MUSCLE (3.8) multiple sequence alignment

CAGL0I07161g       --------MSRESSVNSSMVED-----------------EDSASDMDADLDEENARKH--
KLLA0E03213g       --------MDTEIDPTESPSKE-------------------PSKEPSKEPLLGSDGKI--
AFR135W            --------MYLAMQYHHSSRRQ-----------------WIVSMDDEREMSVEMDVSI--
Ecym_2311          -------------------------------------------MDDEREMSVEMDVSM--
SAKL0G03608g       --------MTEDTPE----------------PHDTSVMEEDPALPGALDEYDEEVGVS--
KLTH0F14960g       --------------MTSSQALE---------PPS-----EDVPMGDAEDAEMEHEGDY--
Kwal_55.21250      --------------MTSSLAQE---------PAS-----EDMPMGDVEEEEIEHEGDY--
TBLA0A02530        --------MSEDQNSSADDQIG--------TPIGNTQEQGQDQDDDANSNYDSNEDSIDV
KNAG0B04020        -----MESELGTTAEVPVLEED---------ANSAASSSQDPGRDDGLHDSAQEDVSVMD
NDAI0C01370        --------MSQETPESSVIYEE---------PIDIPI-EDDDEDDDVDEEDVKAESLTST
Kpol_543.10        MASDDETANGSAVGNSSVVFEEQVADVASGEGNSSEVSGDKQNSNNKVDEVDEIEEDE--
TPHA0J02790        -----MTIAAKTIEKEGATKEEIASNNDLKVDVDGSNRVDDSKDDEVDDDDDDDDDEDDD
NCAS0H02290        ----------MSANDTSSVYEE---------PIEIPL--DNDEEDDNMDSMVEDNA----
KAFR0E02530        --------MTGETPESSIVYED---------PIEIPL----DDDSDDEQPSQQDHNDL--
Smik_15.320        --------MSQEEAESSIVYEE---------PIDIPL-----DDDDDGDEMEEEENNVPL
YOR141C            --------MSQEEAESSIIYEE---------PIDIPL------EDDDDEDELEEENSVPL
Suva_8.192         --------MSQEEAESSVVYEE---------PIDIPL------EDDDEDEMEEEENNVRL
Skud_15.304        --------MSQEEAESSVVYEE---------PIDIPL-EDDDDDDDDEDEMEEEENNVPL
ZYRO0D11308g       ---------MSQEAESEPVYEE---------PIDIPL--EEEDDDDEDDEADEVGESHTP
TDEL0A03410        --------MSQDTSEKSVVYEE---------PIDIPL-EEDDDEDEEDDEVEEHDQEHDS
                                                                               

CAGL0I07161g       -----------------------------------GRSDDGEDTGDDNADDNADDNADDN
KLLA0E03213g       ------------------------------------------------------------
AFR135W            --------------------------------------MDPIPTTEGKVS----------
Ecym_2311          --------------------------------------EVTAAATEGKVT----------
SAKL0G03608g       -----------------------------TGENGTPLSMTPVPPATSGKV----------
KLTH0F14960g       -----------------------------STADQTPLSMTPALSSNPNAS----------
Kwal_55.21250      -----------------------------STADQTPMSMTPALSSHSNAS----------
TBLA0A02530        Q----------------------------DLADDSTIDIKQDSDNENENEDIGDDKSEEK
KNAG0B04020        DDTSGE-----DDEEEDDDDDDDERDDHVSKKMKVGLSKVGSPSGSSNNDDNNNDEDKKN
