MUSCLE (3.8) multiple sequence alignment

TDEL0G04560        ---MSTSLCTRTTAETD-------------PYYIEESSTKI-------------------
AGR274C            ------MCPSNAQANED-------------PSLCLIDLTFM-------------------
Ecym_3119          ------MSSNNVHASED--------------GPCLLDLTFM-------------------
SAKL0A08206g       ---MDGSIVTDAFMAND-------------TRPLDASYTSVAPRIPPKLCFSELPSTLDL
KLTH0G15334g       MNSRSKCGPRFATMEME---------ADFSSQFILEGSGHP-------------------
Kwal_56.23256      MNLTASELSSPTLKPSDYDSIDRIAKSKLKSFFHKSDSSTI-------------------
TPHA0K01150        ----------MGALPEN-------------NMEQFMEYLKE-------------------
Skud_15.344        -------------MPED------------------ISYTGP-------------------
Suva_8.233         -------------MPED------------------PHYSDS-------------------
Smik_15.362        -------------MPKD------------------ITYSDS-------------------
YOR177C            -------------MPED------------------TSYSNS-------------------
                                   :                                           

TDEL0G04560        ----------------------------------------------YQNLYNDENHSNAR
AGR274C            ----------------------------------------------K-QHKGLPDDPSFV
Ecym_3119          ------------------------------------------------KNKSVSEDPSFV
SAKL0A08206g       GSKLDQKSSNHLADCMPTTGKSSVEMGTTSNNTISSPVQDNSDGSND-GEYNSDEDIALN
KLTH0G15334g       ------------------NSNSLPNALLRKDLSLKQWEDTNETEMDF-DLYSIDRDNDLR
Kwal_56.23256      ----------------------------------------PHEETDF-EDTSSSADLGLQ
TPHA0K01150        ----------------------------------------------Y-ADNSDENDDERD
Skud_15.344        ----------------------------------------------F-EEFSNNNSHGIS
Suva_8.233         ----------------------------------------------Y-GENNNSNPNMVS
Smik_15.362        ----------------------------------------------F-EEFNNSNTLAVS
YOR177C            ----------------------------------------------F-EDYYN-NSHAIS
                                                                               

TDEL0G04560        PQDYITGPLEIKGVNYAVEKALRDFER--EGRKDRKALRYITNK-KIVGISSQTGS---L
AGR274C            -ELAINGILN--------QDSIVA----------QRKVKFSE------------------
Ecym_3119          -EIAVNGILD--------QDTVVA----------QRKIKFND------------------
SAKL0A08206g       -KVLVTPVYTIKNSNPFLEDAIASAICPLEVTNHTPKIRFGENSVKMFYSDSLIGNGLEE
KLTH0G15334g       PETYVSDVYEVRNTNPIVEEFVTEQMR--VKGRPSSLLRFGCNQTKLFDMHASIGN----
Kwal_56.23256      -EDIVSDVYDVKNVNPLVEKFVAKRMK--IKSRLNSMVRFGSNRTKIFDKESILQ-----
TPHA0K01150        -------KYK--------VQLINEY----CDNERLQTVQFGKEEVKMFDSREDISN----
Skud_15.344        -------PFK--------DSYFKD------MTPSKPNVRFGDDDVNIFDQRKKVNE----
