MUSCLE (3.8) multiple sequence alignment

TBLA0D00840        ---------MSIDYKQIQHERLPTLYEVLIQKSSAPADLWSFYTYLSQFPYAINYLEFWI
KLLA0F24904g       ----------MEKLPNSQRARLPTLYEVLNQQTAAPLDLWSFYTYLSQYPHAIVYLDFWT
AFR532W            ---------METEEWRLQSERLPTLFEVLNNQTAAPVDSWSFYTFLFQYPGALNYMDFWV
Ecym_1476          ---------METEERRFQSERLPTLYEVLTNQTAAPVDSWSFYTFLFQYPGALNYMDFWV
SAKL0B05456g       ---------METESTKLQSDRLPTLYEVLNQQTTTPVDLWSFYTYLSQFPHAINYLDFWI
KLTH0H15070g       ---------MSPASADLYAQRLPTLYEVLNRQTCAPVDLWSFYTFLSQYPYAINFLDFWI
Kwal_34.15943      --------MARPPSEAL--SRLPTLFEVLNRQSAAPVDLWSFYIFLSQYPYAINFLDFWI
Kpol_1010.13       -------MAQVTDFDRIQQERLPTLYEVLIQKTDSPVDLWSFYTFLSQFPHALNYLEFWI
TPHA0G01210        ---------MAIDFEKLQEERLPTLYEVLILKTEKPVDLWSFYTFLSQFPHAINYLEFWI
CAGL0A03828g       ------MPSTAIDFDQIQHQRLPTLYEVFILKTEPPVDLWSFYTYLSQFPYAINYLDFWI
Suva_8.352         -------MNNVEDFEKIQYERLPTLYEVLIQRTSRPVDLWTFYTFLSQFPYAINYLDFWV
Skud_15.468        -------MNSVHDFEELQRVRLPTLYEVLIQRTSQPVDLWTFYTFLSQFPYAINYLDFWI
Smik_15.482        -------MNRVQDFEKIQRERLPTLYEVLIQRTSQPVDLWTFYTFLSQFPYAINYLDFWV
YOR301W            MKEELSKVSSMQNFEMIQRERLPTLYEVLIQRTSQPVDLWTFYTFLSQFPYAINYLDFWV
KNAG0G03100        ---------MDRNFAQIQKERLPTLYEVLIQKSGAPLDLWSFYTYLSQFPFAINYLDFWI
KAFR0D01490        ---------MELDFAKIQEERLPTLYEVLIQKTSVPVDLWSFYTYLSQFPYAINYLDFWI
NDAI0E00630        ---------MELDYKKIQTERLPTLYEVLIQKTKFPVDLWSFYTFLSQFPYAINYLDFWI
NCAS0B00780        ----MVPNKMEPDFEKIQTERLPTLYEVLVQKTRAPVDLWSFYTFLSQFPYAINYLDFWM
ZYRO0F12232g       ---------MEGDFTPIENQRLPTLYEVLLRQTSPPVDLWSFYTFLSQFPYAIDFLDFWI
TDEL0B03350        -----MKDPMEQDYEQIQRERLPTLYEVLIQVTKAPVDSWEFYTYLSQFPYAIDYLDFWI
                                       *****:**:   :  * * * ** :* *:* *: :::** 

TBLA0D00840        DLMNHNRLCRHLINEIKNSLIQNNKNNPHLNEEDLQKIIDKYSNNDILPPSMPLPQAVST
KLLA0F24904g       DVMAYLRLCKDYVKGIRESVLDVNKLETPTVLQEG-------------------------
AFR532W            DVMAHLRLCKDYVKGIRESMMLLEVEEQQGRSRGR-------------------------
Ecym_1476          DVMAHLRLCKDYVRGIRESMLLLEVEEQQQQQKHR-------------------------
SAKL0B05456g       DIMAHLRLCKDYVKGIRESVLVWEEANRPPRIPKH-------------------------
KLTH0H15070g       DAMAHLRLCKDYVKGVRESFVEWEDSQERSGANRD-------------------------
Kwal_34.15943      DVMAHLRLCKDYVKGIRESVIEWEDSLERSGAN---------------------------
Kpol_1010.13       DLMSHIRLCKDYIRGIRESVLIPNEELKSRRQSEV------YEN----------------
TPHA0G01210        DLMAHIRLCKDYLENIRSSVIEVVDESRVSDEYGN---LTTAGD----------------
CAGL0A03828g       DLMAHIRLCKDYVSTVRQSVVQGSALEEFRNLDER-------------------------
Suva_8.352         DLMAHTRLCQSYVKMVRKSLANFPQEHQ--------------------------------
Skud_15.468        DLMAHTRLCQSYVELVRKSLVNYPQEQQ--------------------------------
Smik_15.482        DLMAHTRLCKSYVELVTKSLINFPKE----------------------------------
YOR301W            DLMTHTRLCKNYIELVRKSLINFPQEQQ--------------------------------
KNAG0G03100        DLMAHIRLCKDFIKGVRRSIGEAAERNEEQQGGGG-------------------------
KAFR0D01490        DLMAHLRLSKDYINGIRGSLLEESNFNELENQQSS-------------------------
NDAI0E00630        DLMAHLRLCKDYISGIRESITYNQNEARNSRIRHHLQYTSEESI----------------
NCAS0B00780        DLMTHLRLCKDYVDGIRESLVVNNERQGNSSLLNN-------------------------
ZYRO0F12232g       DLMAHVRLCRDYVRGVKESIEARNSELI--------------------------------
TDEL0B03350        DLMAHIRLCKDYVKGVRESVEFNETIASRNRDEVN-------------------------
                   * * : **..  :  :  *.                                        

TBLA0D00840        PPADFDTIDEVERESLSNMPIPEQDEDIDNDNDSITSSILLNVLMNEGYLNPDDHYRMSK
KLLA0F24904g       --------------------------NGDDKRESVSSAMLLEALMNDGYLDYNDSQRVSQ
AFR532W            ------------------------PAGSTEKRQSLSSSVLLDALLNDGYLDYHDNRRISQ
Ecym_1476          ---------QKRHSQVSAAGSDAAADNNNNNRMSVSSSLLLDALLNDGYLDYHDNKRISQ
SAKL0B05456g       -----------------------DSGVSDNYRSSVSTSLLLEALMNDGVLDFQDSKRVSQ
KLTH0H15070g       ------------------------SRDSHDNRDSLSSSLLLEALMNDGFLDYEDSKRVSR
Kwal_34.15943      ----------------------------RDSRDSLSSSLLLEALMNDGYLDYEDSKRVSR
Kpol_1010.13       -------VERNVIETENDIEQPNKENNGDQDNISVTSSILIDALMDEGYLDFQNPQKVNR
TPHA0G01210        -------HRKHKEESSSDRYGPGGNDGDADDSASVTSSLLINALMNEGYLDFQDPDQVNR
CAGL0A03828g       --------------------SNVNRHMNNDEDASVTTSILMNTLLSEGYLDFENPEKVSQ
Suva_8.352         ----------------------------QKGDGSATTFNLLDALIEEGHLNLQSPENLLQ
Skud_15.468        ----------------------------ENGGASVKTHDLLSALVEEGHLDPETPEKLLQ
Smik_15.482        -----------------------------NGGASTTTLDLLNALIEEGHLDLEAPGRLLK
YOR301W            ----------------------------QNGSTSTATFDLLNALIEEGHLDPEAPDKLLE
