MUSCLE (3.8) multiple sequence alignment

TBLA0F03050        ------------------------------------------------------------
Ecym_4299          --MFILRENSDGIESQASTISDTQNLRTVDNNNRGLQDTSGLDELETDYTRFKTNEDS--
TPHA0A01760        -------------------------------MTASINGSIDLERFELEYDHGKRGDD---
AGR077C            --------MSRQVHTGRSSSDDTGAPQW---PSRNSVLNDDIEALQAEYDQLKAGEVH--
ZYRO0C01452g       ----MVGSPSGNLSGSGTPPPSQLPPRF--ESEVELSEVSNLDDLEQEYDQYKAAEDRER
KLTH0G13486g       ------------MSNFQSSPGSKRESSFEVSRELSNDAPIDLDDLDAEYGQFKNAEHSDA
Kwal_56.23759      ------------------------------MSNLERQTSLDLDDLDAEYGHFKNTEHSEI
KLLA0F19338g       -----------MTSPQQTSVSGKEFDSLDGESSNQYSVGPDFDQLEQEYDDLKTSEIIAP
SAKL0H16830g       ------MSDYHTHNRGSSKDLEHNSSDF---------AEPNLDDLEAEYDNYKNAEQNPR
TPHA0J00800        ----------MPTDKKNDTTVDNRDLDNIELSSYSNSNTVDLEALEEEYDQYKKEEEIEY
CAGL0L12342g       --------------------------------------MEELDNLELEYNQFKNNERPSN
TDEL0F03980        ----------MGTREAESVPAD---------------SAFKLDDLEAEYDLYKANEQLED
KNAG0G02070        ---MTERRHSFRQEDSDNSFPNEYGAEY--NNANEVSSTPDLDNLELEYDQYKADELHPQ
Kpol_543.43        -------------------------MSF---------DLDDLEDLELEYNQYKTVEEQGN
NDAI0B02020        --MNQTIPFQKNENNTNDIENQYELPSF----PNSDTSSQNLADLELEYDQYKASETNNK
NCAS0B05050        MSGTNGNPFNTRESENDLSNDQYEIPNYTSNIPSSGNSTQNLDDLELEYDQYKVSETNNN
KAFR0B02750        ----------------MSNQHDTELTDF-----------SNLDDLEQEFNQYKKIELT--
Suva_10.176        ----------MSRETHSNIEEVVEIPDF-----QDSTTVPDLDDLELEYDQYKNNENNGA
Skud_12.160        -----------MSKETQPNLEEVEIPDF----QDNTDSVPNLDDLELEYDQYKNNENNGV
Smik_12.151        -----------MSRETYPNLEEVEIPDF----QDTSNTVPDLDDLELEYDQYKNNENNDA
YLR092W            -----------MSREGYPNFEEVEIPDF----QETNNTVPDLDDLELEYDQYKNNENNDT
                                                                               

TBLA0F03050        ------------------------------------------------------------
Ecym_4299          ----------AGYSGAENERSRIDKFD-SVGSSLQFAK--YDGNALPD------------
TPHA0A01760        ----------THDRVEARDLYSKVDIEEVTFQCDNYSG--RLDVNSSL------------
AGR077C            ----------SAQGATHGDIGSRQYSG-SGKPAAQYLG--LNVNSREA------------
ZYRO0C01452g       V---------VGRGDDEYDDDLRKGKVDYKETELEYWN--STNGTTNL--------LAPK
KLTH0G13486g       TAGR------DLTSEYGAQFAAEFGGE-PGSGSGSGSG--FPEAKPVA----PAAPGNVP
Kwal_56.23759      GGGPSSNPGAAVGVGASTKLGQDQNGD-KSGATGGGNG--ANEPLALY------------
KLLA0F19338g       HISNGHS---ISSSPRHHHLYEDRHLDSIIDTNTHGFKKHDNGNGKFADVNIEQIYNYDS
SAKL0H16830g       EKSD------VVETLPPTTHQNDAKGL-KNDGQTTVEL--YGTTSSGG------------
TPHA0J00800        ISGNYLNSSPTQNINVTSNPKYEEYKKLKHLDQSYNYV--STEYLDTD------------
CAGL0L12342g       T---------NAGADIEKGLDTKKYFE-RSITDNSTYG--KKSY----------------
TDEL0F03980        NE--------VTVNGSEDDYGNKKGIDLVKETEVRYYG--SPGPEAIG------------
KNAG0G02070        RT--------ILSNQADTDREKIANVF-VEEQSVRDSN--IPSASIEELQYFAHE-SDGA
Kpol_543.43        SD--------VGDSSGNDDLGNAGDGL-TKDSKFVFEK--DLGYTDDSNELTRESFLNSS
NDAI0B02020        SNHGP-----DLETNNLDVQFSNTYNTGDKKNSIKNHQIQINTFNADS------------
NCAS0B05050        DDVINNNNNNNNNNNNIPELETQQNLD-VQFSNTTNNK--ENQYRIVS--------TVNP
KAFR0B02750        ----------ISSTRQNEEVDSKRQGKSDKNVKSSSFD--SIFSLTQQ------------
Suva_10.176        FNDN------DLESNSLTNHNTASEAKGVKGSKVEYFN--TSDISLYD------------
Skud_12.160        FSDN------DLESNSVANRNAVNDAKGVKGSKIEYFD--PSDVSLYD------------
Smik_12.151        FKDN------DLESNSVAKPNAVGNGKGAKGSKIEYFN--PSDVSLYD------------
YLR092W            FNDK------DLESNSVAKHNAVNSSKGVKGSKIDYFN--PSDVSLYD------------
                                                                               

TBLA0F03050        ---MVYREKQVTLIETFNHRVPRAFTWQSIKTYLLSLLPITKWIAHYNLQWFISDVIAGI
Ecym_4299          FKAPPYYETTVTFMEYYDRTIRSRVGRSFFRSYFLSLFPIIKWIHHYNFAWMYSDFIAGI
TPHA0A01760        -SIPMYNEKPVTIKDFYYEKINDYFSIGEIVQYLTSLFPLLKWLPHYNLDWLIQDLIAGI
AGR077C            --VPEYEETVVSVKDYYNYKLRGFISLNTARDYALSVFPLHRWIHHYNVAWMYADMVAGI
ZYRO0C01452g       ATVPSYEEGQVGPFDIFYHDLKDRMTLGAVKHYFESAFPIIKWLPFYNWKWGYADLVAGI
KLTH0G13486g       SALYEFHERPVTVGEFYSQNLRSTFTLATFTNYLRSLLPIMRWLPHYNARWLYQDLVAGI
Kwal_56.23759      DSPEAYYEDKVTFREYYDTTIRPSLTASNVRQYLRDLLPVINWLPHYNGRWFYQDMVAGI
KLLA0F19338g       LRVPNYEETVVDAKQLYDEKLRPYLTFSAIVEYLTSLFPLLKWVHHYNFNWLYNDLVAGI
SAKL0H16830g       -VIPGYHEDTVNFKDYYDQSLSSNISFSSFREYLISLFPVIRWIPHYNFAWMYGDVVAGV
TPHA0J00800        YLIPAHNENIITFKEYYNHSLKEYFTFNAAKNYALSIFPIIHWLPFYNFNWFISDLIAGI
CAGL0L12342g       -SIPSYEEDTITLKDYYDTNLRDYFTWASVVDYIRSLFPVVNWLPFYNPKWFLSDLIAGI
TDEL0F03980        GNIPGFEESTVSVKDYYNQFIREKLTLNSAGSYVYSLFPIVKWFPHYNLTWGYADLVAGI
KNAG0G02070        KVIPSYVEGNVTELEFFNHSLRSKFTLNAAKNYILSIFPIIHWLPHYNVYWFIQDLIAGI
Kpol_543.43        ENVPRYIEETVTLKEYYNHSIRHYLTFKSFGNYLISIFPIIKWLPFYNYKWLISDLIAGI
NDAI0B02020        VIIPSFEEHAISFKDYYRHSLKENFSLKSVKEYALSIFPIIRWLPHYNLAWFSSDLIAGI
NCAS0B05050        VIIPNYDEKTVSIKDYYDHSIRENVTLVGVRDYFLSIFPITRWLPHYNLTWFTSDLIAGI
KAFR0B02750        QQVPTYEENSITIADYYTYSLRPYFTFKTITDYIKSLFPIFHWLPHYNLTWFISDLIAGI
Suva_10.176        NSVSQFDEPTVSFKEYYDHSIRSHLTLKAAGNYLKSVFPIIYWLPHYNVNWFIADLIAGI
Skud_12.160        NSVSQFEESAVSLKEYYNHSIRSHLTLKGAGDYLKSVFPIINWLPHYNFNWFIADLIAGI
Smik_12.151        NSVSQFEESTVSLKEYYDHSIRSHLTLKGARDYLKSVFPIINWLPHYNFNWFTADLIAGI
YLR092W            NSVSQFEETTVSLKEYYDHSIRSHLTVKGACSYLKSVFPIINWLPHYNFSWFTADLIAGI
                        . *  :   : :   :   .       *  . :*:  *. .**  *   *.:**:

TBLA0F03050        TVGCVLVPQSMSYAQIATLDPQYGLYSSIMGCFIYTVFATSKDICIGPVAIMSLQTAKAI
Ecym_4299          TVGCVLVPQSMSYAQLAGLKPEYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSVQVSKVI
TPHA0A01760        TVGCVLVPQSMSYAQIATLAPQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLQTAKVI
AGR077C            TVGCVLVPQSMSYAQLASLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLETAKVI
ZYRO0C01452g       TVGCVLVPQSMSYAQIATLPPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLETAKVI
KLTH0G13486g       TVGCVLVPQSMSYAQIATLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLQTAKAI
Kwal_56.23759      TVGCVLVPQSMSYAVIATLPPQFGLYSSFVGAMIYSFFATSKDVCIGPVAVMSLQTAKAV
KLLA0F19338g       TVGCVLVPQSMSYAQIATLPAQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLETAKVI
SAKL0H16830g       TVGCVLVPQSMSYAQIASLPAQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLETAKVI
TPHA0J00800        TIGCVLVPQSMSYAQIATLDPQYGLYSSFIGAFVYALFATSKDVCIGPVAVMSLETAKVI
CAGL0L12342g       TVGTVLVPQSMSYAQIATLPPEYGLYSSFIGALVYSFFATSKDVCIGPVAVMSLQTAKVI
TDEL0F03980        TVGCVLVPQSMSYAQIASLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAKVI
KNAG0G02070        TVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLETAKII
Kpol_543.43        TIGCVLVPQSMSYAQIATLPPQYGLYSSFVGAYTYSLFATSKDVCIGPVAVMSLQTAKVI
NDAI0B02020        TVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFTYSLFATSKDVCIGPVAVMSLETGKVI
NCAS0B05050        TVGCVLVPQSMSYAQIATLPAQYGLYSSFIGAFCYSLFATSKDVCIGPVAVMSLETAKVV
KAFR0B02750        TVGCVLVPQSMSYAQIATLSPQFGLYSSFIGAFSYSLFATSKDVCIGPVAVMSLQTAKVI
Suva_10.176        TIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYAYSFFATSKDVCIGPVAVMSLQTAKVI
Skud_12.160        TIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYAYSFFATSKDVCIGPVAVMSLQTAKVI
Smik_12.151        TIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMSLQTAKVI
YLR092W            TIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMSLQTAKVI
                   *:* ********** :* * .::*****::*.  *:.******:******:**::..* :