Suva_8.233         -------PYK--------DSFFKE------VTPSKPNVRFGDDDVNIFDQRKKVNE----
Smik_15.362        -------PYK--------DIFFKE------MTPSKPNVRFGDDDVNIFDQRKKVNE----
YOR177C            -------PYK--------DSFYKE------MTPSKPNVRFGDDDVNIFDQRKKVNE----
                                                        :.:                    

TDEL0G04560        PLTRPATKYVVKKVTFGLSSVVHFEESDIVPKKSVGGPIRGKSILKRSSFNSPSTDYEKI
AGR274C            ---LPLGPQPSARSSMTT------------PRKSILVSRQTTETENSDNEEDPD------
Ecym_3119          ---CPMGPKLTKNEVPAI------------PKKSILVNR--ENTTDTPTEQEIPNE----
SAKL0A08206g       NPPRKPNGNLKHDSVKSVLVEKN-------SDNACPLKSKDSDTADQDWEVNVPIEN---
KLTH0G15334g       ---SHIRKPSGAIKPESILIVKD-------QEPRYL-----EEDSHSDWDQDIPIDN---
Kwal_56.23256      ---VPKKEPPRLTPRDSILVVKE-------QNPQYL-----EEDSQSDWEQDIPISN---
TPHA0K01150        ---KNIQPFKTN------------------SNRGALKPII-KAVEKISMDNNVNEEL---
Skud_15.344        ---INKNSSIRRGIPPSININNT-------PNKSSLKSPKSNNLSDCGFDYERRFETRDD
Suva_8.233         ---INKSSYIKKSIPLSTNTNST-------PNKSSLKSPRSDSTSKPGFDYIDQLESNDE
Smik_15.362        ---INKNSSIKRTFQTSTSTTTT-------PNKSSLKSPKSKKTSKDIFNYGNKSETREE
YOR177C            ---INKNNTVKRSIPSSISTTIT-------PNKSSLKSPRGKRASKNSFDNETKLESKNE
                                                                               

TDEL0G04560        GRRELQNAIARIYNLCDLPFTLFRKD---DPLLSLELLARGVCNAFKSH-----------
AGR274C            ---EVELLLHRCFNFCNLDTDGVAER---PLVENLELISYGIISTFRFH-----------
Ecym_3119          ---EVLLLLRRCFNFCNLDTDGIEKR---SIEENLESISYGIISTFRFH-----------
SAKL0A08206g       --TVALEAITRCFNLCNVPLEDLDED---DLVMSLQRLSFGIVSAFKTQ-----------
KLTH0G15334g       --PVVLEGFLRCWEACGIPDFEFDAE---DMIMTVQKLSYGILQALANQGTVNRLVKAQQ
Kwal_56.23256      --PVVLEGLLRCWDACGIPESEFDDE---DLIMTVQKLSYGILQAFNNQGTINRLVKYQQ
TPHA0K01150        ---EVKECLAACFSLCSVDEEKFTDL---SISKKLRRLYISIGSAFKVK-----------
Skud_15.344        TFKEVNDAVNRCYALCNIPTKHISISSISDLAQTFETLAVGITHETNRK-----------
Suva_8.233         TFKDVNDAVNRCYALCNIPTKHVSIKSISDLAQTFETLAVGITHETNRK-----------
Smik_15.362        TFKDVNDAVNRCYALCNIPTKHISIKSISDLAQTFETLAVGITHETNRK-----------
YOR177C            TLKEVNDAVNRCYALCNIPTKHVSINSISDLAQTFETLAVGITHETNRK-----------
                           .   :  *.:    .          ..  :  .:      :           

TDEL0G04560        --------EICWKKV-----GEE---------ELLELKEK------------INNLETEN
AGR274C            --------ECCYKYA----------------------HE-------------LEASSTVK
Ecym_3119          --------ECCYKYA----------------------HE-------------LETTSKVK
SAKL0A08206g       --------EMCYKYLGKKEKEEILGSLNHLGEKVICLEEDNEQLTLKVKQLSLENQQLFQ