KNAG0G03100        ----------------------------ADDTASVTTSVLMQTIMEEAQLDLNRPDDVYS
KAFR0D01490        ----------------------QEDQNSNSENVSVTTSVLLNALMEEGHLDFENPDRVSK
NDAI0E00630        -------QHETQSIQHHDDPEGGDEDDDDDDNISVTTSVLLNALLDEGHLDFENPERVSQ
NCAS0B00780        -------------------EHAQQVEADADDSASVRTSVLLNALLEEGHFDLTNPAGVSQ
ZYRO0F12232g       ----------------------------ADDAHSDESNVLLDALLTEGYLDFKNARRVSQ
TDEL0B03350        ---------------------------IEDDNESVSSSVLLDALLNEGYLDFQNTKRVSQ
                                                .   *  :  *:..:: :. ::      :  

TBLA0D00840        F-------------FQGNIGGSNDYRMSQLMQNWQ-RHNDNSNSNNTRQTNTGETNNAGN
KLLA0F24904g       F-------------LKGETD-SP--RLSQLLQDWK-QVN---------------------
AFR532W            F-------------LKGDGE-SA--RLSQLFEG---RGGDSSGEKAP-------------
Ecym_1476          F-------------LKGEAD-SD--RFSQLLENLP--HGAEGGEGN----NKGYDGEEPG
SAKL0B05456g       F-------------LQGQTD-SP--RLSQLMENWK-RQSAL-------------------
KLTH0H15070g       F-------------LQGQTD-SP--RLTKLLDNWQ-KQTEHDSDA---------------
Kwal_34.15943      F-------------LQGHTD-SP--RLTRLLDNWQ-KHADQDSAGA--------------
Kpol_1010.13       F-------------LQGDLEYSP--QLSQLLDDWK-RHSGYIDHSN----DDSYASS---
TPHA0G01210        F-------------LQGDIEYSP--QLSQLLAEWR-RHSGIPGKRN----DDVNESEIDE
CAGL0A03828g       F-------------LQGNTHTSP--MVTRMIQDWK-LHNERNSVAA----TSHLQSTQAG
Suva_8.352         N-------------EPSDVPFSP--KLNEMLGNWK-HHSGISQDA---------------
Skud_15.468        N-------------SGPDLPFSP--KLNQLLEGWK-RQSGISEDS---------------
Smik_15.482        S-------------DGQDMPFSP--KLNQLLGDWK-RQSGMSQDS---------------
YOR301W            N-------------SGPDVPFSP--KLNELLGDWK-HQSGIGQEA---------------
KNAG0G03100        FFRNSHQQDGLGDNLRASSRYSA--RVSQMLDEWNGRTSHRYTGHS----VD--------
KAFR0D01490        F-------------LQGKADYSP--KLSQLLDGWK-RHSGIYDANNNLN-----------
NDAI0E00630        F-------------LQGNTEYSP--KLSQLLEDWK-RHSIANNDSN----RKGSLNRNNS
NCAS0B00780        L-------------LQGQVNHSP--KLAQLIDDWN-RHSQNVDDSN----RNRSSNNNSN
ZYRO0F12232g       F-------------LRGNVEESM--RISRLLDTFK-QDHRLSTQSD----R---------
TDEL0B03350        F-------------LQGDTNDSP--RVSRLVDGWK-RQSGIAD-----------------
                                        *    .  :.                             

TBLA0D00840        NSNSNSYTNNTTERFAAMVDELLQNNRIPMPSPILPNTQENIQEQEDQANASSSSFLNGL
KLLA0F24904g       ---------NDQIDFSDFVDGLVKS-----------------NVTKDH----KPK----L
AFR532W            ---------TEEPHLSLMLDEFLVR-----------------QMKESQ----RPK----L
Ecym_1476          HGDYAT---AEDAHLSVMLDEYLVR-----------------QMKESQ----RPK----L
SAKL0B05456g       ---------EDNDRLTEVLDDFLKQ-----------------EMKESQ----QPR----I
KLTH0H15070g       ---------PFKSPLTGLVDEFLKT-----------------QAQDFQ----KAR----I
Kwal_34.15943      ---------PFKSPLTGLVDDFLKT-----------------QAHDFH----KAR----I
Kpol_1010.13       ---------GKDNKIVSAVDGLLQN---------------YTKMHQE-----RPQ----V
TPHA0G01210        NTGEKKNQVGYENKILSAIDDLLKN---------------HVSGQNNAGETIKPQ----I
CAGL0A03828g       IDISRK---ESMQSVSAIVDEFLKR-----------------QSQLGE----KGN----I
Suva_8.352         ---------LQNEDMALILDEILKR-----------------RSQQDG----VPQ----I
Skud_15.468        ---------LRNEDMTLIVDEILKR-----------------RSQQDG----VPQ----I
Smik_15.482        ---------LRRDDIALIVDEILKR-----------------RSQQDG----IPQ----I
YOR301W            ---------LRNEDVALIVDEIMKR-----------------RSQQDG----KPQ----I
KNAG0G03100        ---------ISNGNLTTLMDEFLNE---------------HSKTRGDG----GAY----I
KAFR0D01490        ---------IDNGNLPTLLDEMLKN-----------------KSKRNE----TSQ----I
NDAI0E00630        NVRSRE---TNGAALPDVVDDILRK-----------------QSQQEE----RAK----I
NCAS0B00780        ---------SNNNNLSSILDDILKR-----------------QSQLEE----KPK----V
ZYRO0F12232g       ---------EADEFLAAMVDDMLKQ-----------------KIHKDK----QPK----M
TDEL0B03350        ---------GQNHPLALMVDEMLRK-----------------ETRKLK----QPK----I
                                 .   :*  :                                    :

TBLA0D00840        TTRDLIKNARNICNLYLISPE--KSKKYLINIPETIKFDIIKKIKFENRFDPLIFDDLQN
KLLA0F24904g       TTKQLISSAQDIVSTYLLSQE--QSDRFLFEIPAYLRNDTIRLIMEEKRHDPEVFEPIKE
AFR532W            TTKQLVASANTIVDRYLVSKDSMRSERLLTTVPEHMRLEVINLVKGEQRYDPDVFEPLKI
Ecym_1476          TTKQLIASANAIVDRYLVAKDNMRSERLLTSVPEHMRLEVINMVKGEQRYDPDVFEPLKI
SAKL0B05456g       TTKQLLNNALQIVNMYLSSPQ--QSPKFLVNVPEKIRLDAIHTVQVQQRHDPDVFESLKS
KLTH0H15070g       TSKELLNNARNIVHTYLLAPE--ESSRYLINLPDHMRQNAVHMVLEEKRHDPDVFEQLKA
Kwal_34.15943      TSKELLNNAQNIVNTYLLSPE--TSVRYLINLPDHMRENTLRMVRDEKRHDPELFEQLKS