TBLA0F03050        AHVHQKHPD-----IPAHIIASTIAVICGAITMGIGVLRLGFFIDLIPVTAVFGFTSGSA
Ecym_4299          SHVIDQLPEGTP--ITAPMVASALALFSSILVIPIGLLRLGFILELISVTAVAGFMTGSA
TPHA0A01760        ERVTSGLTADEQTIYTAPIIATALALLCGIISTGIGFLRLGFLIEFISLNAVAGFMTGSA
AGR077C            ARVTENLPEDTN--ITGPIIATALTLLCGAIAMVIGILRLGFLVEFISITAVTGFMTGSA
ZYRO0C01452g       QETLEKFPKEDHE-VTGPLIATALALLCGIVAMGAGVLRLGFLVELISLNAVAGFMTGSS
KLTH0G13486g       SHVVSSLPEDTE--ITSPMIATALALLCGIISLGLGVLRLGFLVELISSTAVAGFMTGSA
Kwal_56.23759      SKVMAELPADTD--ITAPVVATALAFLCGLISLGLGVLRLGFLVELISSTAVAGFMTGSA
KLLA0F19338g       ARVLEKVGEDNPE-ITAPIIATTLSLICGGVALGVGLLRLGFLVEFISLNAVAGFMTGSA
SAKL0H16830g       ARVTEHLPDDTE--ITGPIIATALSLLCGAITLGIGVLRLGFLVELISLNAVAGFMTGSA
TPHA0J00800        ADVSSHFQ-NDPD-VTGPIIATTLALLCGGIAAAVGFLRLGFLVELISLNAVTGFMTGSA
CAGL0L12342g       ARVKEKHPDLDPS-ITGPIIATVLAFICGIIATGVGLLRLGFLVELISLNAVAGFMTGSA
TDEL0F03980        AQVSAKYPENDPI-VTAPVIATALSLLCGIVAIGVGLLRLGFLVELISLNAVAGFMTGSA
KNAG0G02070        ARVMKRFP-NDPD-VQGPIIATTTALLCGGIAAGVGFLRLGFLVELISLNAVAGFMTGSA
Kpol_543.43        QHVNSSLTEEQKTYITAPLIATTLALLCGIISAGVGLLRLGFLVELISLNAVTGFMTGSA
NDAI0B02020        TKVLAKYPEADPN-ITAPVIATVLAFLCGVITAGIGFLRLGFLVELISLNAVTGFMTGSA
NCAS0B05050        TKVLAKYPDNDPT-ITAPIVATALSLLCGIVTAGVGVLRLGFLVELISLNAVTGFMTGSA
KAFR0B02750        ARVQDKLPSDTD--ITASEIATTLALLCGIIATGVGLLRLGFLVELISLNAVAGFMTGSA
Suva_10.176        ADVTARYPDGDTT-ITGPIIATTLALLCGIISAAVGFLRLGFLVELISLNAVAGFMTGSA
Skud_12.160        AEVQAKYPDGDTT-ITGPVIATTLALLCGIISAAVGFLRLGFLVELISLNAVAGFMTGSA
Smik_12.151        ADVTAKYPDGDPA-ITGPVIATTLALLCGIISAAIGFLRLGFLVELISLNAVAGFMTGSA
YLR092W            ADVTAKYPDGDSA-ITGPVIATTLALLCGIISAAVGFLRLGFLVELISLNAVAGFMTGSA
                     .             .  :*:. :.:.. :    *.*****::::*. .** ** :**:

TBLA0F03050        FNILWGQIPGLMGYSKDVNTRQDTYKVVVDTLKKLPKTNINAVMGLIPLFCLFVWKYGCD
Ecym_4299          LSILASQLPSLLGIQK-INTRVETYRVLISTLKHLNGSDINAAFGLICLALLFFWKWTCG
TPHA0A01760        FNIICGQVPALMGYNKKVNTRASTYEVVINTLKHLPDTKLDAVFGLIPLSILYLCKWFFS
AGR077C            LSIISGQVPSLMGYSKKVNTRATTYKVIIESLKHLKDTNMNAAFGLVPLVLLFLWKWICG
ZYRO0C01452g       LNIISGQVPALMGFKKYVHTRDSTYKIIINSLKNLKHTQLDAVFGLIPLVLLYTWKWWCS
KLTH0G13486g       LNIIAGQVPALMGYNKLVNTRTSTYKVIINSLRHLPDTKLDAVFGLVPLVILYVWKWGCS
Kwal_56.23759      LNIISGQLPALMGYNKLVNTRTSTYKVIIETLKHLPDTKLDAVFGLIPLVMLYTWKWLCN
KLLA0F19338g       INIMSGQVPGLMGYSKNVNTRDSTYKVIINTLKHLPDTKLDAVFGLIPLFILYSWKYFCG
SAKL0H16830g       FSIITGQLPALMGYNEKVNTRDTTYKVVINTLKHLPDTKLDAVFGLIPLLILYLWKYGCN
TPHA0J00800        FNILWGQVPGLMGYSKLVNTRQATYKVVIDTLKHLPDTKLDAVFGLIPLFILYVVKWWCT
CAGL0L12342g       FNIIWGQIPGLMGYSKKVNTRRSTYHVVIDSLKHLPDTKLDAAFGLIPLFTLFFWKWWCN
TDEL0F03980        FNILWGQVPALMGYSSKVNTRASTYKVVIDSLKHLPDTKLDAVFGLVPLCLLYLWKWWCG
KNAG0G02070        LNIISGQVPALMGYGKLVNTRTATYKVIVNTLKHLPDTKLDAVFGLIPLFILYFWRWWCN
Kpol_543.43        LNIISGQVPALMGYASEVNTREATYKVIINTLKHLPDTKIDAIFGLIPLVILYFWKWWFS
NDAI0B02020        LNIMWGQIPALMGYGSKVNTRTSTYKVIIESLKHLPDTKLDAVFGLIPLFILYLWKWWCG
NCAS0B05050        LNILWGQVPGLMGYNSKVNTRTANYKVIIETLKHLPDTKLDAVFGLIPLFLLYLWKWWCD
KAFR0B02750        LNIISGQVPGLMGYNSEVNTRTSTYKVIIDTLKHLPDTKLDAVFGLIPLFLLFAWKWVCD
Suva_10.176        FNILWGQVPALMGYNKLVNTRVATYKIVIDSLKHLPDTTLDAAFGLIPLFILYTWKWWCG
Skud_12.160        FNILWGQVPALMGYNKLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWWCG
Smik_12.151        FNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWWCG
YLR092W            FNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWWCG
                   :.*: .*:*.*:*  . ::**  .* :::.:*.:*  : ::* :**: *  *:  .:   

TBLA0F03050        -YAL--------------RRGNLKPWPKRIVFYLLSLRVTIVIIICSAAAY-GAKN----
Ecym_4299          YLGP----KLISKYLR--PNSKKARIWQSFFFYAQALRNAFVLFLATFVSWLVIGRHKKK
TPHA0A01760        SLGPQYLNKLSNRRNLTERQRKIIKYLGNYFFYSNAMRNGVVIIVFTAISW-AITRGKSS
AGR077C            SLGP----RLVDRYLQ--FKPSRASRWNAAFFYLQALRNAVIIVVFTAISW-GISRHKLE
ZYRO0C01452g       SYGP----KLADRHFK--NNPKKRDILKTFYFYAQAMRSAVIIIVFTAISY-GITKGRKT
KLTH0G13486g       TGGP----RLVQRY-----GSRRSRMWDNVFLYTQALRNAVVIVVFTAIAW-GMSHRALK
Kwal_56.23759      SGGP----RLVERYTV--RGSRKQRIWSATLFYTQALRNAVIIIVFTAIAW-SISHHKKK
KLLA0F19338g       TLGP----KLVDRYVAR-SDVKRAAAYKYILFYLQALRNAFVIIIFTLISW-GITRHKAK
SAKL0H16830g       TIGP----NWVDRRMN--PHSPRAKFWKSFFFYAQALRNAFVIVLFTLIAW-GITRHKKK
TPHA0J00800        NYGL----QLAEKQFS--SNERYRFYLKKFYFYTNAMRNAVVIIIFTAISW-SITRNKSS
CAGL0L12342g       SMGP----KLTDRYFPANSRPRANKYWKAFYFYLQASRNGIIIILFTAVSY-GITKGVAK
TDEL0F03980        TYGP----KLADRQLA--HSPKKQRILKRFYFYSNAMRNAVIIIVFTAISW-RITKNKDK
KNAG0G02070        GYGP----KLTDRYYP--KGSRGNFLWKKFYFYAQASRSGIIIIVFTAISW-SITRHVPS
Kpol_543.43        SMGP----KLVDRYY---PNSKYKKYIKAFYFYGNAMRSGIIIIVMTSISW-SVTRGKSK
NDAI0B02020        NMGP----RMADKWFA--NNEKGNFYLKKFYFYAQAAKNAVIIIVFTAIAW-SITKGKTK
NCAS0B05050        NMGP----KLVDKWFPKNKNERANFYFKKFYFYAQAAKNAIIIIVFTAISW-SITRGKAK
KAFR0B02750        VLGP----RLNERHFGNGKNPRAHRIMKNFYFYAQTTKNAIIIIVFTCISW-AITRGKTS
Suva_10.176        TYGP----RLNDRFNS--KKPRLHKIVKWTCFYAQASRNGIIIIVFTCIAW-AITRGKSS
Skud_12.160        TYGP----RLNDRYNS--KNARLHKIVKWTYFYAQASRNGIIIIVFTCIGW-AITRGKSS
Smik_12.151        TYGP----ILNDRYNS--KNPRLHKILKWTYFYAQASRNGVIIVVFTCIGW-AITRGKSK
YLR092W            TYGP----RLNDRYNS--KNPRLHKIIKWTYFYAQASRNGIIIIVFTCIGW-AITRGKSK
                     .                            :*  : .  .::.: :  .:    .    

TBLA0F03050        ----PSLKVLGKIPKGFAAASDNRLKSIPSDLVSDIWSEIPASVIVLVLEHVSIAKSFAR
Ecym_4299          ----TSISVLGTVPSGL---KHVGVPTIPSGLVHKLMPQLPPAVIILLLEHITIAKSFGR
TPHA0A01760        TS--VPISILGTVPKGL---KEVAVFKVPGGLFEKLAPDLPSSIIILLLEHIAISKSFGR
AGR077C            K---PPISLLGKVPSGL---KNVGPLELPEGLVEKLLPELPAATIILLLEHIAIAKSFGR
ZYRO0C01452g       ----PRISVLGKVPKGL---KDVHVMRIPEGLLSKMGSSIPSAIIILLLEHISIAKSFGR
KLTH0G13486g       EGGSARISLLGTVPSGL---KDVGVMKVPSGLLSKIAPELPASVIVLVLEHIAISKAFGR
Kwal_56.23759      ----APISLLGPVPSGL---KDVGVMKLPDGLAAKIAPELPASVIVLLLEHIAIAKAFGR
KLLA0F19338g       ED--LPISLLGTVPSGL---KNVGVMKLPDGLVSNLASELPSAIIILVLEHIAISKAFGR
SAKL0H16830g       ----HPISLLNTVPSGL---KNVGVMKFPDHLATNLAPELPAAAIILLLEHIAIAKAFGR
TPHA0J00800        SE--RPITVLGTVPSGL---KDIGVFKPQTKIVQKIGPQLPASIIVLLLEHIAIAKSFGR
CAGL0L12342g       DK--RRISVLGTVPKGL---RHTGVMKLPHGILNNIAAEIPSSIIVLLLEHIAISKSFGR
TDEL0F03980        EH--RPIKVLGTVPSGL---EDVGVAKIPEGLLAKMAPDIPASIIVLLLEHIAISKSFGR
KNAG0G02070        KE--RRISILGTVPKGL---KDVGAIKVPPELPAKIAPELPAAVIVLLLEHIAISKSFGR
Kpol_543.43        SE--RPISILGTVPSGL---QEVGVFTPPNGLLAKVAPELPSSIIVLLLEHIAIAKSFGR
NDAI0B02020        DE--RPISILGSVPKGL---KEVGVMKLPDGLASKIAPELPASVIVLLLEHIAIAKSFGR
NCAS0B05050        AD--RPISILGTVPKGL---KEVGVMKLPDGLLSKLAPELPASVIVLLLEHIAIAKSFGR
KAFR0B02750        ET--RPISVLGSVPKGL---KDVETFTVPSGLMAKLAPELPASIIVLLLEHIAIAKSFGR
Suva_10.176        AD--RPISILGSVPSGL---KEVGVFHVPPGLMSKLGPNLPASIIVLLLEHIAISKSFGR
Skud_12.160        SE--RPISILGSVPSGL---KEVGVFHVPSGLMSKLGPSLPSSIIVLLLEHIAISKSFGR
Smik_12.151        SE--RPISILGSVPSGL---KEVGVFHVPSGLMSKLGPNLPASIIVLLLEHIAISKSFGR
YLR092W            SE--RPISILGSVPSGL---KEVGVFHVPPGLMSKLGPNLPASIIVLLLEHIAISKSFGR
                         :.:*. :*.*:              :  .: ..:*.: *:*:***::*:*:*.*