KLTH0G15334g       FSEITEDFEECWIDLLEALELED---------TVKCMEAD------------LAHQTSIT
Kwal_56.23256      VSKLTEDFEQCWLDLLEALQLGD---------TVNELKDN------------LTTQVSIN
TPHA0K01150        --------ELFFYWV------------------RMRIENE------------LQKQ-ISD
Skud_15.344        --------AECERSK-----NAI---------DSLYYHEQ------------LEKKDLNE
Suva_8.233         --------AECERSK-----NAI---------DSLYYHEQ------------LEKKELNE
Smik_15.362        --------AECERSK-----NAI---------DSLYYHEQ------------LEKKELNE
YOR177C            --------AECERSK-----NAI---------DSLYYHEQ------------LEKKELNE
                                                                       :       

TDEL0G04560        ETKEREL-NHFKQELYNDLNRLIP------EEQVLKI------PDISYGIVKTGIAKIEH
AGR274C            EEVPQRL---------------LP------VDKTATL-----------------DTDMQD
Ecym_3119          AECPI-----------------VP------LVEGKSP----------------ADAELQH
SAKL0A08206g       NSKPDNLKDELAEKLKGKIMQLEGKISTKDKEYHKVL------TQLNSLKNNSHDDSSQQ
KLTH0G15334g       AEKEKRI-QSLENQVRGLERQLETQVELKQENKDLRAAVEHNTKMFQELNEKYRDVSLKL
Kwal_56.23256      AKNEDRI-HSLEDQIKTLEAQLEDQSTLKREHAENIATAEEANKKFQDLSSKYRDASLKL
TPHA0K01150        QELQIKL-------LKQNLTDITD------SEKTRTL------ELLNFQ------NKYNK
Skud_15.344        KSLQMAI-DHLLKVTKQNQRQVDG---RDKLEETEVL------KSFIKEIEEVEDNKISI
Suva_8.233         KSLQMAI-DHLLKVTKQNLRQADD---TNKLKETEVL------KSFFEEIEEVDDNKISI
Smik_15.362        KSLQMAI-DHLLKVTKQNLRQADD---NNKLKDTEVL------KSFIEEIEEVDDNKISI
YOR177C            KSLQMAI-DHLLKVTKQNLRQADD---GNKLKETEAL------KSFIEEIEEVDDNKISI
                                                                           . . 

TDEL0G04560        ISTKWKLRAAS--CENNDLREENEALREENAELRKGLLGQRD-ISE-----LLVETKISE
AGR274C            ELVLWKIEAEELGIKNNVLMTENGKLIAELTALRQTIRTLNDEKE------KLRAQVHDR
Ecym_3119          EAVVWKIEAEALGIKNNVLMVENGKLINELTSLRQTIRNLRDEKE------NLKAQVYEK
SAKL0A08206g       SIVLKQLAEKT--REAEILRRRLTEQNDRIVNNSNELENLKLEYREVKSQYDLLAKEKER
KLTH0G15334g       NVVQMNNDEVS--IKHDVLMNENAELRHEIRTCRGTVKDRESQIK------QLERTMSND
Kwal_56.23256      DTIQMDRDEIA--IRYDCLKKDHLAISEELSNCKETLNDRETQLK------RLQRDVVNV
TPHA0K01150        TILEKTELEDK--VK--MLDVSVDTLKKELLGTEDTISDLEN-FKE-----QCIIKKLEV
Skud_15.344        NSLEQQLLEEK--TANNILRRDYYKLQERGKRLCHEFQDLQDDYSK-----KMKQKEYEV
Suva_8.233         NNLEQQLLEEK--KANNILRRDYYKLQERGRRLCHEFQDLQNDYTQ-----QIKHKEYEL
Smik_15.362        NSLEQQLFEEK--TANNILRRDYYKLQERGRRLCHDFQDLQDDYSK-----QMKQKEYEV
YOR177C            NSLQQQLLEEK--TANNILRRDYYKLQERGRRLCHEFQELQDDYSK-----QMKQKEYEV
                                     *                 .                     . 