Kpol_1010.13       TAKLLLQNAQTICSLYLISPE--KSEKYLINVPEHIRNETLQLVEIGGRHDPEVFESMRS
TPHA0G01210        TTKQLHHNAAQICTLYLLSPE--RSDKYLINIPEHVREDTLKAIQNDKRYDPDVFEELKN
CAGL0A03828g       TTKQLYNNAQQICNTYLMSQQ--HSPRYLANIPDDLKNQVIHNFKANRRHDPEVFRELKE
Suva_8.352         TTKQLLHSAMGLCTTYLVSPE--QSERYLSNIPAETRTRILEDIQVDRKYDVAIFDDVKA
Skud_15.468        TTKQLLHSAMGLCTTYLASSE--QRERYLSNIPTETRNRIVKDVQVKRRYDIEVFDDVKN
Smik_15.482        TTKQLFHSAVGLCNTYLVSPE--QSERYLSNIPTETRNRIIEDIQVQQKYDIEVFDDIKN
YOR301W            TTKQLLHSAVGLCNTYLVSPE--QSERYLSNIPMETRNRIIESVQIERKYDIEIFDDLKN
KNAG0G03100        TTKQLLHNATHMCRTYLISRE--ESERYLTNIPTEIREYILVGVLDAKKYDPGIFDDLKT
KAFR0D01490        TTKQLLNNALQICNTYLYSTE--KSAKYLSNISEETRMKVLDSVVNQNRYDPEVFEELKA
NDAI0E00630        TTKQLLNNALKICSIYLQSPE--RSERYLTNLPDDIRLKALNLVQNERRHDPQVFEELKS
NCAS0B00780        TTKQLLNSALKICSLYLLSPE--QSERYLTNIPDEVRLKAVNLIQRNSRHDPEVFDELKS
ZYRO0F12232g       TRKQLINNASQICRQYLLSPQ--ESPRYLINVPDEIRMKALHAVQSERRFDPELFEDLRN
TDEL0B03350        TRKQLVNNALQICNIYLLKSA--EDNKYLINVPERVKNQVLYDVQQEQRHDPAVFEPLKT
                   * . *  .*  :   **         . *  :.   .   :  .    ..*  :*  :. 

TBLA0D00840        LTYNFLEVDCFPKFLSKIALHNIHDQISDWRFHSSFKLTSQNRKSNRGLSENDNSSSTDN
KLLA0F24904g       IVYQFLEVDCFPRFLGCVALHNLHDEIV--------------------------------
AFR532W            ISFQFLEIYCFPKFLSSVALHNLHYDIS--------------------------------
Ecym_1476          ISFQFLEIYCFPKFLSSVALHNLHYDVS--------------------------------
SAKL0B05456g       VAFQFLEMDCFPKFLGCVALHNLHDDMTD-------------------------------
KLTH0H15070g       ISFQFLEMDCFPKFLSCVALHNLHDDITSSSLS------------DPLAI----------
Kwal_34.15943      LAFQFLEMDCFPKFLTSVALHNLHDDITT----------------PPLTA----------
Kpol_1010.13       LAYQFLEIDCFSKFLNRVALHNIHDQISDWKYHPVKPHSHNDNNTEKKQPKKNLKIFGMN
TPHA0G01210        ISYQFLEIDCFTKFLGRVALHNLHDQISDWRFHNSS---------TRFLP----------
CAGL0A03828g       VTYQFLETDCFPKFLKEVALHNIHDELSDWRFHPSNKNP------HRTSS----------
Suva_8.352         LTYQFLEMDCFPKFLSRVALHNIHDEISDWRFH---------------------------
Skud_15.468        LAYQFLEMDCFPKFLSRVALHNIHDEISDWRFH------------S-VGA----------
Smik_15.482        LTYQFLEMDCFPKFLSRVALHNIHDEISDWRFH------------S-VNA----------
YOR301W            LTYQFLEMDCFPKFLSRVALHNIHDEISDWRFH------------S-VGV----------
KNAG0G03100        LTYQFLEIDCFPKFLSQVALHNLHDEISNWRFNKLDSTKYSGGGGALTGD----------
KAFR0D01490        TTYQLLETDCFPKFLSTVALHNIHDELSDWRFH------------SEKGA----------
NDAI0E00630        IAFQFLEMDCFPKFLSTVALHNIHDEISDWRFH------------SNARS----------
NCAS0B00780        VSYQFLEIDCFPKFLSTVALHNIHDEISDWRFHAH----------STGGN----------
ZYRO0F12232g       LSYDFLEMDCFPKFLNRVALHNLHDQLSDWRFQ------------T-TAA----------
TDEL0B03350        VAYQFLEIDCFPKFLSTVALHNIHDQISNWRYQ---------------------------
                     :::**  **..**  :****:* ::                                 

TBLA0D00840        EKNYQSDNDDNDSMIYNIDNHISRSPFSNYTIISRLFVGFIWLGIGFWIGYTLIFLNYSR
KLLA0F24904g       ---LQRPKKNKSY------NSRSNSPFSQWSTASRLTIGLAWWLVGLWIGYTLIFMNYSK
AFR532W            -----------------LSQKASRSPYSQCTTLARVATGFFFWAVGFWVGYSLIFLDYPR
Ecym_1476          -----------------LTQKTRTSPYSQCTTLSRVATGFFFWGIGFWVGYTLIFLDYNR
SAKL0B05456g       ---HSSPLGGKTA---TTQRHRKSSLFSTYTILSRVFLGLLLLGIGFWIGYVLIFLDYSR
KLTH0H15070g       ---LGSSAPG-----------RRRSLFARYTTLSRVVLGMIFLWMGLWLGYTLVFLNYSR
Kwal_34.15943      ---PQTPAHEPSF-------TRRHSPFAHHTTLSRVALGMLFLWMGLWLGYTLIFLDYSR
Kpol_1010.13       ---LSNASDDESVNEVEYSRHQSRSPFSNYTTISRICFGTFWMGIGFWIGYVLIFLNYNR
TPHA0G01210        ---NEETHEKKKQ-----LRHHSRSLFSSYTTLSRVMLGLFFMGIGFWIGYALIFLNYAR
CAGL0A03828g       ---PSGSKENLNGHKQLMQNHISWSPFSTYTSLSRVLFGCMWMGIGFWIGYVLIFLHYSR
Suva_8.352         -----SKNSRSRG-----QTHISRSPFSNHTSISRIGLGLLWLGIGFWIGYVLIFLAYGR
Skud_15.468        ---TNEKNKRVRG-----QTHISRSPFSNHTSISRIGFGLLWLGIGFWIGYVLIFLAYSR
Smik_15.482        ---TNEKGKRFRG-----QAHISRSPFSNHTSISRIGFGLLWLGIGFWIGYVLIFLAYGR
YOR301W            ---TNEKSNRSRG-----QTHISRSPFSNHTSISRIGFGLLWLGIGFWIGYVLIFLAYSR
KNAG0G03100        ---PEKDAVGYRG---------AHTPFSNYTTLSRILFGLLWLGIGFWIGYTLIFLKYSR
KAFR0D01490        ---IDNTTLRYRG---------SRSPFSNHTTLSRLIFGLVWLGIGFWIGYVLIFLKYSR
NDAI0E00630        ---HNLTRVDKSL--IKNHDHISKSPFSTYTLLSRTIFGLLWLGIGFWIGYTLIFLKYDR
NCAS0B00780        ---RNKSQASLTEKDLESMRHISKSPFSTYTTLSRIMFGLLWLGVGFWIGYTLIFLKYDR
ZYRO0F12232g       ---IGKSKGDIRG-------QRSASPLSTYSGLGRIALGLCWLGIGFWIGYVLIFLHYSR
TDEL0B03350        ----------SPG----LRRHRSKSPFSNYTVLSRVLIGLIWLGIGFWIGYTLIFLHYSR
                                           :  :  :  .*   *     :*:*:** *:*: * .