TBLA0F03050        VNNYRVSADQELTAIGVSNVMGACCLGAYPVTGSFSRTALKARCEVRTPLGSIFSGLCVV
Ecym_4299          INNYKIVPDQELIAIGVTNLIGSF-FNAYPATGSFSRSALKAKCNVKTPLSGLFSGACVL
TPHA0A01760        VNDYKIVPDQELIAIGVTNLIGTF-FMAYPATGSFSRSALKAKCDVKTPLSGLFSGACVL
AGR077C            INNYKVVPDQELIAIGVTNLFATF-FNAYPATGSFSRSALKAKCNVKTPLSGLFTGACVL
ZYRO0C01452g       VNNYKVVPDQELIAIGATNLIGTF-FNAYPATGSFSRSALKAKCNVRTPLSGVFSGACVL
KLTH0G13486g       VNDYRVVPDQELIAIGATNLIGTF-FNAYPATGSFSRSALKAKCNVSTPLSGLFSGACVL
Kwal_56.23759      VNDYRVVPDQELIAIGATNLLGTF-FNAYPATGSFSRSALKAKCNVSTPLSGVFSGACVL
KLLA0F19338g       VNGYKVVPDQELIAIGVTNLISTF-FNAYPATGSFSRSALKAKCNVKTPLSGIFTGACVL
SAKL0H16830g       INDYKVVPDQELIAIGVTNLVGTF-FNAYPATGSFSRSALKAKCNVRTPLSGVFTGACVL
TPHA0J00800        INDYKIVPDQELIAIGISNLVGTF-FSAYPATGSFSRSALNAKCNVKTPLSGIFTGGCVL
CAGL0L12342g       VNDYKINPNQEIIAIGVSNLLGTF-FNAYPATGSFSRSALKAKCNVMTPLSGIFSAACVL
TDEL0F03980        INDYKVVPDQELIAIGATNLIGTF-FNAYPATGSFSRSALKAKCEVRTPFSGVFTGCCVL
KNAG0G02070        INDYKVVPDQELIAIGVTNLIGTF-FHAYPTTGSFSRSALKAKCNVKTPLSGLFTGSCVL
Kpol_543.43        VNDYKVVPDQELIAIGISNLIGTF-FNSYPVTGSFSRSALKAKCNVKTPLSGIFTGSCVL
NDAI0B02020        INDYKVVPDQELIAIGVTNLIGTF-FNAYPATGSFSRSALKAKCEVRTPLSGLFTGSCVL
NCAS0B05050        INDYKVVPDQELIAIGVTNLIGTF-FNAYPATGSFSRSALKAKCKVRTPLSGIFTGACVL
KAFR0B02750        INDYKIVPDQEIVAIGITNLLGTF-FHAYPATGSFSRSALKAKCNVRTPLSGLFSGACVL
Suva_10.176        VNDYKVVPDQELIAIGVSNLLGTF-FNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVL
Skud_12.160        INDYKVVPDQELIAIGVSNLLGTF-FNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVL
Smik_12.151        INDYKVVPDQELIAIGVSNLLGTF-FNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVL
YLR092W            INDYKVVPDQELIAIGVSNLLGTF-FNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVL
                   :*.*.: .:**: *** :*:..:  : :**.******:**:*.*.* **:..:*:. **:

TBLA0F03050        VAITSLTSALAWIPKATLSAVIIHAVSGLISSYKVTIRLYKMGPLDCLGFLVTIFITVFS
Ecym_4299          LALYYLTSAFYYIPKAALSAVIIHAVVDLIASYKLSFYLWNTNPFDLISFLATILLTIFS
TPHA0A01760        LALYCLTGAFYYIPKATLSAVIIHAVSDLLASYKTTLNFYKMNPLDFVCFITTVFITVFS
AGR077C            LALYCLTEAFYFIPKATLSAVIIHAVADLIASYKVTWMFWRTNPLDFFAFIVTVIITVFS
ZYRO0C01452g       LALYCLTQTFYYIPSATLSAVIIHAVSDLCASYKTSWNFYKMNPGDFIAFIVTVFITVFS
KLTH0G13486g       LAIYCLTSAFKFIPKATLSAVIIHAVSDLIASYKTTWSFWRLSPPDLVCFLVTVVITVFS
Kwal_56.23759      LAIYCLTSAFQYIPKATLSAVIIHAVSDLIASYKTTWSIWRLNPLDLVCFLATVFIAVFS
KLLA0F19338g       LSLYCLTDAFYFIPKAALSAIIIHAVSDLVASYKTTWNFWLMNPLDFVCFIVTVIITIFS
SAKL0H16830g       LALYCLTEAFYYIPKATLSAVIIHAVSDLIASYETTWNFWKMNPLDCLCFLVTVFITIFS
TPHA0J00800        LALYCLTGAFFYIPKATLSAVIIHAVSDLIASYQTTLSFWNMNPLDTLCFLVTVLITVFS
CAGL0L12342g       LAIYCLTGAFFYIPKATLSAVIIHAVFDLIASYHTTWSLWKMNVFDFIGFITTVFITVFS
TDEL0F03980        VAIYCLTDAFFFIPSATLSAVIIHAVSDLLASYKTTWNFWKMNPLDCCAFIVTVLITVFS
KNAG0G02070        LALYCLTGAFFYIPKATLSAVIIHSVSDLVASYHTTWNFYKMNPLDFVCFLTTIIITVFS
Kpol_543.43        LALYCLTGAFFYIPKATLSAVIIHAVSDLVASYKTTWSFWKMNPLDFICFITTVFITVFA
NDAI0B02020        LALYCLTGVFLYIPKATLSAVIIHAVSDLIASYHTTWNFWKMNPLDCFSFIVTVFITVFS
NCAS0B05050        LALYCLTGAFFYIPKATLSAVIIQAVSDLIASYKITWNFWKMNPLDCLCFLVTVFITVFS
KAFR0B02750        LALYCLTGAFFYIPKATLCAVIIHAVSNLIASYKATMNFWKMNPLDCFCFLVTVIITVFA
Suva_10.176        LALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFS
Skud_12.160        LALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFA
Smik_12.151        LALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFA
YLR092W            LALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFA
                   :::  ** .: :**.*:*.*:**::* .* :**  :  ::  .  *   *:.*:.:::*:

TBLA0F03050        EIEIGVYFAVCWACFLLMIRIAFPYGAFLGYVRVREISRSSITMIEPMDYE---SGNDKE
Ecym_4299          SIENGIYFAVAFSMATLLMKNAFPSGKFLGYVKITEV--SNLNVFEDLDSI--GNNDPEL
TPHA0A01760        SIEYGIYFAICFSCAQLIFKNMFPVGSFLGYIKIAEV--LNPTLSTNDYTILLDDSSSVL
AGR077C            SIEHGIYFSISWSCAVLLCKVAFPDGKFLGYIDVAEV--IEPAGPPSINSE---ADLASI
ZYRO0C01452g       SIDYGIYFAMCWSAAMFLLKNMFAPGRFLGRVEVAEV--VNAQVDPNVESVSESAGSHLD
KLTH0G13486g       SIENGIYFAMCWSVAVLLFRTAFPAGKFLGRVQIAEARVTNSGAGAGVGMSSGNSAGTAV
Kwal_56.23759      SIENGIYFAMCWSVAVLLFKVAFPRAQFLGRVEIAELA-TNEGVSAGSEFAPLSKDFEKG
KLLA0F19338g       SIENGIYFAVCWSCALLLLKVVFPTGQFLGYVEICQV--SNAEVDENIDRI----VLSED
SAKL0H16830g       SIENGIYFAICWSCAILLFKIAFPSGKFLGRVEVSEV--INPTVREDLGVV---EDFDSE
TPHA0J00800        SIENGIYFAMCYSCALFIFRSAFPAGKFLGRIEIAEV--INATPKDDFQMDNFNGFETSE
CAGL0L12342g       SIENGIYFAVCWSCAILLYNNAFPAGKFLGRIEIAEV--VNPKIVDDDDFSFENSNESFD
TDEL0F03980        SIENGIYFAMCWSCAMLLLKHAFPAGQFLGRVEVAEV--INPTVVEDVEAI---SINDQI
KNAG0G02070        SIENGIYFAICWSCALLLFKVAFPAGKFLGRVEIAEV--VDGEIINDNSVV---MTTDDC
Kpol_543.43        SIEDGIYFTMCWSAAILLFKVAFPAGKFLGYVKIAEI--VNPEIVDSDYLV------EKA
NDAI0B02020        SIENGIYFAMCWSCAILVLKVAFPAGKFLGRVEIAEV--VNGCVDDSFEVT---DYSSNS
NCAS0B05050        SIENGIYFAVCWSCAILLLKVCFPAGKFLGRIEVAEV--IDGYVDNSIESATTAEYSSAS
KAFR0B02750        SIEDGIYFAMCWSVAVLLFKVAFPPGKFLGQIEITEV--LDGKLVGDSSVL---TSSDEN
Suva_10.176        SIENGIYFAMCWSCAIFILKVAFPAGKFLGRVEIAEV--TDAYVRADSDSV---SFTSEN
Skud_12.160        SIEDGIYFAMCWSCAMLLLKVAFPAGKFLGRVEIAEV--TDAYVKADSDAV---SYVSEN
Smik_12.151        SIEDGIYFAMCWSCAMLLLKMAFPAGKFLGRVEIAEV--TDAYIKANSDAV---SYTSEN
YLR092W            SIEDGIYFAMCWSCAMLILKVAFPAGKFLGRVEVAEV--TDAYVRPDSDVV---SYVSEN
                   .*: *:**::.::   :: .  *. . *** : : :    .                   

TBLA0F03050        NIKLNKKQLTKKYYNKFINSLHYNAPYDDDG-TSEYKNQNNKSTSISTSSSNEPEPKSST
Ecym_4299          PQEISKDS------KLAKDPDVHASANLMAS---------------------KLDVR---
TPHA0A01760        GEENTKDDSVKNRLDQNENPKSSEKEYSEFK------------SYEMSSNSKTTNLS---
AGR077C            DNSATFQQ---------IDKDGGKLNTVESV-------------------LPDPHTR---
ZYRO0C01452g       GFQAQSSIESSSKKLDPLDKSAVHSNYLNGG---------DDGSDNNINNQIGQKLV---
KLTH0G13486g       NREKERET-TFTAVSVSSESLSHTAPGKAKAANSAGTDKLGKVEGHVTDGGSPRAPR---
Kwal_56.23759      KGVSYASG------SVSSESFNAKKQGIEGG------------SQFVGGASNAAGAG---
KLLA0F19338g       SQPKTIED------NVTKNNTAVKVGVVANE------------------SFGHSQLQ---
SAKL0H16830g       NINVASST---------KPKLGLSADNSSIS-------------------TGPSRVR---
TPHA0J00800        YNNFPADQ------SYGKFDIANKNTHKYNS--------------------PHCSKN---
CAGL0L12342g       DEGIYFDN------SVAEDKLGTSSNDLKKF---NAGVKTRSINGELVNGQTSSDIR---
TDEL0F03980        EGSVGKSK------SLKADKGAISASSGSNY-------------------------K---
KNAG0G02070        VSEFGGNK------EFSKDKLNGKSDFIVKD---------KLDSTASSSSIAENKLK---
Kpol_543.43        ETSVQYST-------VLMNPEKGELSYLSSK-------------------SSESQLK---
NDAI0B02020        NLSLSADT-----INHNKKLKILHIPLLKTL--------KDQLFSDISSIQGKSKIR---
NCAS0B05050        SPSSDNET------DTKKIQKTSSISFGKDA---------KAVAVSTSPVDCNPKVR---
KAFR0B02750        SEILPTTK------------AGYSVEVVSNH---------------------NENTN---
Suva_10.176        NNRISTLE------EDGVGEKEGPTNYIINSFKKLETKVQTKGFESPSASIGQPRIK---
Skud_12.160        NNRISTLE------ENGEDEKEISAKYITNSSKKIETNVQTKGFASPSSSIGQPRIK---
Smik_12.151        NNGIRTSE------EGDEYEKDSSTKYITNSSKKIETNVQTKSFDSPSSLITQPRMK---
YLR092W            NNGISTLE------DGGEDDKESSTKYVTNSSKKIETNVQTKGFDSPSSSISQPRIK---
                                                                               