TDEL0G04560        KKT---------------IIR----TRPINSRIKGVNDERSTVNELIL------------
AGR274C            ------------------DIQ----LLKLKDQSKDIDTETQVK-----------------
Ecym_3119          ------------------DIQ----LFKLKDKIKDNNIETQTK-----------------
SAKL0A08206g       TDFKCKEFQESWYEATERTKTIQAELLKLEKEKDQILTESKKTEKELIKEHQNDQKLFLS
KLTH0G15334g       SREAKKELETSKTQCNQMAFE----YKNAEMNWKHRQSMLLSDLEEKSALAEAFNQELER
Kwal_56.23256      QRESQEALDISNKHCSRMATE----LENAEATWKHNFFLILKQREEQMAISEGLKSQSMK
TPHA0K01150        AELDTE------------VKR----LNNKNMEWRKKSNEYKLD-----------------
Skud_15.344        QKLKNE------------VKF----LTNMNTNLKADKTQFSQKEKQYS------------
Suva_8.233         QKLKNE------------IKT----LLNMNNNLKADKTQFSQMEKQYF------------
Smik_15.362        QKLKNE------------IKT----LLCMNDNLKADRTLLSQKEKQYF------------
YOR177C            QKLKNE------------IKV----LLNMNDNLKAEKAHYSQKEKQYF------------
                                                :                              

TDEL0G04560        --------KRLLKASQKSNETLAGEYKELKDLQDSLYEKVHSLKVFLGAMKQAFC-----
AGR274C            ------------------LRRLQDLAGRLEKVISQRASTISNLREDRQALRRELAKSTEL
Ecym_3119          ------------------IKQLQDTTGRLEKVITQRTSTISNLKQDRHTLRKQLAKSTEN
SAKL0A08206g       SKETYDNLSKKVQEQIVARNTQQRKMNVLSQKIVKLSEELNKVKEERTALNESLSSVTEE
KLTH0G15334g       AKNEIEGFKNQNIVSEASLNAAKEYIEELELQNKELNQRISKLCLQVEGLVEFKNKAKAK
Kwal_56.23256      ARQELEDLKKRNTESLITLNATGNYIKSIELQNRELNDKVSMLSSRLETLLDFKKRAKTK
TPHA0K01150        ------------------LSRRDAEVKEAQMKQQELLIKFEHLKKYM-------------
Skud_15.344        --QKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAV
Suva_8.233         --QKYTYIEKYMTHVKEEYNKKEDECDKLKFIIDNNLKKIDHLERALQSQIATQNSFSTA
Smik_15.362        --QKCTYIEKYMNHVKEEYNRKENECNKLKYIIDKSMKRIEHLERSLQSQSTVQNSFSTA
YOR177C            --QKYTYIEKYMNHVKEEYNRKEDECKKLNFIIDKSMKKIEHLERSLQTQFTAQNSFSTA
                                                .    .    .  :                 

TDEL0G04560        -------NSISREKALERVNLKLIS--------------ELEGYRFQNDQL-KENSVASE
AGR274C            TINLKGDNRRLKAHVDSLLHLFNDC--------------ENEGP--------SSSVTLPH
Ecym_3119          NINLKGANNRLKQHVDNLLYLFND---------------------CENPASENNPSQLPQ
SAKL0A08206g       NNKSKALTEKLEVKLTNQKKRFKELVKWNEKLLKMDGNMRKEIYKTVEDYE-SKASELER
KLTH0G15334g       VALLKDAKRESKQQNKKNARLIAAL--------------ESRVEELATLSE-VKENDNKQ