TBLA0D00840        GIRVTTLPPFLFGCYYIICGLYQLDIFYSLFGVTQDLMFQPKRNLLHANKKIDKTTKKNL
KLLA0F24904g       GIRVVCIVPFFLGSYYIICGIYLVDIIYAFSGVTQTLVSKRKLDDLELRSMNNHRSNSL-
AFR532W            RVRTVTLVPFLIGSYYIVCGVYHLDIIYAVCGVTQTLISPRRYEEPELGLDQKQNSAT--
Ecym_1476          KVRTVTLLPFFVGCYYIVCGIYHLDIIYAICGVTQTLVSPRRFAEPELGLKKSKTNSA--
SAKL0B05456g       GIRVVTIVPFFLGFYYVVCGIYQLDVVYALFGVTQNLVTNKDKRDLELGYQRNSSKSSNV
KLTH0H15070g       GIRVTTIVPFFLGFYFIWCGIYKIDILYALCGVTQTLVSNELVSSKDLEIGLNRNAVHN-
Kwal_34.15943      GIRVTTIVPFFLGFYFICCGIYRIDILYALAGVTQTLVSNEQVSLKDLEIGLNRNSVNH-
Kpol_1010.13       GIRVVTIVPFAIGSYFIVCGIYQVDVVYSWFGVTQELMFRHKSSDEENGHPMNLDKNNK-
TPHA0G01210        GIRVVTIVPFIIGSYFIVCGIYQIDIAYACFGITQELMYKHKRSPDEETNHSDNLEAKD-
CAGL0A03828g       AIRVTTVVPFGLGCYYIVCGIYQVDIIYSWFGLTQRLMYSHKKGNIEEGRQVYGATYND-
Suva_8.352         AIRVVTVVPFALGCYCVVCGMYQVDIVYSWFGVTQRLLHRHKNSNDDAGAATDAD-----
Skud_15.468        AIRVVTVVPFALGCYCIVCGMYQVDIVYSWFGVTQRLLHRHKDGSDNEDDSSEDFD----
Smik_15.482        AIRVVTVVPFALGCYCIVCGMYQVDIVYSWFGVTQRLLHRHKNSSSDQDGVSAGSD----
YOR301W            AIRVVTVVPFTLGCYCIVCGMYQVDIVYSWFGVTQRLLHRHKNAGNDEGDASSDTD----
KNAG0G03100        AIRVVTVVPFALGCYYCICGLYQVDIIYSIFGVTQRLLQRETAAAGEDPPTHTDATTA--
KAFR0D01490        AIRVVTVVPFAIGCYLIICGMYQVDIIYSWFGVTQVLTYKDSDSKILRSNDEEHTTTKE-
NDAI0E00630        GIRVVTIVPFAIGNYFIICGMYRVDIIYSWFGVTQRLLYKHNEKNRDADREVQMDEKNGK
NCAS0B00780        GIRVVTIVPFCIGSYFVVCGLYQVDILYSWFGITQRLLYKDRKVTEDGYDGNVPVDVKE-
ZYRO0F12232g       AIRVTTIVPFGIGCYFSVCGIYQVDILYSWFGVTQRLMYEKKLPSDREEDVPKSRT----
TDEL0B03350        AIRVVTIVPFALGSYSIVCGLYQVDILYAFFGLTQALMYQEKDGSQT--DRKHSHDYS--
                    :*.. : ** .* *   **:* :*: *:  *:** *                       

TBLA0D00840        KHLKRGIPFFFNLFGGKKRLIKIDHPYIRNLLFKRG----------IW--CAILVALSTA
KLLA0F24904g       -HSSNEVPWWLTIFGGRSRLCKVKHPFVNSIMIRRA----------LW--CLLLVLIMTA
AFR532W            -----KVPFFFTFLGGRKRLTKVRHPFVLNIMRKRA----------LW--CLFLVIVTTA
Ecym_1476          -----KVPLLFSLLGGRNRLTKVRHPFVLNIMRKRA----------LW--CLFLVLVTTA
SAKL0B05456g       R----RLPVIFRVLGGRGRLVKVRHPFVDRILKRRS----------VW--CWFLILLGTA
KLTH0H15070g       -KTRQSTSPVFRVFGGSSRLVSIQQPFVNSMLRRRA----------LW--CLVLVLAGTA
Kwal_34.15943      -RMSHNAPFVFRILGGTGRLVRIKHPFINKLLKKRG----------YW--CLLLVLTLTG
Kpol_1010.13       -----GVPGILKVLGGKSRLIRIDHQFIRNLLFKRG----------LW--CCAIITISTA
TPHA0G01210        -G---EISGLFKILGGQTRLIKIKHPFIRNLIYKRG----------LW--CLLWVLISTG
CAGL0A03828g       -----DVPLIFTLLGGKSRLIHIEHPFIKKILYKRG----------LW--CLTLVVIFTA
Suva_8.352         -----HVPGVLAVFGGKSRLTSVQHPFTRRLLRKRGGRAHSDFQLRSWSSCVMSPWPVHR
Skud_15.468        -----HVPAIL-----KSRLTCVQHPFIRQLLRKRG----------LW--CLLLVVGATA
Smik_15.482        -----HVPVLLAVFGGKRRLTRVKHPFTRQLLRKRG----------LW--CLLLVVGATA
YOR301W            -----HVPMILAVFGGRRRLTRIEHPFTRQLLRKRG----------LW--CLLLVVGATA
KNAG0G03100        -----KVPSLLVLFGGRGRLLKIEHEFTRRLLLRRG----------LW--CLLLVTFSTA
KAFR0D01490        -----KVPFLIALLGGGKRTVKIEHTFIKKLLQRRG----------LW--CLLLVVISTA
NDAI0E00630        NH---HVSGILALLGGRSRLIRIEHPFIKNILMKRG----------LW--CLFLVLLSTG
NCAS0B00780        -SKD-KIPFIFGILGGRNRLIEVKHPFIRKFLFQRG----------LW--CCLLVLISTG
ZYRO0F12232g       -----RVPTIFALLGGRSRLMPVHHPFIKKLLLRRG----------MW--CFLLVVVSTA
TDEL0B03350        -----EIPTIFKLLGGRSRLIKIQHDFIKKLLWKRA----------LW--CGFLTTLATA
                          .  :       *   : : :   :: .*.           *  *         

TBLA0D00840        GLTVI------------FSVVPGWRV----------------------
KLLA0F24904g       ILTAI------------FAAVPGRRI----------------------
AFR532W            VLTVI------------FTAVPSVRL----------------------
Ecym_1476          VLTTI------------FTAVPSTRL----------------------