NDAI0C01370        DKQQNHIPAEDNVDYDNDNDNDNDTNTKKMDPPTISRSVTATPIDQSLSTKHPRDSERED
Kpol_543.10        ------------IEGEDDEDEEE------QDQPSEMSSIMGTPIGDHGSVGNGKHSEFSP
TPHA0J02790        ---------------DDDDDDNEDDDHASMIAQSELSSVVGTPTGDFGKSDAFHDD-KKR
NCAS0H02290        -----------------------------NGKEQSSQNAVGSGSTSHDDEDEEEEEHDHE
KAFR0E02530        ------------------------------------RSSTNTPLAERAATIDGEEDVDGD
Smik_15.320        SSQADQ------EVEDNDSDDSVNN----EIGSETPRSVTGLSADPRDVAEEEEEEDEEG
YOR141C            SSQADQ------ENAENESDDSVDN----VVGSETPRSVTGLSVDPRDVADEEDED-EEG
Suva_8.192         SSQADQ------ENGDNDSDDSVDN----GVGSETPRSVTGLSADPRDAAEEEEEEEEEE
Skud_15.304        SSQADQ---------DNDSDDSADN----GIGSETPGSVMGLSADPRDVAEEEDDEEEGE
ZYRO0D11308g       STTQQKLRAEAEAHGDADEDEDMD-----TMHANASRSGTSTPLGNANTAAGDDDEMDDD
TDEL0A03410        ------------VKEEDDEEDDENN----LHAAEISRSATATPIGQRNHVE---------
                                                                               

CAGL0I07161g       GDADTSVDGASTRR----------------------------------GKKKYQKYPDLD
KLLA0E03213g       ------------------------------------------------------------
AFR135W            -------------------------------------------------------KPETA
Ecym_2311          -------------------------------------------------------KPETG
SAKL0G03608g       ------------------------------------------------------KKPDT-
KLTH0F14960g       ------------------------------------------------------KVKKPD
Kwal_55.21250      ------------------------------------------------------KVKKPD
TBLA0A02530        HNVISNKVIIKRKPGRKRRPNNDYGETPLAD-----------------TKIPSKKNPKID
KNAG0B04020        NKNNNDGAVAAMETAVGDVPSATASPTPSVV-----------------MNGAADEKQEKD
NDAI0C01370        NDDNDNQENENENEDELPSSSGANTPKASTPPLTPTPTTASTNKKLKSKEEAYKKYPKMD
Kpol_543.10        KKRKLDNKIIESTDSKKQD-----------------------------KAESPEKGNNTD
TPHA0J02790        KLDESSPDKNAEKP----------------------------------NSEMTNRSDISN
NCAS0H02290        EEEDQDDEEDDDDSKELITTSGTATPTRTLTPMGSANGKTTK------EEGPQKKVQKVE
KAFR0E02530        DDIESNNSVK--------------------------------------TVKIDGKDVQLS
Smik_15.320        EEEEEDEEEEDNDDENENELEDSRDKRAQPTAQ---------------TSKRYKKYPKLD
YOR141C            EDEDEDEDDNDVDNEDENDNDNANENENELGSSRDKRAPPAVQ-----TSKRYKKYPKLD
Suva_8.192         EEEEDDNDGDNDNDNDNDDDNDNDNDGEGLKDKRAQPTAQ--------TSKRYKKYPKLD
Skud_15.304        DEEEEEEDNDDDEENDNDNADGNDNENELGSSKSERGEPGVQ------TSKRYKKYPKLD