Kwal_56.23256      ILALRDAKRTVKQSIKDANLTVDQL--------------RKQAAETREMCE-VQEKQKEQ
TPHA0K01150        -------------------------------------------------------IILTI
Skud_15.344        TVQDEDQKDAHLEDRYHKVKEFMEQ--------------KLQTSKNNDPSC-SEAEALDN
Suva_8.233         AIQEEDPDDAHLEDRYQKVKEFMEQ--------------KLQTSKIDDPMK-SETEALDN
Smik_15.362        TILEEGSKDIDLEDRYHKVKEFMEQ--------------KLQTSKIHDSSC-SETEALDN
YOR177C            MIQEEGPKDAHLKDRYHKVKEFMEQ--------------KLQTSKINDPSC-SEAEALDN
                                                                               

TDEL0G04560        LELNIRIEQRKNETHGNSTRISVLIR-VLEGVIGELQTPSDPEEI---
AGR274C            QLQSLKLTSKHEKDESQAFMQRPLHP---QNNRKHTGLKLRAHT----
Ecym_3119          QFEHLKLTSDIESD--HIATTKKIRPLSSNHCRSTRNRHISSKVPGYI
SAKL0A08206g       VNLELKRLKDVLYDTRMEIYSKNNKKDSLTLNRNVLTVISNKYTTV--
KLTH0G15334g       LFQELQQYKKSLHG-AKVQTPSVLSPLKHKNAHNRRSLQLSDRRIGAF
Kwal_56.23256      LFLELQAAKKLLKE-SKISTPPSHSPLAHKGVRPHRPLMLANNRIDAF
TPHA0K01150        IFRMISLDILS-------------------------------------
Skud_15.344        VLGLIENTMKTLEG-NSKYYSTTTKK-CLKYVTGSSRLKENEHITN--
Suva_8.233         VLGLIENTMKTLDR-NSKYQPTTTKK-CIKYVIGSSRLKENEHITN--
Smik_15.362        VLGLIENTMKKLDK-NNKYVPTTAKK-CIKYVTGSSRFDENEHITN--
YOR177C            VLCLIESSMKTLDK-NSKCYPIATKK-CIKYVTDSPRLKENEHVTN--
                       :                                           

FASTA FORMAT for MUSCLE Version 3.6

>TDEL0G04560
---MSTSLCTRTTAETD-------------PYYIEESSTKI-------------------
----------------------------------------------YQNLYNDENHSNAR
PQDYITGPLEIKGVNYAVEKALRDFER--EGRKDRKALRYITNK-KIVGISSQTGS---L
PLTRPATKYVVKKVTFGLSSVVHFEESDIVPKKSVGGPIRGKSILKRSSFNSPSTDYEKI
GRRELQNAIARIYNLCDLPFTLFRKD---DPLLSLELLARGVCNAFKSH-----------
--------EICWKKV-----GEE---------ELLELKEK------------INNLETEN
ETKEREL-NHFKQELYNDLNRLIP------EEQVLKI------PDISYGIVKTGIAKIEH
ISTKWKLRAAS--CENNDLREENEALREENAELRKGLLGQRD-ISE-----LLVETKISE
KKT---------------IIR----TRPINSRIKGVNDERSTVNELIL------------
--------KRLLKASQKSNETLAGEYKELKDLQDSLYEKVHSLKVFLGAMKQAFC-----
-------NSISREKALERVNLKLIS--------------ELEGYRFQNDQL-KENSVASE
LELNIRIEQRKNETHGNSTRISVLIR-VLEGVIGELQTPSDPEEI---
>AGR274C
------MCPSNAQANED-------------PSLCLIDLTFM-------------------
----------------------------------------------K-QHKGLPDDPSFV
-ELAINGILN--------QDSIVA----------QRKVKFSE------------------
---LPLGPQPSARSSMTT------------PRKSILVSRQTTETENSDNEEDPD------