SAKL0B05456g       IFTVI------------FSCVPGHRL----------------------
KLTH0H15070g       IFTVI------------FSCVPGHRL----------------------
Kwal_34.15943      VFTVI------------FSCVPGRRL----------------------
Kpol_1010.13       IFTVI------------FSCVPGRRV----------------------
TPHA0G01210        VFTVI------------FACVPSRRV----------------------
CAGL0A03828g       IFTVI------------FCCVPGRRL----------------------
Suva_8.352         TVTAARDAKCRKRRGGGVKCRPRRRRPALPAKGCLTHPIHRIALAHDE
Skud_15.468        AFTVI------------FSCVPGRRV----------------------
Smik_15.482        AFTVI------------FSCVPGRRV----------------------
YOR301W            AFTVI------------FSCVPGRRV----------------------
KNAG0G03100        AFTVI------------FSCVPGYRV----------------------
KAFR0D01490        IFTVI------------FSCVPGFRI----------------------
NDAI0E00630        IFTVI------------FSCVPGYRI----------------------
NCAS0B00780        VFTVV------------FSCVPGHRV----------------------
ZYRO0F12232g       VLTVL------------FSCVPGKRI----------------------
TDEL0B03350        ILTVI------------FSCVPGYRL----------------------
                    .*.             .   *  *                       

FASTA FORMAT for MUSCLE Version 3.6

>TBLA0D00840
---------MSIDYKQIQHERLPTLYEVLIQKSSAPADLWSFYTYLSQFPYAINYLEFWI
DLMNHNRLCRHLINEIKNSLIQNNKNNPHLNEEDLQKIIDKYSNNDILPPSMPLPQAVST
PPADFDTIDEVERESLSNMPIPEQDEDIDNDNDSITSSILLNVLMNEGYLNPDDHYRMSK
F-------------FQGNIGGSNDYRMSQLMQNWQ-RHNDNSNSNNTRQTNTGETNNAGN
NSNSNSYTNNTTERFAAMVDELLQNNRIPMPSPILPNTQENIQEQEDQANASSSSFLNGL
TTRDLIKNARNICNLYLISPE--KSKKYLINIPETIKFDIIKKIKFENRFDPLIFDDLQN
LTYNFLEVDCFPKFLSKIALHNIHDQISDWRFHSSFKLTSQNRKSNRGLSENDNSSSTDN
EKNYQSDNDDNDSMIYNIDNHISRSPFSNYTIISRLFVGFIWLGIGFWIGYTLIFLNYSR
GIRVTTLPPFLFGCYYIICGLYQLDIFYSLFGVTQDLMFQPKRNLLHANKKIDKTTKKNL
KHLKRGIPFFFNLFGGKKRLIKIDHPYIRNLLFKRG----------IW--CAILVALSTA
GLTVI------------FSVVPGWRV----------------------
>KLLA0F24904g
----------MEKLPNSQRARLPTLYEVLNQQTAAPLDLWSFYTYLSQYPHAIVYLDFWT
DVMAYLRLCKDYVKGIRESVLDVNKLETPTVLQEG-------------------------
--------------------------NGDDKRESVSSAMLLEALMNDGYLDYNDSQRVSQ
F-------------LKGETD-SP--RLSQLLQDWK-QVN---------------------
---------NDQIDFSDFVDGLVKS-----------------NVTKDH----KPK----L
TTKQLISSAQDIVSTYLLSQE--QSDRFLFEIPAYLRNDTIRLIMEEKRHDPEVFEPIKE
IVYQFLEVDCFPRFLGCVALHNLHDEIV--------------------------------
---LQRPKKNKSY------NSRSNSPFSQWSTASRLTIGLAWWLVGLWIGYTLIFMNYSK
GIRVVCIVPFFLGSYYIICGIYLVDIIYAFSGVTQTLVSKRKLDDLELRSMNNHRSNSL-
-HSSNEVPWWLTIFGGRSRLCKVKHPFVNSIMIRRA----------LW--CLLLVLIMTA
ILTAI------------FAAVPGRRI----------------------
>AFR532W
---------METEEWRLQSERLPTLFEVLNNQTAAPVDSWSFYTFLFQYPGALNYMDFWV
DVMAHLRLCKDYVKGIRESMMLLEVEEQQGRSRGR-------------------------
------------------------PAGSTEKRQSLSSSVLLDALLNDGYLDYHDNRRISQ
F-------------LKGDGE-SA--RLSQLFEG---RGGDSSGEKAP-------------
---------TEEPHLSLMLDEFLVR-----------------QMKESQ----RPK----L
TTKQLVASANTIVDRYLVSKDSMRSERLLTTVPEHMRLEVINLVKGEQRYDPDVFEPLKI
ISFQFLEIYCFPKFLSSVALHNLHYDIS--------------------------------
-----------------LSQKASRSPYSQCTTLARVATGFFFWAVGFWVGYSLIFLDYPR
RVRTVTLVPFLIGSYYIVCGVYHLDIIYAVCGVTQTLISPRRYEEPELGLDQKQNSAT--
-----KVPFFFTFLGGRKRLTKVRHPFVLNIMRKRA----------LW--CLFLVIVTTA
VLTVI------------FTAVPSVRL----------------------
>Ecym_1476
---------METEERRFQSERLPTLYEVLTNQTAAPVDSWSFYTFLFQYPGALNYMDFWV
DVMAHLRLCKDYVRGIRESMLLLEVEEQQQQQKHR-------------------------
---------QKRHSQVSAAGSDAAADNNNNNRMSVSSSLLLDALLNDGYLDYHDNKRISQ
F-------------LKGEAD-SD--RFSQLLENLP--HGAEGGEGN----NKGYDGEEPG
HGDYAT---AEDAHLSVMLDEYLVR-----------------QMKESQ----RPK----L
TTKQLIASANAIVDRYLVAKDNMRSERLLTSVPEHMRLEVINMVKGEQRYDPDVFEPLKI
ISFQFLEIYCFPKFLSSVALHNLHYDVS--------------------------------