TBLA0F03050        CSTNEPEPESSTYSTNEVISIQPSTKKDDQNKTQIYNVDEETSQHYVIKGEDPTKNNEYI
Ecym_4299          ------------FHTK--------------------------------------------
TPHA0A01760        ------------YYVR--------------------------------------------
AGR077C            ------------FHRR--------------------------------------------
ZYRO0C01452g       ------------YHTK--------------------------------------------
KLTH0G13486g       ------------FHTK--------------------------------------------
Kwal_56.23759      ------------FHTK--------------------------------------------
KLLA0F19338g       ------------YHTK--------------------------------------------
SAKL0H16830g       ------------FHTK--------------------------------------------
TPHA0J00800        ------------FYTK--------------------------------------------
CAGL0L12342g       ------------YYTK--------------------------------------------
TDEL0F03980        ------------FHSK--------------------------------------------
KNAG0G02070        ------------YYTK--------------------------------------------
Kpol_543.43        ------------YHIK--------------------------------------------
NDAI0B02020        ------------YYTK--------------------------------------------
NCAS0B05050        ------------YYTK--------------------------------------------
KAFR0B02750        ------------YYTK--------------------------------------------
Suva_10.176        ------------YHTK--------------------------------------------
Skud_12.160        ------------YHTK--------------------------------------------
Smik_12.151        ------------YHTK--------------------------------------------
YLR092W            ------------YHTK--------------------------------------------
                               :  .                                            

TBLA0F03050        FRQETSENSTIVEGTGNLDNSQDLEQLDQSSVDENQDNIINKRLTRQLVYDHELEHDTPT
Ecym_4299          ------------------------------------------------------------
TPHA0A01760        ------------------------------------------------------------
AGR077C            ------------------------------------------------------------
ZYRO0C01452g       ------------------------------------------------------------
KLTH0G13486g       ------------------------------------------------------------
Kwal_56.23759      ------------------------------------------------------------
KLLA0F19338g       ------------------------------------------------------------
SAKL0H16830g       ------------------------------------------------------------
TPHA0J00800        ------------------------------------------------------------
CAGL0L12342g       ------------------------------------------------------------
TDEL0F03980        ------------------------------------------------------------
KNAG0G02070        ------------------------------------------------------------
Kpol_543.43        ------------------------------------------------------------
NDAI0B02020        ------------------------------------------------------------
NCAS0B05050        ------------------------------------------------------------
KAFR0B02750        ------------------------------------------------------------
Suva_10.176        ------------------------------------------------------------
Skud_12.160        ------------------------------------------------------------
Smik_12.151        ------------------------------------------------------------
YLR092W            ------------------------------------------------------------
                                                                               

TBLA0F03050        EIIWIPYSHRFTRELNPHVKIHPPPPGVVVYRFSDSLTYINCSRNYDNIIDYIKDNTKPG
Ecym_4299          ---WVPLDNGYSRELNPEIAVHMPPPGVIVYRPTESWHYLNCSRQFDIIVDRVKTLTRPG
TPHA0A01760        ---WVPMKNDYHREVNPLIKITPPPPGIIVYRFGDSFTYLNCSRHYDIIYDEVKKNTRKG
AGR077C            ---WIPLDHAYSRELNPEAVVNPPPPGVIVYRPTDSWTYLNCSRHFDIILDHVKEHTRPG
ZYRO0C01452g       ---WISYDRSYSREFNPEVPIQPPPPGVIVYRFGDSYTYLNCSRHYDIIYDEVRRTTRRG
KLTH0G13486g       ---WVPFD-RYTRELNPEVFVAPPPPGVIVFRPSESWTYVNCSRQYDAIFDEVVRLTRRG
Kwal_56.23759      ---WVPFE-PYTRELNPQVPVAQPPPGVIVFRPSESWTYVNCARQYNAIFDEVVRTTRRG
KLLA0F19338g       ---WLPLNNHYQRELNPDVVVQAPPPGVIVYRPSESWTYVNCSRQYDTIFDRVKELTRPG
SAKL0H16830g       ---WIPLENNYGREYNSGIVVQPPPPGVIVYRPSESWTYINCSRQYDIIFDEVKRLTRRG
TPHA0J00800        ---WVPFDHTYTKELNKDVEILEPPPGVIVYRLSDSFIYLNCSRHFDTIFDEVKRKTKRG
CAGL0L12342g       ---WVPFDHAYSKELNPSVRITPPPPGVIVYRLSDSYTYINCSRHYDLIFDEIKRVTRRG
TDEL0F03980        ---WVAEQYAYNRELNPDVKILPPPPGVVVYRMSDSFTYINCSRHYDTIFDHIKKHTRRG
KNAG0G02070        ---WVPFDHAYTRELNPDVTIQPPPPGVIVYRMSDSYTYINASNHYDIIIDEIKRVTRRG
Kpol_543.43        ---WIPYDHAYTKEMNPNVEVTPPPDGVIVYRLTESFTYINCSRNYETLYDKVKELTRPG
NDAI0B02020        ---WLPFDHAYTKELNPNVIILPPPPGVIVYRLTDSFTYMNCSKHYDVIFEEIKKQTKRG
NCAS0B05050        ---WVPFDHAYTRELNPSVNILPPPPGVIVYRLTDSFTYINCSRHYDVIFDEVKRQTRRG
KAFR0B02750        ---WVPFDFSYTKELNPDAHIKPPPPGVIVYRMADSFTYMNCSRHFDILFDEIKRSTKRG
Suva_10.176        ---WLPFDHKYTKELNPDVNILPPPEGVLVYRLSESYTYINCSRHYNVITDEIKKVTRRG
Skud_12.160        ---WLPFDHKYTRELNPDVHILPPPESVLVYRLSESYTYLNCSRHYNIIIDEVKRATRRG
Smik_12.151        ---WVPFDHKYTRELNPDIQILPPPEGVLVYRLSESYTYLNCSRHYNIITEKVKEVTRRG
YLR092W            ---WIPFDHKYTRELNPDVQILPPPDGVLVYRLSESYTYLNCSRHYNIITEEVKKVTRRG
                      *:. .  : .* *    :  ** .::*:*  :*  *:*.:.::: : : :   *. *

TBLA0F03050        EIDVLSDALYVKPWNNPGPWEKPKL----------KFWEH---------------ADPEI
Ecym_4299          KL-VNHLRKSEQLWCEPGDWVPPLF------LRKFFKKYR---------------HKAAK
TPHA0A01760        IS-NVYKRKQDRPWNDVGEWECPKS------LKNLFNKFK---------KKTDIGGDEDK
AGR077C            QL-VNHLSNKERLWCDPGPWRPPRI------FRRFIADKR--------------------
ZYRO0C01452g       QM-ISAVKKVDRPWNDPGEWEAPRW------FKKLTSKKK--------------TAEEWA
KLTH0G13486g       RP-QIVAKSSSRPWNDPGEWHPPKF------LRKLFKSSS---------------EDLEN
Kwal_56.23759      K--VQVTSKSGRPWNDPGEWHPPKF------LRKWFGKKY---------------SESLE
KLLA0F19338g       KL-LKHVSKHDKMWNDPGEWEPPFL------VKKLFKLGN---------------KHDLE
SAKL0H16830g       IV-LAHTKKSDRPWNDPGQWEPPLF------LKKLFKRGK---------------RLEQE
TPHA0J00800        KF-IGNIKKSQRPWNDPGEWEAPTWMTKKFSIRNLFKRKQ----------EAESNVPNED
CAGL0L12342g       QL-IQHRHKWDRPWNDPGEWEAPD-------LKKFFNVKKFVSVFKRKVTDVDTFENENE
TDEL0F03980        QL-LHLRKKSDRPWNDPGEWEISPS------IKKFFKLGK---------------KNQND
KNAG0G02070        QL-LQHRKKSDRPWNDPGEWKPPKF------LSNVLHWRK---------------NKKKN
Kpol_543.43        QL-MTHIKKSDRPWNDPGDWKPPKF------LKNIINWRK--------------NKNKDD
NDAI0B02020        QL-IRHRKKSDRPWNDPGEWEAPNFSK---LWKKLSFRRN---------------KNNND
NCAS0B05050        QL-LRHRKKADRPWNDPGEWEAPQF------LKNLFHRKK---------------KNSTD
KAFR0B02750        KL-TQIMRKSDRPWNDPGKWEPRVF------IKKYLRREN---------------YDEDN
Suva_10.176        QL-IRHRKKSDRPWNDPGPWEPPTF------FKNLKFWKK---------------KETDI
Skud_12.160        QI-IRHRKKSDRPWNDPGPWEAPAF------LKNLKFWKK---------------KESDL
Smik_12.151        QL-IRHRKKSDRPWNDPGPWEAPAF------LKNLKFWKK---------------RESDS
YLR092W            QL-IRHRKKSDRPWNDPGPWEAPAF------LKNLKFWKK---------------RENDP
                              . * : * *                                        

TBLA0F03050        ARK--------KRMADKRPTLRILCLDFSQVAQIDSTALQALIDLRHEVNAYTCSLVEWH
Ecym_4299          PEV--------VEQVDNRPVLKILAMDWTQVTHVDSTSIQSLIDLRKTINRYADRQVGFH
TPHA0A01760        DGNEAIESNSKANNTDNKPELKIICFDFSQVVQTDATAIQSLNDLRKAVNRYSNKQIEYH
AGR077C            ---------TGSAVADARPVLRVLAMDWSQVSQVDSTGIQNLVDLRNALNKYADRPVEFH
ZYRO0C01452g       ETEAQESKAAEQKLQDNRPLLKIICLDFSQCSQTDATAIQNLTDLRKQVNRYADRQVEFH
KLTH0G13486g       R----------AVARDERPVLRVIAMDWSQVAQVDSTGLQTLQDLRKAVNKYADRQVEFH
Kwal_56.23759      Q----------GVVSDDRPVLRVIAMDWSQVAQVDSTGLQTLHDLRKAVSKYADRQVEFH
KLLA0F19338g       G----------GEVIDERPVLKILAMDWSQVTQIDSTGVQNLVDLRKAINKYANRQVEFH
SAKL0H16830g       LSP--------ELGRDERPVLKILAMDWSQVTQIDATGVQNLVDLRKAINKYADRQVEFH
TPHA0J00800        ASTDLDISNNKDIDMDHRPVLQVICLDFSQVSQTDNTALQSLFDLRKSVNSYADRQVEFH
CAGL0L12342g       IEHIHDGEHYKKNDKDERPLLRVVCLDFSQVANTDATALQSLADLRKAVNKYADRQVEFH
TDEL0F03980        IESQDE-DVAIDNTRDERPLLKIICLDFSQVVQVDSTAIQSLVDLRKAVHKYADRQVEFH
KNAG0G02070        QTADVESLET-GIVRDERPVLKVLCLDFSQVAQVDSTSLQSLVDLRKAVNAYADRQVEFH
Kpol_543.43        EPTTFD-----NKVVDTRPILKIICLDFSQVAQTDSTALQSLLDLRRAINKYADRQVEFH
NDAI0B02020        NEETHIPDVP-VSKRDDRPLLKVLCLDFSQVAQVDATALQSLVDLRKAINKYADRQVEFH
NCAS0B05050        EESAVDVSDN-SSIRDNRPLLKIVCLDFSQVAQIDASAIQSLVDLRKSINRYADRQVEFH
KAFR0B02750        VDIE-------DRVIDDRPFLKIICLDFSQVSQIDATAIQCLYDLRKSVNKYADRQVEFH
Suva_10.176        ESSENAVNNPTDAVRDDRPLLKILCLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFH
Skud_12.160        EFTQNAPNNSIDAERDERPLLKILCLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFH
Smik_12.151        EFLENAPDNSIGTERDDRPLLKILCLDFSQVAQTDATALQSLVDLRKVINQYADRQVEFH
YLR092W            ESMENAPSTSVDVERDDRPLLKILCLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFH
                                  * .* *.::.:*::*  : * :.:* * ***. :  *:   : :*