ZYRO0D11308g       ELDDDDGDENNKKRD---------------------------------SQGKFKKYPKLD
TDEL0A03410        --DEEDEDYNDEDAK---------------------------------SQERAKKHPRLD
                                                                               

CAGL0I07161g       PLKAPP----GKKVPLHLLEKRRLGRLKAAEEFARKLKVVGIERVENLNLPQSGLFSPVP
KLLA0E03213g       -SKDIP----SKKVPQHLLEKRRLGRIKAAEEFAKKLKIIGIERQENEHIAQPITLKPVS
AFR135W            GAAAGQ----GKKVPQHLLEKRRLGRIKAAEEFARKLKKIGIEKQDNLHISQTGLFRPLP
Ecym_2311          GVASTQ----SKKVPQHLLEKRRLGRIKAAEEFARKLKKIGIEKQDNIHISQTGLFRVHS
SAKL0G03608g       --HIPP----GKKVPMHLLEKRRLGRIKAAEEFAKKLKTIGIEKRDNSALQQTGLFKPLL
KLTH0F14960g       P-HAKQ----QTKVPGHLLEKRRLGRQKAAEQYAQKMKTIGIEKRDNPLLHQLGLFKPLS
Kwal_55.21250      P-QVKQ----NTKVPGHLLEKRRLGRQKAAEQYAQKMKTIGIEKRDNPLLHQLGLFKPLS
TBLA0A02530        SSK-------NKKFHLHLLEKRRLGRLKAAEEFAKKLKQSGIEKIETLTVNPTGLFQPAM
KNAG0B04020        SKSAA-----GKKVPLHLLEKRRLGRIKAAEEFAKKLKQIGIEKVDSTTLPSTGGLKPLI
NDAI0C01370        PKKVPP----GKKVPLHLLEKRRLGRIKAAEEFAKKLKEAGIEKVESVTVPPTGLFQPLN
Kpol_543.10        SGNATPSTTENKKVPRHLLEKRRLGRLKAAEAFAAKLKKTGIERVDNSHLQQTGLFGQML
TPHA0J02790        GSNKPV----STKMSTSVLERRRLGRQRAAAAYAIKLQKTGIEKKENDNIQSTGLFRPIP
NCAS0H02290        PNKVPL----GKKVPLHLLEKRRLGRIKAAKEFAKKLKEIGIEKVESVPVPMTGMFQPLL
KAFR0E02530        YGKTMA----GTKVPKHLLERRRIGRIKAAEAFAKKLKKIGIEKIENITLPQTGLFQPLN
Smik_15.320        PAKAPP----GKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIEKVEATTLPATGLFQPLM
YOR141C            PAKAPP----GKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIEKVETTTLPATGLFQPLM
Suva_8.192         PAKAPP----GKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIEKVEATTLPATGLFQPLL
Skud_15.304        PAKAPP----GKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIEKVEATTLPATGLFQPLM
ZYRO0D11308g       PAKAPP----GKKVPLHLLEKRRLGRIKAAEEFARKLKKIGIEKVETNTLPPTGLFQPMI
TDEL0A03410        PAKAPP----GKKVPLHLLEKRRLGRIKAAEEFAKKLKQIGIEKIESTTLPATGLFQPVL
                              .*.   :**.**:** .**  :* .::  ***. :   :     :    

CAGL0I07161g       LINQKNYSSDYLRKDENAFAVRERKQMRNSNAN------------NSAHAKTSE-LGSGA
KLLA0E03213g       VINQKNYSSNYLKNDDQIFYMRERKHLRQQGQTGGS------SSAPAAGIGTPA-LDDDN
AFR135W            LINQKNYSSDYLRKDDQIFSMRERKSLRSGNVN------------PVNSSQPPT-LLAEA
Ecym_2311          LINQKNYSSDYLRKDDQIFSMRERKNLRSGNVN-------SITNSSQPLIALPD-VQDDE
SAKL0G03608g       LINQKNYSSDYLKKDDQIFAMRERKSLRNPNSG----NGNGNTGNNAVSNATPEVIPEEE