-----------------LTQKTRTSPYSQCTTLSRVATGFFFWGIGFWVGYTLIFLDYNR
KVRTVTLLPFFVGCYYIVCGIYHLDIIYAICGVTQTLVSPRRFAEPELGLKKSKTNSA--
-----KVPLLFSLLGGRNRLTKVRHPFVLNIMRKRA----------LW--CLFLVLVTTA
VLTTI------------FTAVPSTRL----------------------
>SAKL0B05456g
---------METESTKLQSDRLPTLYEVLNQQTTTPVDLWSFYTYLSQFPHAINYLDFWI
DIMAHLRLCKDYVKGIRESVLVWEEANRPPRIPKH-------------------------
-----------------------DSGVSDNYRSSVSTSLLLEALMNDGVLDFQDSKRVSQ
F-------------LQGQTD-SP--RLSQLMENWK-RQSAL-------------------
---------EDNDRLTEVLDDFLKQ-----------------EMKESQ----QPR----I
TTKQLLNNALQIVNMYLSSPQ--QSPKFLVNVPEKIRLDAIHTVQVQQRHDPDVFESLKS
VAFQFLEMDCFPKFLGCVALHNLHDDMTD-------------------------------
---HSSPLGGKTA---TTQRHRKSSLFSTYTILSRVFLGLLLLGIGFWIGYVLIFLDYSR
GIRVVTIVPFFLGFYYVVCGIYQLDVVYALFGVTQNLVTNKDKRDLELGYQRNSSKSSNV
R----RLPVIFRVLGGRGRLVKVRHPFVDRILKRRS----------VW--CWFLILLGTA
IFTVI------------FSCVPGHRL----------------------
>KLTH0H15070g
---------MSPASADLYAQRLPTLYEVLNRQTCAPVDLWSFYTFLSQYPYAINFLDFWI
DAMAHLRLCKDYVKGVRESFVEWEDSQERSGANRD-------------------------
------------------------SRDSHDNRDSLSSSLLLEALMNDGFLDYEDSKRVSR
F-------------LQGQTD-SP--RLTKLLDNWQ-KQTEHDSDA---------------
---------PFKSPLTGLVDEFLKT-----------------QAQDFQ----KAR----I
TSKELLNNARNIVHTYLLAPE--ESSRYLINLPDHMRQNAVHMVLEEKRHDPDVFEQLKA
ISFQFLEMDCFPKFLSCVALHNLHDDITSSSLS------------DPLAI----------
---LGSSAPG-----------RRRSLFARYTTLSRVVLGMIFLWMGLWLGYTLVFLNYSR
GIRVTTIVPFFLGFYFIWCGIYKIDILYALCGVTQTLVSNELVSSKDLEIGLNRNAVHN-
-KTRQSTSPVFRVFGGSSRLVSIQQPFVNSMLRRRA----------LW--CLVLVLAGTA
IFTVI------------FSCVPGHRL----------------------
>Kwal_34.15943
--------MARPPSEAL--SRLPTLFEVLNRQSAAPVDLWSFYIFLSQYPYAINFLDFWI
DVMAHLRLCKDYVKGIRESVIEWEDSLERSGAN---------------------------
----------------------------RDSRDSLSSSLLLEALMNDGYLDYEDSKRVSR
F-------------LQGHTD-SP--RLTRLLDNWQ-KHADQDSAGA--------------
---------PFKSPLTGLVDDFLKT-----------------QAHDFH----KAR----I
TSKELLNNAQNIVNTYLLSPE--TSVRYLINLPDHMRENTLRMVRDEKRHDPELFEQLKS
LAFQFLEMDCFPKFLTSVALHNLHDDITT----------------PPLTA----------
---PQTPAHEPSF-------TRRHSPFAHHTTLSRVALGMLFLWMGLWLGYTLIFLDYSR
GIRVTTIVPFFLGFYFICCGIYRIDILYALAGVTQTLVSNEQVSLKDLEIGLNRNSVNH-
-RMSHNAPFVFRILGGTGRLVRIKHPFINKLLKKRG----------YW--CLLLVLTLTG
VFTVI------------FSCVPGRRL----------------------
>Kpol_1010.13
-------MAQVTDFDRIQQERLPTLYEVLIQKTDSPVDLWSFYTFLSQFPHALNYLEFWI
DLMSHIRLCKDYIRGIRESVLIPNEELKSRRQSEV------YEN----------------
-------VERNVIETENDIEQPNKENNGDQDNISVTSSILIDALMDEGYLDFQNPQKVNR
F-------------LQGDLEYSP--QLSQLLDDWK-RHSGYIDHSN----DDSYASS---
---------GKDNKIVSAVDGLLQN---------------YTKMHQE-----RPQ----V
TAKLLLQNAQTICSLYLISPE--KSEKYLINVPEHIRNETLQLVEIGGRHDPEVFESMRS
LAYQFLEIDCFSKFLNRVALHNIHDQISDWKYHPVKPHSHNDNNTEKKQPKKNLKIFGMN
---LSNASDDESVNEVEYSRHQSRSPFSNYTTISRICFGTFWMGIGFWIGYVLIFLNYNR
GIRVVTIVPFAIGSYFIVCGIYQVDVVYSWFGVTQELMFRHKSSDEENGHPMNLDKNNK-
-----GVPGILKVLGGKSRLIRIDHQFIRNLLFKRG----------LW--CCAIITISTA
IFTVI------------FSCVPGRRV----------------------
>TPHA0G01210
---------MAIDFEKLQEERLPTLYEVLILKTEKPVDLWSFYTFLSQFPHAINYLEFWI
DLMAHIRLCKDYLENIRSSVIEVVDESRVSDEYGN---LTTAGD----------------
-------HRKHKEESSSDRYGPGGNDGDADDSASVTSSLLINALMNEGYLDFQDPDQVNR
F-------------LQGDIEYSP--QLSQLLAEWR-RHSGIPGKRN----DDVNESEIDE
NTGEKKNQVGYENKILSAIDDLLKN---------------HVSGQNNAGETIKPQ----I
TTKQLHHNAAQICTLYLLSPE--RSDKYLINIPEHVREDTLKAIQNDKRYDPDVFEELKN
ISYQFLEIDCFTKFLGRVALHNLHDQISDWRFHNSS---------TRFLP----------
---NEETHEKKKQ-----LRHHSRSLFSSYTTLSRVMLGLFFMGIGFWIGYALIFLNYAR
GIRVVTIVPFIIGSYFIVCGIYQIDIAYACFGITQELMYKHKRSPDEETNHSDNLEAKD-
-G---EISGLFKILGGQTRLIKIKHPFIRNLIYKRG----------LW--CLLWVLISTG
VFTVI------------FACVPSRRV----------------------
>CAGL0A03828g
------MPSTAIDFDQIQHQRLPTLYEVFILKTEPPVDLWSFYTYLSQFPYAINYLDFWI