TBLA0F03050        FCGIISPWVRRNLIEIGFGKINKEF--------------------------FPKVND---
Ecym_4299          FSGIVSPWIKRALVHAGFGTINENYSNDPLLLKYSTYHVVQN---------VLSADE---
TPHA0A01760        FSGIISAWVKKSLIEMGFGTVNDNYSDKSIIIGHQSYHVSKI---------NNQEDGLEN
AGR077C            FAGIVSPWIKRALVNTGFGI-----ADPPLISSRVSYHLVR----------LPADPP---
ZYRO0C01452g       ICGLYAPWVKRALVNFGFGTVNEEYSDESLLAGHRSYHVAR----------APTSLE---
KLTH0G13486g       FAGIIEPWVKRGLINSGFGTVNDEFADESLLVGHKSCHIARSA--------EPTEDE---
Kwal_56.23759      FSGIISPWIKRGLLNTGFGTVNEEHADESLLVGHKTYQVARG---------GATGDE---
KLLA0F19338g       FSGIISPWIKRSLINAGFGTVNEEFSDESIIVGHTSYSLVKN---------RPDLQD---
SAKL0H16830g       FSGIISPWIKRALVAVGFGTVNDEFADESLILGHSSYHIVKT---------RPQDEE---
TPHA0J00800        FCGIISPWVKRGLIKLGFGTVNEAYSDASTIVGHVSYHIVKNPTFRNKSFSSHTSED---
CAGL0L12342g       FVGIYSPWIKRGLRNLGFGTTNEEYSDESIIAGHSSYHLSRF---------RESEQDGFN
TDEL0F03980        FTGIISSWVKRSLLSMGFGTVNASYSDESIIAGHSSYHIAKTT--------KPLADD---
KNAG0G02070        FAGIISPWIKRGLVKIGFGTVNEEFSDESIIAGHSSYHLVKN---------TIGDIE---
Kpol_543.43        FSGILSPWVKKGLVNLGFGTVNKEYSDESIIIGHTSYHVVK----------TEDLEN---
NDAI0B02020        FAGIVSPWIKKGLINIGFGTINEEYSDESIIAGHTSYHLAR----------IPGDDL---
NCAS0B05050        FAGIVSPWVKRGLINRGFGTINDEFSDASIIAGHSSYHLTRT---------LPDSDF---
KAFR0B02750        FVGIISPWIKKSLRNFGFGTINNEYSDESIIMGHSSYHLTK------------DVDG---
Suva_10.176        FVGIISPWVKRGLISRGFGTLNEEYSDESIVAGHTSYHVAR----------VPQNEE---
Skud_12.160        FVGIISPWVKRGLISRGFGTINEEYSDESIVAGHTSYHVAR----------VPRNKE---
Smik_12.151        FVGIISPWVKRGLVSRGFGTLNEEYSDESIVAGHTSYHVAR----------VPQSKE---
YLR092W            FVGIISPWVKRGLISRGFGTLNEEYSDESIVAGHTSYHVAR----------VPQGEE---
                   : *:  .*:.. *   ***                                         

TBLA0F03050        ---SSTVEVISDLEYN-GELALGENVPFFIC----VFRILIDG
Ecym_4299          -----ENQQNSEISAS-LDVASGTNFPFFHIDMPDFTKWDI--
TPHA0A01760        QINEKYLQPDGSYIYH-IQTVTGTNYPFFHIDIPDFSNWEL--
AGR077C            ---------HIVHGHS-VVFALGTNTPFFHLDMPDFETWRHDA
ZYRO0C01452g       ------DGLGSPAQYS-VYPASGTNLPFFHVEIPDFSKWDL--
KLTH0G13486g       -------------ESRLAHPATGTNLPFFHLELPDFSEWDYSD
Kwal_56.23759      -------------EALLPQPATGVNMPFFHAEMPDFSKWDFSD
KLLA0F19338g       ------PEAALPEPIA-LHTALGVNLPFFHLEMPEFHKWHL--
SAKL0H16830g       -------NHIGQGRYN-ISAASGTNMPFFHVEMPDFSKWSL--
TPHA0J00800        TISDMNIEAKDYNNYS-IEAASGTNYPFFHIDIPNFSKWDV--
CAGL0L12342g       ELDSLESQRNIGSKTK-VLAASGTNLPFFHVDIPDFSKWDI--
TDEL0F03980        -FTTDSSGSSQLQQSQEIYAATGTNMPFFHLDIPDFSKWDL--
KNAG0G02070        ------------NGYQ-VKTATGTNLPFFHIDIPDFKKWDI--
Kpol_543.43        NPMTTVEEPNQNSSYY-IHAGTGTNFPFFHIEIPDFSKWNI--
NDAI0B02020        -----ELPTMRGGNYK-VYTATGTNLPFFHIDIPDFYQWDV--
NCAS0B05050        DLESNFRDTYSRSQYH-VFAATGTNLPFFHIDIPDFSKWDL--
KAFR0B02750        -----------------IKAATGTNLPFFHIDIPNFNKWDI--
Suva_10.176        ----------TPDKYS-VYTASGTNLPFFHIDIPDFAKWDI--
Skud_12.160        ----------NPDKYS-VYTASGTNLPFFHIDIPDFAKWDI--
Smik_12.151        ----------NSDKYS-VYTASGTNLPFFHIDIPDFAKWDI--
YLR092W            ----------NPEKYS-VYTASGTNLPFFHIDIPDFAKWDI--
                                         * * ***      .       