KLTH0F14960g       LINQKNYSSDYLKRDDQIFAMRERKSLRNANAN----------------QATPD-MPEDD
Kwal_55.21250      LINQKNYSSDYLKRDDQIFAMRERKSLRNATAS----------------QSTPD-MPDDD
TBLA0A02530        LINQKNYSSDYLKKDSQIFAMRNRKEIRENAQT------------TTSLNNTPD-FQEGR
KNAG0B04020        VINQKNYSSDYIRKDDQIFALRERKFLRSAGTS------------NTTTTTTNN-GSNTN
NDAI0C01370        LINQKNYSSIYLKNDDQIFCLRDDKSLKNTSPN-------------QTSTATPDNIVESV
Kpol_543.10        LVNQKNCSSDYLKKDDQVFALRERKTLRNNTTV-------------STTANTPD-VVDLK
TPHA0J02790        LVNQKNCSSDYLKTNSQIFALRERKVLRNNTNIININSGNNSNSTSGTTANTPE-VSDLK
NCAS0H02290        LINQKNYSSDYLRKDEQIFALRERKTLRSNTTQ------------NISSSNTPE-VTDLQ
KAFR0E02530        LINQKNYSSDYIRKDDQIFALRERKTLRSSTNA------------NNNNTSTPKAVVDLK
Smik_15.320        LINQKNYSSDYLKKDDQIFALRDRKFLRNNNTT------------QVSSTNTPD-VIDLK
YOR141C            LINQKNYSSDYLKKDDQIFALRDRKFLRNNNTS------------QISSTNTPD-VIDLK
Suva_8.192         LINQKNYSSDYLKKDDQIFALRDRKFLRNNNTT------------QVSSTNTPD-VVDMK
Skud_15.304        LINQKNYSSDYLKKDDQIFALRDRKFLRNNNTT------------QVSSTNTPD-VVDLK
ZYRO0D11308g       LINQKNYSSDYLKKDEQVFALRDRKVLRNNTQV-------------PSMANTPD-VADLK
TDEL0A03410        LINQKNYSSDYLKKDEQIFALRERKTLRNNTQT-------------SSINNTPD-VIDIK
                   ::**** ** *:. :.: * :*: * :..                               

CAGL0I07161g       QSASMASSASLDALVDTDTKLQSVEDIDFNDPRLTIVIHPGSDSIKIGLATDEEPVSIPN
KLLA0E03213g       MA--------------------DSNAIED-DELDSIIIHPGSSFIKIGPNYDIFPQQVPN
AFR135W            GEDDLKLNG-------------DEDGIDDTEDANTIVIHPGSRSLKIGLSTDVFPLSVPS
Ecym_2311          VKTNG-----------------DEDGLDDTADTNTIVIHPGSRSLKIGLSTDVFPLSIPS
SAKL0G03608g       DND-------------------DNDDAEGTDDLNTIVIHPGSKFLKIGFATDVLPQSVPS
KLTH0F14960g       ----------------------DQESVDGESDAQTIVIHPGSRNLKIGLATEVLPQSIPC
Kwal_55.21250      ----------------------DQESVDGDSELNTIVIHPGSKSLKIGFATDVLPQSIPS
TBLA0A02530        GEANQAA---------------QDEDINLGDPSTTIVIHPGSKFLKIGYAQDPNPILIPS
KNAG0B04020        GVGSASHTPEVATSTIPNEFTLKSDDIDFTDATTTIVIQPGSESIKIGFATDETPLVIPN
NDAI0C01370        ATGINNKS--------------TGDQLNLNDPTKTIIIHTGSHSLKIGKALDENPIIVPN
Kpol_543.10        ALNNGSSASLVDEVLNK-----NDDDIDFNDPTTTIVIHPGSRYLKIGFAKDETPLVVPS
TPHA0J02790        NVNSESNVSLIDETILKN----NPDNIVFDDPTTTIVIHPGSRYLKIGFAKDDSPLVIPN
NCAS0H02290        SVRETSNFTTANG---------NNDEILLNDPNTTIVIHPGSSFLKVGFALDEVPELIPN
KAFR0E02530        TGV-------------------MDDEIDLNDPNSTIIIQPGSETMKIGFALDETPLLIPN
Smik_15.320        NLPHSEANT--AS---------LNEEIDLNDSTATIVIHPGSNSVKIGFPKDEHPVLVPN