DLMAHIRLCKDYVSTVRQSVVQGSALEEFRNLDER-------------------------
--------------------SNVNRHMNNDEDASVTTSILMNTLLSEGYLDFENPEKVSQ
F-------------LQGNTHTSP--MVTRMIQDWK-LHNERNSVAA----TSHLQSTQAG
IDISRK---ESMQSVSAIVDEFLKR-----------------QSQLGE----KGN----I
TTKQLYNNAQQICNTYLMSQQ--HSPRYLANIPDDLKNQVIHNFKANRRHDPEVFRELKE
VTYQFLETDCFPKFLKEVALHNIHDELSDWRFHPSNKNP------HRTSS----------
---PSGSKENLNGHKQLMQNHISWSPFSTYTSLSRVLFGCMWMGIGFWIGYVLIFLHYSR
AIRVTTVVPFGLGCYYIVCGIYQVDIIYSWFGLTQRLMYSHKKGNIEEGRQVYGATYND-
-----DVPLIFTLLGGKSRLIHIEHPFIKKILYKRG----------LW--CLTLVVIFTA
IFTVI------------FCCVPGRRL----------------------
>Suva_8.352
-------MNNVEDFEKIQYERLPTLYEVLIQRTSRPVDLWTFYTFLSQFPYAINYLDFWV
DLMAHTRLCQSYVKMVRKSLANFPQEHQ--------------------------------
----------------------------QKGDGSATTFNLLDALIEEGHLNLQSPENLLQ
N-------------EPSDVPFSP--KLNEMLGNWK-HHSGISQDA---------------
---------LQNEDMALILDEILKR-----------------RSQQDG----VPQ----I
TTKQLLHSAMGLCTTYLVSPE--QSERYLSNIPAETRTRILEDIQVDRKYDVAIFDDVKA
LTYQFLEMDCFPKFLSRVALHNIHDEISDWRFH---------------------------
-----SKNSRSRG-----QTHISRSPFSNHTSISRIGLGLLWLGIGFWIGYVLIFLAYGR
AIRVVTVVPFALGCYCVVCGMYQVDIVYSWFGVTQRLLHRHKNSNDDAGAATDAD-----
-----HVPGVLAVFGGKSRLTSVQHPFTRRLLRKRGGRAHSDFQLRSWSSCVMSPWPVHR
TVTAARDAKCRKRRGGGVKCRPRRRRPALPAKGCLTHPIHRIALAHDE
>Skud_15.468
-------MNSVHDFEELQRVRLPTLYEVLIQRTSQPVDLWTFYTFLSQFPYAINYLDFWI
DLMAHTRLCQSYVELVRKSLVNYPQEQQ--------------------------------
----------------------------ENGGASVKTHDLLSALVEEGHLDPETPEKLLQ
N-------------SGPDLPFSP--KLNQLLEGWK-RQSGISEDS---------------
---------LRNEDMTLIVDEILKR-----------------RSQQDG----VPQ----I
TTKQLLHSAMGLCTTYLASSE--QRERYLSNIPTETRNRIVKDVQVKRRYDIEVFDDVKN
LAYQFLEMDCFPKFLSRVALHNIHDEISDWRFH------------S-VGA----------
---TNEKNKRVRG-----QTHISRSPFSNHTSISRIGFGLLWLGIGFWIGYVLIFLAYSR
AIRVVTVVPFALGCYCIVCGMYQVDIVYSWFGVTQRLLHRHKDGSDNEDDSSEDFD----
-----HVPAIL-----KSRLTCVQHPFIRQLLRKRG----------LW--CLLLVVGATA
AFTVI------------FSCVPGRRV----------------------
>Smik_15.482
-------MNRVQDFEKIQRERLPTLYEVLIQRTSQPVDLWTFYTFLSQFPYAINYLDFWV
DLMAHTRLCKSYVELVTKSLINFPKE----------------------------------
-----------------------------NGGASTTTLDLLNALIEEGHLDLEAPGRLLK
S-------------DGQDMPFSP--KLNQLLGDWK-RQSGMSQDS---------------
---------LRRDDIALIVDEILKR-----------------RSQQDG----IPQ----I
TTKQLFHSAVGLCNTYLVSPE--QSERYLSNIPTETRNRIIEDIQVQQKYDIEVFDDIKN
LTYQFLEMDCFPKFLSRVALHNIHDEISDWRFH------------S-VNA----------
---TNEKGKRFRG-----QAHISRSPFSNHTSISRIGFGLLWLGIGFWIGYVLIFLAYGR
AIRVVTVVPFALGCYCIVCGMYQVDIVYSWFGVTQRLLHRHKNSSSDQDGVSAGSD----
-----HVPVLLAVFGGKRRLTRVKHPFTRQLLRKRG----------LW--CLLLVVGATA
AFTVI------------FSCVPGRRV----------------------
>YOR301W
MKEELSKVSSMQNFEMIQRERLPTLYEVLIQRTSQPVDLWTFYTFLSQFPYAINYLDFWV
DLMTHTRLCKNYIELVRKSLINFPQEQQ--------------------------------
----------------------------QNGSTSTATFDLLNALIEEGHLDPEAPDKLLE
N-------------SGPDVPFSP--KLNELLGDWK-HQSGIGQEA---------------
---------LRNEDVALIVDEIMKR-----------------RSQQDG----KPQ----I
TTKQLLHSAVGLCNTYLVSPE--QSERYLSNIPMETRNRIIESVQIERKYDIEIFDDLKN
LTYQFLEMDCFPKFLSRVALHNIHDEISDWRFH------------S-VGV----------
---TNEKSNRSRG-----QTHISRSPFSNHTSISRIGFGLLWLGIGFWIGYVLIFLAYSR
AIRVVTVVPFTLGCYCIVCGMYQVDIVYSWFGVTQRLLHRHKNAGNDEGDASSDTD----
-----HVPMILAVFGGRRRLTRIEHPFTRQLLRKRG----------LW--CLLLVVGATA
AFTVI------------FSCVPGRRV----------------------
>KNAG0G03100
---------MDRNFAQIQKERLPTLYEVLIQKSGAPLDLWSFYTYLSQFPFAINYLDFWI
DLMAHIRLCKDFIKGVRRSIGEAAERNEEQQGGGG-------------------------
----------------------------ADDTASVTTSVLMQTIMEEAQLDLNRPDDVYS
FFRNSHQQDGLGDNLRASSRYSA--RVSQMLDEWNGRTSHRYTGHS----VD--------
---------ISNGNLTTLMDEFLNE---------------HSKTRGDG----GAY----I
TTKQLLHNATHMCRTYLISRE--ESERYLTNIPTEIREYILVGVLDAKKYDPGIFDDLKT