---EVELLLHRCFNFCNLDTDGVAER---PLVENLELISYGIISTFRFH-----------
--------ECCYKYA----------------------HE-------------LEASSTVK
EEVPQRL---------------LP------VDKTATL-----------------DTDMQD
ELVLWKIEAEELGIKNNVLMTENGKLIAELTALRQTIRTLNDEKE------KLRAQVHDR
------------------DIQ----LLKLKDQSKDIDTETQVK-----------------
------------------LRRLQDLAGRLEKVISQRASTISNLREDRQALRRELAKSTEL
TINLKGDNRRLKAHVDSLLHLFNDC--------------ENEGP--------SSSVTLPH
QLQSLKLTSKHEKDESQAFMQRPLHP---QNNRKHTGLKLRAHT----
>Ecym_3119
------MSSNNVHASED--------------GPCLLDLTFM-------------------
------------------------------------------------KNKSVSEDPSFV
-EIAVNGILD--------QDTVVA----------QRKIKFND------------------
---CPMGPKLTKNEVPAI------------PKKSILVNR--ENTTDTPTEQEIPNE----
---EVLLLLRRCFNFCNLDTDGIEKR---SIEENLESISYGIISTFRFH-----------
--------ECCYKYA----------------------HE-------------LETTSKVK
AECPI-----------------VP------LVEGKSP----------------ADAELQH
EAVVWKIEAEALGIKNNVLMVENGKLINELTSLRQTIRNLRDEKE------NLKAQVYEK
------------------DIQ----LFKLKDKIKDNNIETQTK-----------------
------------------IKQLQDTTGRLEKVITQRTSTISNLKQDRHTLRKQLAKSTEN
NINLKGANNRLKQHVDNLLYLFND---------------------CENPASENNPSQLPQ
QFEHLKLTSDIESD--HIATTKKIRPLSSNHCRSTRNRHISSKVPGYI
>SAKL0A08206g
---MDGSIVTDAFMAND-------------TRPLDASYTSVAPRIPPKLCFSELPSTLDL
GSKLDQKSSNHLADCMPTTGKSSVEMGTTSNNTISSPVQDNSDGSND-GEYNSDEDIALN
-KVLVTPVYTIKNSNPFLEDAIASAICPLEVTNHTPKIRFGENSVKMFYSDSLIGNGLEE
NPPRKPNGNLKHDSVKSVLVEKN-------SDNACPLKSKDSDTADQDWEVNVPIEN---
--TVALEAITRCFNLCNVPLEDLDED---DLVMSLQRLSFGIVSAFKTQ-----------
--------EMCYKYLGKKEKEEILGSLNHLGEKVICLEEDNEQLTLKVKQLSLENQQLFQ
NSKPDNLKDELAEKLKGKIMQLEGKISTKDKEYHKVL------TQLNSLKNNSHDDSSQQ
SIVLKQLAEKT--REAEILRRRLTEQNDRIVNNSNELENLKLEYREVKSQYDLLAKEKER
TDFKCKEFQESWYEATERTKTIQAELLKLEKEKDQILTESKKTEKELIKEHQNDQKLFLS
SKETYDNLSKKVQEQIVARNTQQRKMNVLSQKIVKLSEELNKVKEERTALNESLSSVTEE
NNKSKALTEKLEVKLTNQKKRFKELVKWNEKLLKMDGNMRKEIYKTVEDYE-SKASELER
VNLELKRLKDVLYDTRMEIYSKNNKKDSLTLNRNVLTVISNKYTTV--
>KLTH0G15334g
MNSRSKCGPRFATMEME---------ADFSSQFILEGSGHP-------------------
------------------NSNSLPNALLRKDLSLKQWEDTNETEMDF-DLYSIDRDNDLR
PETYVSDVYEVRNTNPIVEEFVTEQMR--VKGRPSSLLRFGCNQTKLFDMHASIGN----
---SHIRKPSGAIKPESILIVKD-------QEPRYL-----EEDSHSDWDQDIPIDN---
--PVVLEGFLRCWEACGIPDFEFDAE---DMIMTVQKLSYGILQALANQGTVNRLVKAQQ
FSEITEDFEECWIDLLEALELED---------TVKCMEAD------------LAHQTSIT
AEKEKRI-QSLENQVRGLERQLETQVELKQENKDLRAAVEHNTKMFQELNEKYRDVSLKL
