDIVQY
AKGILDDPTFSRIPTVEQVSAWVLRTIYLRATSRPHVAWLASCVTIHLSEAIGLHHEIDR
EDIAISNNVP-PKRTTVVSEHTRRLFWCAWSINTILSYDYGRSSVTLNRITCKPVKETDG
NFTAHLVALAHLIPQDSVNAN----AAQLLQALAAVHESPNAHPFLSLTKGDICLSLYRR
LRLLNHILDKNVVLQIIDIGNTALSAAYALVKLDQAWWNVLSTSFQYVCVLLAIDTPESL
SHVATAMKTLDNITQILGTRIAFEAQKTAKLLLEDSMKKKRQEIQQLEQATHQRSNLETT
HLLDIDWDALLDPSDTLNFM-------