LTYQFLEIDCFPKFLSQVALHNLHDEISNWRFNKLDSTKYSGGGGALTGD----------
---PEKDAVGYRG---------AHTPFSNYTTLSRILFGLLWLGIGFWIGYTLIFLKYSR
AIRVVTVVPFALGCYYCICGLYQVDIIYSIFGVTQRLLQRETAAAGEDPPTHTDATTA--
-----KVPSLLVLFGGRGRLLKIEHEFTRRLLLRRG----------LW--CLLLVTFSTA
AFTVI------------FSCVPGYRV----------------------
>KAFR0D01490
---------MELDFAKIQEERLPTLYEVLIQKTSVPVDLWSFYTYLSQFPYAINYLDFWI
DLMAHLRLSKDYINGIRGSLLEESNFNELENQQSS-------------------------
----------------------QEDQNSNSENVSVTTSVLLNALMEEGHLDFENPDRVSK
F-------------LQGKADYSP--KLSQLLDGWK-RHSGIYDANNNLN-----------
---------IDNGNLPTLLDEMLKN-----------------KSKRNE----TSQ----I
TTKQLLNNALQICNTYLYSTE--KSAKYLSNISEETRMKVLDSVVNQNRYDPEVFEELKA
TTYQLLETDCFPKFLSTVALHNIHDELSDWRFH------------SEKGA----------
---IDNTTLRYRG---------SRSPFSNHTTLSRLIFGLVWLGIGFWIGYVLIFLKYSR
AIRVVTVVPFAIGCYLIICGMYQVDIIYSWFGVTQVLTYKDSDSKILRSNDEEHTTTKE-
-----KVPFLIALLGGGKRTVKIEHTFIKKLLQRRG----------LW--CLLLVVISTA
IFTVI------------FSCVPGFRI----------------------
>NDAI0E00630
---------MELDYKKIQTERLPTLYEVLIQKTKFPVDLWSFYTFLSQFPYAINYLDFWI
DLMAHLRLCKDYISGIRESITYNQNEARNSRIRHHLQYTSEESI----------------
-------QHETQSIQHHDDPEGGDEDDDDDDNISVTTSVLLNALLDEGHLDFENPERVSQ
F-------------LQGNTEYSP--KLSQLLEDWK-RHSIANNDSN----RKGSLNRNNS
NVRSRE---TNGAALPDVVDDILRK-----------------QSQQEE----RAK----I
TTKQLLNNALKICSIYLQSPE--RSERYLTNLPDDIRLKALNLVQNERRHDPQVFEELKS
IAFQFLEMDCFPKFLSTVALHNIHDEISDWRFH------------SNARS----------
---HNLTRVDKSL--IKNHDHISKSPFSTYTLLSRTIFGLLWLGIGFWIGYTLIFLKYDR
GIRVVTIVPFAIGNYFIICGMYRVDIIYSWFGVTQRLLYKHNEKNRDADREVQMDEKNGK
NH---HVSGILALLGGRSRLIRIEHPFIKNILMKRG----------LW--CLFLVLLSTG
IFTVI------------FSCVPGYRI----------------------
>NCAS0B00780
----MVPNKMEPDFEKIQTERLPTLYEVLVQKTRAPVDLWSFYTFLSQFPYAINYLDFWM
DLMTHLRLCKDYVDGIRESLVVNNERQGNSSLLNN-------------------------
-------------------EHAQQVEADADDSASVRTSVLLNALLEEGHFDLTNPAGVSQ
L-------------LQGQVNHSP--KLAQLIDDWN-RHSQNVDDSN----RNRSSNNNSN
---------SNNNNLSSILDDILKR-----------------QSQLEE----KPK----V
TTKQLLNSALKICSLYLLSPE--QSERYLTNIPDEVRLKAVNLIQRNSRHDPEVFDELKS
VSYQFLEIDCFPKFLSTVALHNIHDEISDWRFHAH----------STGGN----------
---RNKSQASLTEKDLESMRHISKSPFSTYTTLSRIMFGLLWLGVGFWIGYTLIFLKYDR
GIRVVTIVPFCIGSYFVVCGLYQVDILYSWFGITQRLLYKDRKVTEDGYDGNVPVDVKE-
-SKD-KIPFIFGILGGRNRLIEVKHPFIRKFLFQRG----------LW--CCLLVLISTG
VFTVV------------FSCVPGHRV----------------------
>ZYRO0F12232g
---------MEGDFTPIENQRLPTLYEVLLRQTSPPVDLWSFYTFLSQFPYAIDFLDFWI
DLMAHVRLCRDYVRGVKESIEARNSELI--------------------------------
----------------------------ADDAHSDESNVLLDALLTEGYLDFKNARRVSQ
F-------------LRGNVEESM--RISRLLDTFK-QDHRLSTQSD----R---------
---------EADEFLAAMVDDMLKQ-----------------KIHKDK----QPK----M
TRKQLINNASQICRQYLLSPQ--ESPRYLINVPDEIRMKALHAVQSERRFDPELFEDLRN
LSYDFLEMDCFPKFLNRVALHNLHDQLSDWRFQ------------T-TAA----------
---IGKSKGDIRG-------QRSASPLSTYSGLGRIALGLCWLGIGFWIGYVLIFLHYSR
AIRVTTIVPFGIGCYFSVCGIYQVDILYSWFGVTQRLMYEKKLPSDREEDVPKSRT----
-----RVPTIFALLGGRSRLMPVHHPFIKKLLLRRG----------MW--CFLLVVVSTA
VLTVL------------FSCVPGKRI----------------------
>TDEL0B03350
-----MKDPMEQDYEQIQRERLPTLYEVLIQVTKAPVDSWEFYTYLSQFPYAIDYLDFWI
DLMAHIRLCKDYVKGVRESVEFNETIASRNRDEVN-------------------------
---------------------------IEDDNESVSSSVLLDALLNEGYLDFQNTKRVSQ
F-------------LQGDTNDSP--RVSRLVDGWK-RQSGIAD-----------------
---------GQNHPLALMVDEMLRK-----------------ETRKLK----QPK----I
TRKQLVNNALQICNIYLLKSA--EDNKYLINVPERVKNQVLYDVQQEQRHDPAVFEPLKT
VAYQFLEIDCFPKFLSTVALHNIHDQISNWRYQ---------------------------
----------SPG----LRRHRSKSPFSNYTVLSRVLIGLIWLGIGFWIGYTLIFLHYSR
AIRVVTIVPFALGSYSIVCGLYQVDILYAFFGLTQALMYQEKDGSQT--DRKHSHDYS--
-----EIPTIFKLLGGRSRLIKIQHDFIKKLLWKRA----------LW--CGFLTTLATA
ILTVI------------FSCVPGYRL----------------------