FASTA FORMAT for MUSCLE Version 3.6

>TBLA0F03050
------------------------------------------------------------
------------------------------------------------------------
---MVYREKQVTLIETFNHRVPRAFTWQSIKTYLLSLLPITKWIAHYNLQWFISDVIAGI
TVGCVLVPQSMSYAQIATLDPQYGLYSSIMGCFIYTVFATSKDICIGPVAIMSLQTAKAI
AHVHQKHPD-----IPAHIIASTIAVICGAITMGIGVLRLGFFIDLIPVTAVFGFTSGSA
FNILWGQIPGLMGYSKDVNTRQDTYKVVVDTLKKLPKTNINAVMGLIPLFCLFVWKYGCD
-YAL--------------RRGNLKPWPKRIVFYLLSLRVTIVIIICSAAAY-GAKN----
----PSLKVLGKIPKGFAAASDNRLKSIPSDLVSDIWSEIPASVIVLVLEHVSIAKSFAR
VNNYRVSADQELTAIGVSNVMGACCLGAYPVTGSFSRTALKARCEVRTPLGSIFSGLCVV
VAITSLTSALAWIPKATLSAVIIHAVSGLISSYKVTIRLYKMGPLDCLGFLVTIFITVFS
EIEIGVYFAVCWACFLLMIRIAFPYGAFLGYVRVREISRSSITMIEPMDYE---SGNDKE
NIKLNKKQLTKKYYNKFINSLHYNAPYDDDG-TSEYKNQNNKSTSISTSSSNEPEPKSST
CSTNEPEPESSTYSTNEVISIQPSTKKDDQNKTQIYNVDEETSQHYVIKGEDPTKNNEYI
FRQETSENSTIVEGTGNLDNSQDLEQLDQSSVDENQDNIINKRLTRQLVYDHELEHDTPT
EIIWIPYSHRFTRELNPHVKIHPPPPGVVVYRFSDSLTYINCSRNYDNIIDYIKDNTKPG
EIDVLSDALYVKPWNNPGPWEKPKL----------KFWEH---------------ADPEI
ARK--------KRMADKRPTLRILCLDFSQVAQIDSTALQALIDLRHEVNAYTCSLVEWH
FCGIISPWVRRNLIEIGFGKINKEF--------------------------FPKVND---
---SSTVEVISDLEYN-GELALGENVPFFIC----VFRILIDG
>Ecym_4299
--MFILRENSDGIESQASTISDTQNLRTVDNNNRGLQDTSGLDELETDYTRFKTNEDS--
----------AGYSGAENERSRIDKFD-SVGSSLQFAK--YDGNALPD------------
FKAPPYYETTVTFMEYYDRTIRSRVGRSFFRSYFLSLFPIIKWIHHYNFAWMYSDFIAGI
TVGCVLVPQSMSYAQLAGLKPEYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSVQVSKVI
SHVIDQLPEGTP--ITAPMVASALALFSSILVIPIGLLRLGFILELISVTAVAGFMTGSA
LSILASQLPSLLGIQK-INTRVETYRVLISTLKHLNGSDINAAFGLICLALLFFWKWTCG
YLGP----KLISKYLR--PNSKKARIWQSFFFYAQALRNAFVLFLATFVSWLVIGRHKKK
----TSISVLGTVPSGL---KHVGVPTIPSGLVHKLMPQLPPAVIILLLEHITIAKSFGR
INNYKIVPDQELIAIGVTNLIGSF-FNAYPATGSFSRSALKAKCNVKTPLSGLFSGACVL
LALYYLTSAFYYIPKAALSAVIIHAVVDLIASYKLSFYLWNTNPFDLISFLATILLTIFS
SIENGIYFAVAFSMATLLMKNAFPSGKFLGYVKITEV--SNLNVFEDLDSI--GNNDPEL
PQEISKDS------KLAKDPDVHASANLMAS---------------------KLDVR---
------------FHTK--------------------------------------------
------------------------------------------------------------
---WVPLDNGYSRELNPEIAVHMPPPGVIVYRPTESWHYLNCSRQFDIIVDRVKTLTRPG
KL-VNHLRKSEQLWCEPGDWVPPLF------LRKFFKKYR---------------HKAAK
PEV--------VEQVDNRPVLKILAMDWTQVTHVDSTSIQSLIDLRKTINRYADRQVGFH
FSGIVSPWIKRALVHAGFGTINENYSNDPLLLKYSTYHVVQN---------VLSADE---
-----ENQQNSEISAS-LDVASGTNFPFFHIDMPDFTKWDI--
>TPHA0A01760
-------------------------------MTASINGSIDLERFELEYDHGKRGDD---
----------THDRVEARDLYSKVDIEEVTFQCDNYSG--RLDVNSSL------------
-SIPMYNEKPVTIKDFYYEKINDYFSIGEIVQYLTSLFPLLKWLPHYNLDWLIQDLIAGI
TVGCVLVPQSMSYAQIATLAPQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLQTAKVI
ERVTSGLTADEQTIYTAPIIATALALLCGIISTGIGFLRLGFLIEFISLNAVAGFMTGSA
FNIICGQVPALMGYNKKVNTRASTYEVVINTLKHLPDTKLDAVFGLIPLSILYLCKWFFS
SLGPQYLNKLSNRRNLTERQRKIIKYLGNYFFYSNAMRNGVVIIVFTAISW-AITRGKSS
TS--VPISILGTVPKGL---KEVAVFKVPGGLFEKLAPDLPSSIIILLLEHIAISKSFGR
VNDYKIVPDQELIAIGVTNLIGTF-FMAYPATGSFSRSALKAKCDVKTPLSGLFSGACVL
LALYCLTGAFYYIPKATLSAVIIHAVSDLLASYKTTLNFYKMNPLDFVCFITTVFITVFS
SIEYGIYFAICFSCAQLIFKNMFPVGSFLGYIKIAEV--LNPTLSTNDYTILLDDSSSVL
GEENTKDDSVKNRLDQNENPKSSEKEYSEFK------------SYEMSSNSKTTNLS---
------------YYVR--------------------------------------------
------------------------------------------------------------
---WVPMKNDYHREVNPLIKITPPPPGIIVYRFGDSFTYLNCSRHYDIIYDEVKKNTRKG
IS-NVYKRKQDRPWNDVGEWECPKS------LKNLFNKFK---------KKTDIGGDEDK
DGNEAIESNSKANNTDNKPELKIICFDFSQVVQTDATAIQSLNDLRKAVNRYSNKQIEYH
FSGIISAWVKKSLIEMGFGTVNDNYSDKSIIIGHQSYHVSKI---------NNQEDGLEN
QINEKYLQPDGSYIYH-IQTVTGTNYPFFHIDIPDFSNWEL--
>AGR077C
--------MSRQVHTGRSSSDDTGAPQW---PSRNSVLNDDIEALQAEYDQLKAGEVH--
----------SAQGATHGDIGSRQYSG-SGKPAAQYLG--LNVNSREA------------
--VPEYEETVVSVKDYYNYKLRGFISLNTARDYALSVFPLHRWIHHYNVAWMYADMVAGI
TVGCVLVPQSMSYAQLASLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLETAKVI
ARVTENLPEDTN--ITGPIIATALTLLCGAIAMVIGILRLGFLVEFISITAVTGFMTGSA
LSIISGQVPSLMGYSKKVNTRATTYKVIIESLKHLKDTNMNAAFGLVPLVLLFLWKWICG
SLGP----RLVDRYLQ--FKPSRASRWNAAFFYLQALRNAVIIVVFTAISW-GISRHKLE
K---PPISLLGKVPSGL---KNVGPLELPEGLVEKLLPELPAATIILLLEHIAIAKSFGR
INNYKVVPDQELIAIGVTNLFATF-FNAYPATGSFSRSALKAKCNVKTPLSGLFTGACVL
LALYCLTEAFYFIPKATLSAVIIHAVADLIASYKVTWMFWRTNPLDFFAFIVTVIITVFS
SIEHGIYFSISWSCAVLLCKVAFPDGKFLGYIDVAEV--IEPAGPPSINSE---ADLASI
DNSATFQQ---------IDKDGGKLNTVESV-------------------LPDPHTR---
------------FHRR--------------------------------------------
------------------------------------------------------------
---WIPLDHAYSRELNPEAVVNPPPPGVIVYRPTDSWTYLNCSRHFDIILDHVKEHTRPG
QL-VNHLSNKERLWCDPGPWRPPRI------FRRFIADKR--------------------
---------TGSAVADARPVLRVLAMDWSQVSQVDSTGIQNLVDLRNALNKYADRPVEFH
FAGIVSPWIKRALVNTGFGI-----ADPPLISSRVSYHLVR----------LPADPP---
---------HIVHGHS-VVFALGTNTPFFHLDMPDFETWRHDA
>ZYRO0C01452g
----MVGSPSGNLSGSGTPPPSQLPPRF--ESEVELSEVSNLDDLEQEYDQYKAAEDRER
V---------VGRGDDEYDDDLRKGKVDYKETELEYWN--STNGTTNL--------LAPK
ATVPSYEEGQVGPFDIFYHDLKDRMTLGAVKHYFESAFPIIKWLPFYNWKWGYADLVAGI
TVGCVLVPQSMSYAQIATLPPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLETAKVI
QETLEKFPKEDHE-VTGPLIATALALLCGIVAMGAGVLRLGFLVELISLNAVAGFMTGSS
LNIISGQVPALMGFKKYVHTRDSTYKIIINSLKNLKHTQLDAVFGLIPLVLLYTWKWWCS
SYGP----KLADRHFK--NNPKKRDILKTFYFYAQAMRSAVIIIVFTAISY-GITKGRKT
----PRISVLGKVPKGL---KDVHVMRIPEGLLSKMGSSIPSAIIILLLEHISIAKSFGR
VNNYKVVPDQELIAIGATNLIGTF-FNAYPATGSFSRSALKAKCNVRTPLSGVFSGACVL
LALYCLTQTFYYIPSATLSAVIIHAVSDLCASYKTSWNFYKMNPGDFIAFIVTVFITVFS
SIDYGIYFAMCWSAAMFLLKNMFAPGRFLGRVEVAEV--VNAQVDPNVESVSESAGSHLD
GFQAQSSIESSSKKLDPLDKSAVHSNYLNGG---------DDGSDNNINNQIGQKLV---
------------YHTK--------------------------------------------
------------------------------------------------------------
---WISYDRSYSREFNPEVPIQPPPPGVIVYRFGDSYTYLNCSRHYDIIYDEVRRTTRRG
QM-ISAVKKVDRPWNDPGEWEAPRW------FKKLTSKKK--------------TAEEWA
ETEAQESKAAEQKLQDNRPLLKIICLDFSQCSQTDATAIQNLTDLRKQVNRYADRQVEFH
ICGLYAPWVKRALVNFGFGTVNEEYSDESLLAGHRSYHVAR----------APTSLE---
------DGLGSPAQYS-VYPASGTNLPFFHVEIPDFSKWDL--
>KLTH0G13486g
------------MSNFQSSPGSKRESSFEVSRELSNDAPIDLDDLDAEYGQFKNAEHSDA
TAGR------DLTSEYGAQFAAEFGGE-PGSGSGSGSG--FPEAKPVA----PAAPGNVP
SALYEFHERPVTVGEFYSQNLRSTFTLATFTNYLRSLLPIMRWLPHYNARWLYQDLVAGI
TVGCVLVPQSMSYAQIATLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLQTAKAI
SHVVSSLPEDTE--ITSPMIATALALLCGIISLGLGVLRLGFLVELISSTAVAGFMTGSA
LNIIAGQVPALMGYNKLVNTRTSTYKVIINSLRHLPDTKLDAVFGLVPLVILYVWKWGCS
TGGP----RLVQRY-----GSRRSRMWDNVFLYTQALRNAVVIVVFTAIAW-GMSHRALK
EGGSARISLLGTVPSGL---KDVGVMKVPSGLLSKIAPELPASVIVLVLEHIAISKAFGR
VNDYRVVPDQELIAIGATNLIGTF-FNAYPATGSFSRSALKAKCNVSTPLSGLFSGACVL
LAIYCLTSAFKFIPKATLSAVIIHAVSDLIASYKTTWSFWRLSPPDLVCFLVTVVITVFS
SIENGIYFAMCWSVAVLLFRTAFPAGKFLGRVQIAEARVTNSGAGAGVGMSSGNSAGTAV
NREKERET-TFTAVSVSSESLSHTAPGKAKAANSAGTDKLGKVEGHVTDGGSPRAPR---
------------FHTK--------------------------------------------
------------------------------------------------------------
---WVPFD-RYTRELNPEVFVAPPPPGVIVFRPSESWTYVNCSRQYDAIFDEVVRLTRRG
RP-QIVAKSSSRPWNDPGEWHPPKF------LRKLFKSSS---------------EDLEN
R----------AVARDERPVLRVIAMDWSQVAQVDSTGLQTLQDLRKAVNKYADRQVEFH
FAGIIEPWVKRGLINSGFGTVNDEFADESLLVGHKSCHIARSA--------EPTEDE---
-------------ESRLAHPATGTNLPFFHLELPDFSEWDYSD
>Kwal_56.23759
------------------------------MSNLERQTSLDLDDLDAEYGHFKNTEHSEI
GGGPSSNPGAAVGVGASTKLGQDQNGD-KSGATGGGNG--ANEPLALY------------
DSPEAYYEDKVTFREYYDTTIRPSLTASNVRQYLRDLLPVINWLPHYNGRWFYQDMVAGI
TVGCVLVPQSMSYAVIATLPPQFGLYSSFVGAMIYSFFATSKDVCIGPVAVMSLQTAKAV
SKVMAELPADTD--ITAPVVATALAFLCGLISLGLGVLRLGFLVELISSTAVAGFMTGSA
LNIISGQLPALMGYNKLVNTRTSTYKVIIETLKHLPDTKLDAVFGLIPLVMLYTWKWLCN
SGGP----RLVERYTV--RGSRKQRIWSATLFYTQALRNAVIIIVFTAIAW-SISHHKKK
----APISLLGPVPSGL---KDVGVMKLPDGLAAKIAPELPASVIVLLLEHIAIAKAFGR
VNDYRVVPDQELIAIGATNLLGTF-FNAYPATGSFSRSALKAKCNVSTPLSGVFSGACVL
LAIYCLTSAFQYIPKATLSAVIIHAVSDLIASYKTTWSIWRLNPLDLVCFLATVFIAVFS
SIENGIYFAMCWSVAVLLFKVAFPRAQFLGRVEIAELA-TNEGVSAGSEFAPLSKDFEKG
KGVSYASG------SVSSESFNAKKQGIEGG------------SQFVGGASNAAGAG---
------------FHTK--------------------------------------------
------------------------------------------------------------
---WVPFE-PYTRELNPQVPVAQPPPGVIVFRPSESWTYVNCARQYNAIFDEVVRTTRRG
K--VQVTSKSGRPWNDPGEWHPPKF------LRKWFGKKY---------------SESLE
Q----------GVVSDDRPVLRVIAMDWSQVAQVDSTGLQTLHDLRKAVSKYADRQVEFH
FSGIISPWIKRGLLNTGFGTVNEEHADESLLVGHKTYQVARG---------GATGDE---
-------------EALLPQPATGVNMPFFHAEMPDFSKWDFSD