NVVQMNNDEVS--IKHDVLMNENAELRHEIRTCRGTVKDRESQIK------QLERTMSND
SREAKKELETSKTQCNQMAFE----YKNAEMNWKHRQSMLLSDLEEKSALAEAFNQELER
AKNEIEGFKNQNIVSEASLNAAKEYIEELELQNKELNQRISKLCLQVEGLVEFKNKAKAK
VALLKDAKRESKQQNKKNARLIAAL--------------ESRVEELATLSE-VKENDNKQ
LFQELQQYKKSLHG-AKVQTPSVLSPLKHKNAHNRRSLQLSDRRIGAF
>Kwal_56.23256
MNLTASELSSPTLKPSDYDSIDRIAKSKLKSFFHKSDSSTI-------------------
----------------------------------------PHEETDF-EDTSSSADLGLQ
-EDIVSDVYDVKNVNPLVEKFVAKRMK--IKSRLNSMVRFGSNRTKIFDKESILQ-----
---VPKKEPPRLTPRDSILVVKE-------QNPQYL-----EEDSQSDWEQDIPISN---
--PVVLEGLLRCWDACGIPESEFDDE---DLIMTVQKLSYGILQAFNNQGTINRLVKYQQ
VSKLTEDFEQCWLDLLEALQLGD---------TVNELKDN------------LTTQVSIN
AKNEDRI-HSLEDQIKTLEAQLEDQSTLKREHAENIATAEEANKKFQDLSSKYRDASLKL
DTIQMDRDEIA--IRYDCLKKDHLAISEELSNCKETLNDRETQLK------RLQRDVVNV
QRESQEALDISNKHCSRMATE----LENAEATWKHNFFLILKQREEQMAISEGLKSQSMK
ARQELEDLKKRNTESLITLNATGNYIKSIELQNRELNDKVSMLSSRLETLLDFKKRAKTK
ILALRDAKRTVKQSIKDANLTVDQL--------------RKQAAETREMCE-VQEKQKEQ
LFLELQAAKKLLKE-SKISTPPSHSPLAHKGVRPHRPLMLANNRIDAF
>TPHA0K01150
----------MGALPEN-------------NMEQFMEYLKE-------------------
----------------------------------------------Y-ADNSDENDDERD
-------KYK--------VQLINEY----CDNERLQTVQFGKEEVKMFDSREDISN----
---KNIQPFKTN------------------SNRGALKPII-KAVEKISMDNNVNEEL---
---EVKECLAACFSLCSVDEEKFTDL---SISKKLRRLYISIGSAFKVK-----------
--------ELFFYWV------------------RMRIENE------------LQKQ-ISD
QELQIKL-------LKQNLTDITD------SEKTRTL------ELLNFQ------NKYNK
TILEKTELEDK--VK--MLDVSVDTLKKELLGTEDTISDLEN-FKE-----QCIIKKLEV
AELDTE------------VKR----LNNKNMEWRKKSNEYKLD-----------------
------------------LSRRDAEVKEAQMKQQELLIKFEHLKKYM-------------
-------------------------------------------------------IILTI
IFRMISLDILS-------------------------------------
>Skud_15.344
-------------MPED------------------ISYTGP-------------------
----------------------------------------------F-EEFSNNNSHGIS
-------PFK--------DSYFKD------MTPSKPNVRFGDDDVNIFDQRKKVNE----
---INKNSSIRRGIPPSININNT-------PNKSSLKSPKSNNLSDCGFDYERRFETRDD
TFKEVNDAVNRCYALCNIPTKHISISSISDLAQTFETLAVGITHETNRK-----------
--------AECERSK-----NAI---------DSLYYHEQ------------LEKKDLNE
KSLQMAI-DHLLKVTKQNQRQVDG---RDKLEETEVL------KSFIKEIEEVEDNKISI
NSLEQQLLEEK--TANNILRRDYYKLQERGKRLCHEFQDLQDDYSK-----KMKQKEYEV
QKLKNE------------VKF----LTNMNTNLKADKTQFSQKEKQYS------------
--QKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAV
TVQDEDQKDAHLEDRYHKVKEFMEQ--------------KLQTSKNNDPSC-SEAEALDN
VLGLIENTMKTLEG-NSKYYSTTTKK-CLKYVTGSSRLKENEHITN--
>Suva_8.233
-------------MPED------------------PHYSDS-------------------
----------------------------------------------Y-GENNNSNPNMVS
-------PYK--------DSFFKE------VTPSKPNVRFGDDDVNIFDQRKKVNE----
---INKSSYIKKSIPLSTNTNST-------PNKSSLKSPRSDSTSKPGFDYIDQLESNDE
TFKDVNDAVNRCYALCNIPTKHVSIKSISDLAQTFETLAVGITHETNRK-----------
--------AECERSK-----NAI---------DSLYYHEQ------------LEKKELNE
KSLQMAI-DHLLKVTKQNLRQADD---TNKLKETEVL------KSFFEEIEEVDDNKISI
NNLEQQLLEEK--KANNILRRDYYKLQERGRRLCHEFQDLQNDYTQ-----QIKHKEYEL
QKLKNE------------IKT----LLNMNNNLKADKTQFSQMEKQYF------------
--QKYTYIEKYMTHVKEEYNKKEDECDKLKFIIDNNLKKIDHLERALQSQIATQNSFSTA
AIQEEDPDDAHLEDRYQKVKEFMEQ--------------KLQTSKIDDPMK-SETEALDN
VLGLIENTMKTLDR-NSKYQPTTTKK-CIKYVIGSSRLKENEHITN--
>Smik_15.362
-------------MPKD------------------ITYSDS-------------------
----------------------------------------------F-EEFNNSNTLAVS
-------PYK--------DIFFKE------MTPSKPNVRFGDDDVNIFDQRKKVNE----
---INKNSSIKRTFQTSTSTTTT-------PNKSSLKSPKSKKTSKDIFNYGNKSETREE
TFKDVNDAVNRCYALCNIPTKHISIKSISDLAQTFETLAVGITHETNRK-----------
--------AECERSK-----NAI---------DSLYYHEQ------------LEKKELNE
KSLQMAI-DHLLKVTKQNLRQADD---NNKLKDTEVL------KSFIEEIEEVDDNKISI
NSLEQQLFEEK--TANNILRRDYYKLQERGRRLCHDFQDLQDDYSK-----QMKQKEYEV
QKLKNE------------IKT----LLCMNDNLKADRTLLSQKEKQYF------------
--QKCTYIEKYMNHVKEEYNRKENECNKLKYIIDKSMKRIEHLERSLQSQSTVQNSFSTA
TILEEGSKDIDLEDRYHKVKEFMEQ--------------KLQTSKIHDSSC-SETEALDN
VLGLIENTMKKLDK-NNKYVPTTAKK-CIKYVTGSSRFDENEHITN--
>YOR177C
-------------MPED------------------TSYSNS-------------------
----------------------------------------------F-EDYYN-NSHAIS
-------PYK--------DSFYKE------MTPSKPNVRFGDDDVNIFDQRKKVNE----
---INKNNTVKRSIPSSISTTIT-------PNKSSLKSPRGKRASKNSFDNETKLESKNE
TLKEVNDAVNRCYALCNIPTKHVSINSISDLAQTFETLAVGITHETNRK-----------
--------AECERSK-----NAI---------DSLYYHEQ------------LEKKELNE
KSLQMAI-DHLLKVTKQNLRQADD---GNKLKETEAL------KSFIEEIEEVDDNKISI
NSLQQQLLEEK--TANNILRRDYYKLQERGRRLCHEFQELQDDYSK-----QMKQKEYEV
QKLKNE------------IKV----LLNMNDNLKAEKAHYSQKEKQYF------------
--QKYTYIEKYMNHVKEEYNRKEDECKKLNFIIDKSMKKIEHLERSLQTQFTAQNSFSTA
MIQEEGPKDAHLKDRYHKVKEFMEQ--------------KLQTSKINDPSC-SEAEALDN
VLCLIESSMKTLDK-NSKCYPIATKK-CIKYVTDSPRLKENEHVTN--