>KLLA0F19338g
-----------MTSPQQTSVSGKEFDSLDGESSNQYSVGPDFDQLEQEYDDLKTSEIIAP
HISNGHS---ISSSPRHHHLYEDRHLDSIIDTNTHGFKKHDNGNGKFADVNIEQIYNYDS
LRVPNYEETVVDAKQLYDEKLRPYLTFSAIVEYLTSLFPLLKWVHHYNFNWLYNDLVAGI
TVGCVLVPQSMSYAQIATLPAQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLETAKVI
ARVLEKVGEDNPE-ITAPIIATTLSLICGGVALGVGLLRLGFLVEFISLNAVAGFMTGSA
INIMSGQVPGLMGYSKNVNTRDSTYKVIINTLKHLPDTKLDAVFGLIPLFILYSWKYFCG
TLGP----KLVDRYVAR-SDVKRAAAYKYILFYLQALRNAFVIIIFTLISW-GITRHKAK
ED--LPISLLGTVPSGL---KNVGVMKLPDGLVSNLASELPSAIIILVLEHIAISKAFGR
VNGYKVVPDQELIAIGVTNLISTF-FNAYPATGSFSRSALKAKCNVKTPLSGIFTGACVL
LSLYCLTDAFYFIPKAALSAIIIHAVSDLVASYKTTWNFWLMNPLDFVCFIVTVIITIFS
SIENGIYFAVCWSCALLLLKVVFPTGQFLGYVEICQV--SNAEVDENIDRI----VLSED
SQPKTIED------NVTKNNTAVKVGVVANE------------------SFGHSQLQ---
------------YHTK--------------------------------------------
------------------------------------------------------------
---WLPLNNHYQRELNPDVVVQAPPPGVIVYRPSESWTYVNCSRQYDTIFDRVKELTRPG
KL-LKHVSKHDKMWNDPGEWEPPFL------VKKLFKLGN---------------KHDLE
G----------GEVIDERPVLKILAMDWSQVTQIDSTGVQNLVDLRKAINKYANRQVEFH
FSGIISPWIKRSLINAGFGTVNEEFSDESIIVGHTSYSLVKN---------RPDLQD---
------PEAALPEPIA-LHTALGVNLPFFHLEMPEFHKWHL--
>SAKL0H16830g
------MSDYHTHNRGSSKDLEHNSSDF---------AEPNLDDLEAEYDNYKNAEQNPR
EKSD------VVETLPPTTHQNDAKGL-KNDGQTTVEL--YGTTSSGG------------
-VIPGYHEDTVNFKDYYDQSLSSNISFSSFREYLISLFPVIRWIPHYNFAWMYGDVVAGV
TVGCVLVPQSMSYAQIASLPAQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLETAKVI
ARVTEHLPDDTE--ITGPIIATALSLLCGAITLGIGVLRLGFLVELISLNAVAGFMTGSA
FSIITGQLPALMGYNEKVNTRDTTYKVVINTLKHLPDTKLDAVFGLIPLLILYLWKYGCN
TIGP----NWVDRRMN--PHSPRAKFWKSFFFYAQALRNAFVIVLFTLIAW-GITRHKKK
----HPISLLNTVPSGL---KNVGVMKFPDHLATNLAPELPAAAIILLLEHIAIAKAFGR
INDYKVVPDQELIAIGVTNLVGTF-FNAYPATGSFSRSALKAKCNVRTPLSGVFTGACVL
LALYCLTEAFYYIPKATLSAVIIHAVSDLIASYETTWNFWKMNPLDCLCFLVTVFITIFS
SIENGIYFAICWSCAILLFKIAFPSGKFLGRVEVSEV--INPTVREDLGVV---EDFDSE
NINVASST---------KPKLGLSADNSSIS-------------------TGPSRVR---
------------FHTK--------------------------------------------
------------------------------------------------------------
---WIPLENNYGREYNSGIVVQPPPPGVIVYRPSESWTYINCSRQYDIIFDEVKRLTRRG
IV-LAHTKKSDRPWNDPGQWEPPLF------LKKLFKRGK---------------RLEQE
LSP--------ELGRDERPVLKILAMDWSQVTQIDATGVQNLVDLRKAINKYADRQVEFH
FSGIISPWIKRALVAVGFGTVNDEFADESLILGHSSYHIVKT---------RPQDEE---
-------NHIGQGRYN-ISAASGTNMPFFHVEMPDFSKWSL--
>TPHA0J00800
----------MPTDKKNDTTVDNRDLDNIELSSYSNSNTVDLEALEEEYDQYKKEEEIEY
ISGNYLNSSPTQNINVTSNPKYEEYKKLKHLDQSYNYV--STEYLDTD------------
YLIPAHNENIITFKEYYNHSLKEYFTFNAAKNYALSIFPIIHWLPFYNFNWFISDLIAGI
TIGCVLVPQSMSYAQIATLDPQYGLYSSFIGAFVYALFATSKDVCIGPVAVMSLETAKVI
ADVSSHFQ-NDPD-VTGPIIATTLALLCGGIAAAVGFLRLGFLVELISLNAVTGFMTGSA
FNILWGQVPGLMGYSKLVNTRQATYKVVIDTLKHLPDTKLDAVFGLIPLFILYVVKWWCT
NYGL----QLAEKQFS--SNERYRFYLKKFYFYTNAMRNAVVIIIFTAISW-SITRNKSS
SE--RPITVLGTVPSGL---KDIGVFKPQTKIVQKIGPQLPASIIVLLLEHIAIAKSFGR
INDYKIVPDQELIAIGISNLVGTF-FSAYPATGSFSRSALNAKCNVKTPLSGIFTGGCVL
LALYCLTGAFFYIPKATLSAVIIHAVSDLIASYQTTLSFWNMNPLDTLCFLVTVLITVFS
SIENGIYFAMCYSCALFIFRSAFPAGKFLGRIEIAEV--INATPKDDFQMDNFNGFETSE
YNNFPADQ------SYGKFDIANKNTHKYNS--------------------PHCSKN---
------------FYTK--------------------------------------------
------------------------------------------------------------
---WVPFDHTYTKELNKDVEILEPPPGVIVYRLSDSFIYLNCSRHFDTIFDEVKRKTKRG
KF-IGNIKKSQRPWNDPGEWEAPTWMTKKFSIRNLFKRKQ----------EAESNVPNED
ASTDLDISNNKDIDMDHRPVLQVICLDFSQVSQTDNTALQSLFDLRKSVNSYADRQVEFH
FCGIISPWVKRGLIKLGFGTVNEAYSDASTIVGHVSYHIVKNPTFRNKSFSSHTSED---
TISDMNIEAKDYNNYS-IEAASGTNYPFFHIDIPNFSKWDV--
>CAGL0L12342g
--------------------------------------MEELDNLELEYNQFKNNERPSN
T---------NAGADIEKGLDTKKYFE-RSITDNSTYG--KKSY----------------
-SIPSYEEDTITLKDYYDTNLRDYFTWASVVDYIRSLFPVVNWLPFYNPKWFLSDLIAGI
TVGTVLVPQSMSYAQIATLPPEYGLYSSFIGALVYSFFATSKDVCIGPVAVMSLQTAKVI
ARVKEKHPDLDPS-ITGPIIATVLAFICGIIATGVGLLRLGFLVELISLNAVAGFMTGSA
FNIIWGQIPGLMGYSKKVNTRRSTYHVVIDSLKHLPDTKLDAAFGLIPLFTLFFWKWWCN
SMGP----KLTDRYFPANSRPRANKYWKAFYFYLQASRNGIIIILFTAVSY-GITKGVAK
DK--RRISVLGTVPKGL---RHTGVMKLPHGILNNIAAEIPSSIIVLLLEHIAISKSFGR
VNDYKINPNQEIIAIGVSNLLGTF-FNAYPATGSFSRSALKAKCNVMTPLSGIFSAACVL
LAIYCLTGAFFYIPKATLSAVIIHAVFDLIASYHTTWSLWKMNVFDFIGFITTVFITVFS
SIENGIYFAVCWSCAILLYNNAFPAGKFLGRIEIAEV--VNPKIVDDDDFSFENSNESFD
DEGIYFDN------SVAEDKLGTSSNDLKKF---NAGVKTRSINGELVNGQTSSDIR---
------------YYTK--------------------------------------------
------------------------------------------------------------
---WVPFDHAYSKELNPSVRITPPPPGVIVYRLSDSYTYINCSRHYDLIFDEIKRVTRRG
QL-IQHRHKWDRPWNDPGEWEAPD-------LKKFFNVKKFVSVFKRKVTDVDTFENENE
IEHIHDGEHYKKNDKDERPLLRVVCLDFSQVANTDATALQSLADLRKAVNKYADRQVEFH
FVGIYSPWIKRGLRNLGFGTTNEEYSDESIIAGHSSYHLSRF---------RESEQDGFN
ELDSLESQRNIGSKTK-VLAASGTNLPFFHVDIPDFSKWDI--
>TDEL0F03980
----------MGTREAESVPAD---------------SAFKLDDLEAEYDLYKANEQLED
NE--------VTVNGSEDDYGNKKGIDLVKETEVRYYG--SPGPEAIG------------
GNIPGFEESTVSVKDYYNQFIREKLTLNSAGSYVYSLFPIVKWFPHYNLTWGYADLVAGI
TVGCVLVPQSMSYAQIASLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAKVI
AQVSAKYPENDPI-VTAPVIATALSLLCGIVAIGVGLLRLGFLVELISLNAVAGFMTGSA
FNILWGQVPALMGYSSKVNTRASTYKVVIDSLKHLPDTKLDAVFGLVPLCLLYLWKWWCG
TYGP----KLADRQLA--HSPKKQRILKRFYFYSNAMRNAVIIIVFTAISW-RITKNKDK
EH--RPIKVLGTVPSGL---EDVGVAKIPEGLLAKMAPDIPASIIVLLLEHIAISKSFGR
INDYKVVPDQELIAIGATNLIGTF-FNAYPATGSFSRSALKAKCEVRTPFSGVFTGCCVL
VAIYCLTDAFFFIPSATLSAVIIHAVSDLLASYKTTWNFWKMNPLDCCAFIVTVLITVFS
SIENGIYFAMCWSCAMLLLKHAFPAGQFLGRVEVAEV--INPTVVEDVEAI---SINDQI
EGSVGKSK------SLKADKGAISASSGSNY-------------------------K---
------------FHSK--------------------------------------------
------------------------------------------------------------
---WVAEQYAYNRELNPDVKILPPPPGVVVYRMSDSFTYINCSRHYDTIFDHIKKHTRRG
QL-LHLRKKSDRPWNDPGEWEISPS------IKKFFKLGK---------------KNQND
IESQDE-DVAIDNTRDERPLLKIICLDFSQVVQVDSTAIQSLVDLRKAVHKYADRQVEFH
FTGIISSWVKRSLLSMGFGTVNASYSDESIIAGHSSYHIAKTT--------KPLADD---
-FTTDSSGSSQLQQSQEIYAATGTNMPFFHLDIPDFSKWDL--
>KNAG0G02070
---MTERRHSFRQEDSDNSFPNEYGAEY--NNANEVSSTPDLDNLELEYDQYKADELHPQ
RT--------ILSNQADTDREKIANVF-VEEQSVRDSN--IPSASIEELQYFAHE-SDGA
KVIPSYVEGNVTELEFFNHSLRSKFTLNAAKNYILSIFPIIHWLPHYNVYWFIQDLIAGI
TVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLETAKII
ARVMKRFP-NDPD-VQGPIIATTTALLCGGIAAGVGFLRLGFLVELISLNAVAGFMTGSA
LNIISGQVPALMGYGKLVNTRTATYKVIVNTLKHLPDTKLDAVFGLIPLFILYFWRWWCN
GYGP----KLTDRYYP--KGSRGNFLWKKFYFYAQASRSGIIIIVFTAISW-SITRHVPS
KE--RRISILGTVPKGL---KDVGAIKVPPELPAKIAPELPAAVIVLLLEHIAISKSFGR
INDYKVVPDQELIAIGVTNLIGTF-FHAYPTTGSFSRSALKAKCNVKTPLSGLFTGSCVL
LALYCLTGAFFYIPKATLSAVIIHSVSDLVASYHTTWNFYKMNPLDFVCFLTTIIITVFS
SIENGIYFAICWSCALLLFKVAFPAGKFLGRVEIAEV--VDGEIINDNSVV---MTTDDC
VSEFGGNK------EFSKDKLNGKSDFIVKD---------KLDSTASSSSIAENKLK---
------------YYTK--------------------------------------------
------------------------------------------------------------
---WVPFDHAYTRELNPDVTIQPPPPGVIVYRMSDSYTYINASNHYDIIIDEIKRVTRRG
QL-LQHRKKSDRPWNDPGEWKPPKF------LSNVLHWRK---------------NKKKN
QTADVESLET-GIVRDERPVLKVLCLDFSQVAQVDSTSLQSLVDLRKAVNAYADRQVEFH
FAGIISPWIKRGLVKIGFGTVNEEFSDESIIAGHSSYHLVKN---------TIGDIE---
------------NGYQ-VKTATGTNLPFFHIDIPDFKKWDI--
>Kpol_543.43
-------------------------MSF---------DLDDLEDLELEYNQYKTVEEQGN
SD--------VGDSSGNDDLGNAGDGL-TKDSKFVFEK--DLGYTDDSNELTRESFLNSS
ENVPRYIEETVTLKEYYNHSIRHYLTFKSFGNYLISIFPIIKWLPFYNYKWLISDLIAGI
TIGCVLVPQSMSYAQIATLPPQYGLYSSFVGAYTYSLFATSKDVCIGPVAVMSLQTAKVI
QHVNSSLTEEQKTYITAPLIATTLALLCGIISAGVGLLRLGFLVELISLNAVTGFMTGSA
LNIISGQVPALMGYASEVNTREATYKVIINTLKHLPDTKIDAIFGLIPLVILYFWKWWFS
SMGP----KLVDRYY---PNSKYKKYIKAFYFYGNAMRSGIIIIVMTSISW-SVTRGKSK
SE--RPISILGTVPSGL---QEVGVFTPPNGLLAKVAPELPSSIIVLLLEHIAIAKSFGR
VNDYKVVPDQELIAIGISNLIGTF-FNSYPVTGSFSRSALKAKCNVKTPLSGIFTGSCVL
LALYCLTGAFFYIPKATLSAVIIHAVSDLVASYKTTWSFWKMNPLDFICFITTVFITVFA
SIEDGIYFTMCWSAAILLFKVAFPAGKFLGYVKIAEI--VNPEIVDSDYLV------EKA
ETSVQYST-------VLMNPEKGELSYLSSK-------------------SSESQLK---
------------YHIK--------------------------------------------
------------------------------------------------------------
---WIPYDHAYTKEMNPNVEVTPPPDGVIVYRLTESFTYINCSRNYETLYDKVKELTRPG
QL-MTHIKKSDRPWNDPGDWKPPKF------LKNIINWRK--------------NKNKDD
EPTTFD-----NKVVDTRPILKIICLDFSQVAQTDSTALQSLLDLRRAINKYADRQVEFH
FSGILSPWVKKGLVNLGFGTVNKEYSDESIIIGHTSYHVVK----------TEDLEN---
NPMTTVEEPNQNSSYY-IHAGTGTNFPFFHIEIPDFSKWNI--
>NDAI0B02020
--MNQTIPFQKNENNTNDIENQYELPSF----PNSDTSSQNLADLELEYDQYKASETNNK
SNHGP-----DLETNNLDVQFSNTYNTGDKKNSIKNHQIQINTFNADS------------
VIIPSFEEHAISFKDYYRHSLKENFSLKSVKEYALSIFPIIRWLPHYNLAWFSSDLIAGI
TVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFTYSLFATSKDVCIGPVAVMSLETGKVI
TKVLAKYPEADPN-ITAPVIATVLAFLCGVITAGIGFLRLGFLVELISLNAVTGFMTGSA
LNIMWGQIPALMGYGSKVNTRTSTYKVIIESLKHLPDTKLDAVFGLIPLFILYLWKWWCG
NMGP----RMADKWFA--NNEKGNFYLKKFYFYAQAAKNAVIIIVFTAIAW-SITKGKTK
DE--RPISILGSVPKGL---KEVGVMKLPDGLASKIAPELPASVIVLLLEHIAIAKSFGR
INDYKVVPDQELIAIGVTNLIGTF-FNAYPATGSFSRSALKAKCEVRTPLSGLFTGSCVL
LALYCLTGVFLYIPKATLSAVIIHAVSDLIASYHTTWNFWKMNPLDCFSFIVTVFITVFS
SIENGIYFAMCWSCAILVLKVAFPAGKFLGRVEIAEV--VNGCVDDSFEVT---DYSSNS
NLSLSADT-----INHNKKLKILHIPLLKTL--------KDQLFSDISSIQGKSKIR---
------------YYTK--------------------------------------------
------------------------------------------------------------
---WLPFDHAYTKELNPNVIILPPPPGVIVYRLTDSFTYMNCSKHYDVIFEEIKKQTKRG
QL-IRHRKKSDRPWNDPGEWEAPNFSK---LWKKLSFRRN---------------KNNND
NEETHIPDVP-VSKRDDRPLLKVLCLDFSQVAQVDATALQSLVDLRKAINKYADRQVEFH
FAGIVSPWIKKGLINIGFGTINEEYSDESIIAGHTSYHLAR----------IPGDDL---
-----ELPTMRGGNYK-VYTATGTNLPFFHIDIPDFYQWDV--
>NCAS0B05050
MSGTNGNPFNTRESENDLSNDQYEIPNYTSNIPSSGNSTQNLDDLELEYDQYKVSETNNN
DDVINNNNNNNNNNNNIPELETQQNLD-VQFSNTTNNK--ENQYRIVS--------TVNP
VIIPNYDEKTVSIKDYYDHSIRENVTLVGVRDYFLSIFPITRWLPHYNLTWFTSDLIAGI
TVGCVLVPQSMSYAQIATLPAQYGLYSSFIGAFCYSLFATSKDVCIGPVAVMSLETAKVV
TKVLAKYPDNDPT-ITAPIVATALSLLCGIVTAGVGVLRLGFLVELISLNAVTGFMTGSA
LNILWGQVPGLMGYNSKVNTRTANYKVIIETLKHLPDTKLDAVFGLIPLFLLYLWKWWCD
NMGP----KLVDKWFPKNKNERANFYFKKFYFYAQAAKNAIIIIVFTAISW-SITRGKAK
AD--RPISILGTVPKGL---KEVGVMKLPDGLLSKLAPELPASVIVLLLEHIAIAKSFGR
INDYKVVPDQELIAIGVTNLIGTF-FNAYPATGSFSRSALKAKCKVRTPLSGIFTGACVL
LALYCLTGAFFYIPKATLSAVIIQAVSDLIASYKITWNFWKMNPLDCLCFLVTVFITVFS
SIENGIYFAVCWSCAILLLKVCFPAGKFLGRIEVAEV--IDGYVDNSIESATTAEYSSAS
SPSSDNET------DTKKIQKTSSISFGKDA---------KAVAVSTSPVDCNPKVR---
------------YYTK--------------------------------------------
------------------------------------------------------------
---WVPFDHAYTRELNPSVNILPPPPGVIVYRLTDSFTYINCSRHYDVIFDEVKRQTRRG
QL-LRHRKKADRPWNDPGEWEAPQF------LKNLFHRKK---------------KNSTD
EESAVDVSDN-SSIRDNRPLLKIVCLDFSQVAQIDASAIQSLVDLRKSINRYADRQVEFH
FAGIVSPWVKRGLINRGFGTINDEFSDASIIAGHSSYHLTRT---------LPDSDF---
DLESNFRDTYSRSQYH-VFAATGTNLPFFHIDIPDFSKWDL--
>KAFR0B02750
----------------MSNQHDTELTDF-----------SNLDDLEQEFNQYKKIELT--
----------ISSTRQNEEVDSKRQGKSDKNVKSSSFD--SIFSLTQQ------------
QQVPTYEENSITIADYYTYSLRPYFTFKTITDYIKSLFPIFHWLPHYNLTWFISDLIAGI
TVGCVLVPQSMSYAQIATLSPQFGLYSSFIGAFSYSLFATSKDVCIGPVAVMSLQTAKVI
ARVQDKLPSDTD--ITASEIATTLALLCGIIATGVGLLRLGFLVELISLNAVAGFMTGSA
LNIISGQVPGLMGYNSEVNTRTSTYKVIIDTLKHLPDTKLDAVFGLIPLFLLFAWKWVCD
VLGP----RLNERHFGNGKNPRAHRIMKNFYFYAQTTKNAIIIIVFTCISW-AITRGKTS
ET--RPISVLGSVPKGL---KDVETFTVPSGLMAKLAPELPASIIVLLLEHIAIAKSFGR
INDYKIVPDQEIVAIGITNLLGTF-FHAYPATGSFSRSALKAKCNVRTPLSGLFSGACVL
LALYCLTGAFFYIPKATLCAVIIHAVSNLIASYKATMNFWKMNPLDCFCFLVTVIITVFA
SIEDGIYFAMCWSVAVLLFKVAFPPGKFLGQIEITEV--LDGKLVGDSSVL---TSSDEN
SEILPTTK------------AGYSVEVVSNH---------------------NENTN---
------------YYTK--------------------------------------------
------------------------------------------------------------
---WVPFDFSYTKELNPDAHIKPPPPGVIVYRMADSFTYMNCSRHFDILFDEIKRSTKRG
KL-TQIMRKSDRPWNDPGKWEPRVF------IKKYLRREN---------------YDEDN
VDIE-------DRVIDDRPFLKIICLDFSQVSQIDATAIQCLYDLRKSVNKYADRQVEFH
FVGIISPWIKKSLRNFGFGTINNEYSDESIIMGHSSYHLTK------------DVDG---
-----------------IKAATGTNLPFFHIDIPNFNKWDI--
>Suva_10.176
----------MSRETHSNIEEVVEIPDF-----QDSTTVPDLDDLELEYDQYKNNENNGA
FNDN------DLESNSLTNHNTASEAKGVKGSKVEYFN--TSDISLYD------------
NSVSQFDEPTVSFKEYYDHSIRSHLTLKAAGNYLKSVFPIIYWLPHYNVNWFIADLIAGI
TIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYAYSFFATSKDVCIGPVAVMSLQTAKVI
ADVTARYPDGDTT-ITGPIIATTLALLCGIISAAVGFLRLGFLVELISLNAVAGFMTGSA
FNILWGQVPALMGYNKLVNTRVATYKIVIDSLKHLPDTTLDAAFGLIPLFILYTWKWWCG
TYGP----RLNDRFNS--KKPRLHKIVKWTCFYAQASRNGIIIIVFTCIAW-AITRGKSS
AD--RPISILGSVPSGL---KEVGVFHVPPGLMSKLGPNLPASIIVLLLEHIAISKSFGR
VNDYKVVPDQELIAIGVSNLLGTF-FNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVL
LALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFS
SIENGIYFAMCWSCAIFILKVAFPAGKFLGRVEIAEV--TDAYVRADSDSV---SFTSEN
NNRISTLE------EDGVGEKEGPTNYIINSFKKLETKVQTKGFESPSASIGQPRIK---
------------YHTK--------------------------------------------
------------------------------------------------------------
---WLPFDHKYTKELNPDVNILPPPEGVLVYRLSESYTYINCSRHYNVITDEIKKVTRRG
QL-IRHRKKSDRPWNDPGPWEPPTF------FKNLKFWKK---------------KETDI
ESSENAVNNPTDAVRDDRPLLKILCLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFH
FVGIISPWVKRGLISRGFGTLNEEYSDESIVAGHTSYHVAR----------VPQNEE---
----------TPDKYS-VYTASGTNLPFFHIDIPDFAKWDI--
>Skud_12.160
-----------MSKETQPNLEEVEIPDF----QDNTDSVPNLDDLELEYDQYKNNENNGV
FSDN------DLESNSVANRNAVNDAKGVKGSKIEYFD--PSDVSLYD------------
NSVSQFEESAVSLKEYYNHSIRSHLTLKGAGDYLKSVFPIINWLPHYNFNWFIADLIAGI
TIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYAYSFFATSKDVCIGPVAVMSLQTAKVI
AEVQAKYPDGDTT-ITGPVIATTLALLCGIISAAVGFLRLGFLVELISLNAVAGFMTGSA
FNILWGQVPALMGYNKLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWWCG
TYGP----RLNDRYNS--KNARLHKIVKWTYFYAQASRNGIIIIVFTCIGW-AITRGKSS
SE--RPISILGSVPSGL---KEVGVFHVPSGLMSKLGPSLPSSIIVLLLEHIAISKSFGR
INDYKVVPDQELIAIGVSNLLGTF-FNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVL
LALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFA
SIEDGIYFAMCWSCAMLLLKVAFPAGKFLGRVEIAEV--TDAYVKADSDAV---SYVSEN
NNRISTLE------ENGEDEKEISAKYITNSSKKIETNVQTKGFASPSSSIGQPRIK---
------------YHTK--------------------------------------------
------------------------------------------------------------
---WLPFDHKYTRELNPDVHILPPPESVLVYRLSESYTYLNCSRHYNIIIDEVKRATRRG
QI-IRHRKKSDRPWNDPGPWEAPAF------LKNLKFWKK---------------KESDL
EFTQNAPNNSIDAERDERPLLKILCLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFH
FVGIISPWVKRGLISRGFGTINEEYSDESIVAGHTSYHVAR----------VPRNKE---
----------NPDKYS-VYTASGTNLPFFHIDIPDFAKWDI--
>Smik_12.151
-----------MSRETYPNLEEVEIPDF----QDTSNTVPDLDDLELEYDQYKNNENNDA
FKDN------DLESNSVAKPNAVGNGKGAKGSKIEYFN--PSDVSLYD------------
NSVSQFEESTVSLKEYYDHSIRSHLTLKGARDYLKSVFPIINWLPHYNFNWFTADLIAGI
TIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMSLQTAKVI
ADVTAKYPDGDPA-ITGPVIATTLALLCGIISAAIGFLRLGFLVELISLNAVAGFMTGSA
FNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWWCG
TYGP----ILNDRYNS--KNPRLHKILKWTYFYAQASRNGVIIVVFTCIGW-AITRGKSK
SE--RPISILGSVPSGL---KEVGVFHVPSGLMSKLGPNLPASIIVLLLEHIAISKSFGR
INDYKVVPDQELIAIGVSNLLGTF-FNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVL
LALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFA
SIEDGIYFAMCWSCAMLLLKMAFPAGKFLGRVEIAEV--TDAYIKANSDAV---SYTSEN
NNGIRTSE------EGDEYEKDSSTKYITNSSKKIETNVQTKSFDSPSSLITQPRMK---
------------YHTK--------------------------------------------
------------------------------------------------------------
---WVPFDHKYTRELNPDIQILPPPEGVLVYRLSESYTYLNCSRHYNIITEKVKEVTRRG
QL-IRHRKKSDRPWNDPGPWEAPAF------LKNLKFWKK---------------RESDS
EFLENAPDNSIGTERDDRPLLKILCLDFSQVAQTDATALQSLVDLRKVINQYADRQVEFH
FVGIISPWVKRGLVSRGFGTLNEEYSDESIVAGHTSYHVAR----------VPQSKE---
----------NSDKYS-VYTASGTNLPFFHIDIPDFAKWDI--
>YLR092W
-----------MSREGYPNFEEVEIPDF----QETNNTVPDLDDLELEYDQYKNNENNDT
FNDK------DLESNSVAKHNAVNSSKGVKGSKIDYFN--PSDVSLYD------------
NSVSQFEETTVSLKEYYDHSIRSHLTVKGACSYLKSVFPIINWLPHYNFSWFTADLIAGI
TIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMSLQTAKVI
ADVTAKYPDGDSA-ITGPVIATTLALLCGIISAAVGFLRLGFLVELISLNAVAGFMTGSA
FNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWWCG
TYGP----RLNDRYNS--KNPRLHKIIKWTYFYAQASRNGIIIIVFTCIGW-AITRGKSK
SE--RPISILGSVPSGL---KEVGVFHVPPGLMSKLGPNLPASIIVLLLEHIAISKSFGR
INDYKVVPDQELIAIGVSNLLGTF-FNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVL
LALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFA
SIEDGIYFAMCWSCAMLILKVAFPAGKFLGRVEVAEV--TDAYVRPDSDVV---SYVSEN
NNGISTLE------DGGEDDKESSTKYVTNSSKKIETNVQTKGFDSPSSSISQPRIK---
------------YHTK--------------------------------------------
------------------------------------------------------------
---WIPFDHKYTRELNPDVQILPPPDGVLVYRLSESYTYLNCSRHYNIITEEVKKVTRRG
QL-IRHRKKSDRPWNDPGPWEAPAF------LKNLKFWKK---------------RENDP
ESMENAPSTSVDVERDDRPLLKILCLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFH
FVGIISPWVKRGLISRGFGTLNEEYSDESIVAGHTSYHVAR----------VPQGEE---
----------NPEKYS-VYTASGTNLPFFHIDIPDFAKWDI--