YOR141C            SLPHSEASA--AP---------LNDEIDLNDPTATIVIHPGSNSIKIGFPKDDHPVVVPN
Suva_8.192         SLPNSEPST--AP---------LNDEIDLNDPTATIVIHPGSNSIKIGFPKDEHPIVVPN
Skud_15.304        NLSHTEPST--AP---------LNDEIDLNDPTATIVIHPGSNSIKIGFPKDEHPIIVPN
ZYRO0D11308g       RENGNTTELNEAA---------GDEDIDLSDANTTLVIHPGSNSLKVGFAKDESPFVIPS
TDEL0A03410        NTNTEVPDYI-AA---------ADEDIDLSDANTTLVIHPGSRHLRIGFAKDEVPLVVPS
                                           :         :::*:.**  :.:*   :  *  :* 

CAGL0I07161g       LVAVPRSQVV---------NPVDE--TPVNVLNIELDDQFHELTNQLKYNFKERMKYYKR
KLLA0E03213g       LVAVPTHGGT----------------VPSPQEDISNNEIFQQLKDDIQFDFKERMRYYKR
AFR135W            CVAVARRASQ----------------RLEPQQRYDKDEDFMEHLQQIQSDFKERMRYYKR
Ecym_2311          CVAIARSEQV----------------EVPSQPRYDNDEEFMGNLQQIQSDFKERMRYYKR
SAKL0G03608g       CIAIPRATKN-----------------SVRSPQIREPSEFDGLKSAIQQDFKERMRYYKR
KLTH0F14960g       CVAVPKRPRT----------------SDSTPEPQVDEEEYISAKESIQQDFKERMRYYKR
Kwal_55.21250      CVAVPKRSQS----------------LQGETKQPHDTEEYQETKDSIQQDFKERMRYYKR
TBLA0A02530        CVAVPKNQFL--------DTVSELN-DNFNYSK-DQSEKFDEYKNELLKSFKERMRFYKR
KNAG0B04020        CVAVPHSGET------------PIG-NAANLTR-DQPDQFLQFKEELQTSFKERMRHYKR
NDAI0C01370        CVAIPKQEYEGMTRNINTKDSIPTPPENNIFDSIAQSDEFNDLKLEIETNFKERMKYYKR
Kpol_543.10        CVAIPKNSLY--------SENV----RELSIDKIEDSERLVGMKAQLQQSFRERMRYYKR
TPHA0J02790        CVAFPKNSLY--------SENV----EETIVSK-EESDNFKTKKNQIQQSFRDRMRYYKR
NCAS0H02290        CVALPKTDFN--------NTNIIKS-KQTSVNI-EDNEKFESLKAEMEESFEERMRYYKR
KAFR0E02530        LVAIPKKDDS--------KGPS----TESKLNT-EQSEEFEDLKNELHSTFKERMRYYKR
Smik_15.320        CVAVPKKWLN--------LESSEND-EIFSLQR-EQSEKFHSIKSDMEKNFRERMRYYKR
YOR141C            CVAVPKKWLD--------LENSEHV-ENVCLQR-EQSEEFNNIKSEMEKNFRERMRYYKR
Suva_8.192         CVAVPKKWLN--------LANDQNE-GNISLQR-KQSEEFESIKSEMEKNFRERMRYYKR
Skud_15.304        CVAVPKKWLN--------LGNGPNE-DNISLQR-EQSDEFENIKSEMEKNFRERMRYYKR
ZYRO0D11308g       CVAIPKSELH--------NQIPMDQKNQTCYTR-DQPTEFEEIKAEMQHSFRERMRFYKR
TDEL0A03410        CVAIPKTELN--------DEF-----QEAPLKR-EQPEEFEELKSTIQHSFRERMRYYKR
                    :*..                                         :   * :**..***

CAGL0I07161g       KMQSNAHEQVTSFNSNSKPEEVSDKNDQGKID-WIYNAD-----KKYYGEDAQRCIGDEF
KLLA0E03213g       RIMPNSTEQAAAFNAKSDPELVPDLNDFGRIE-WIKDRS-----KSYYGHDATQCLPSDF
AFR135W            KIIPNSHEQVLSYNSRAQPEKIPEHNDLHRIE-WIKDAP---EGTIYYGEGAERCLPENF
Ecym_2311          KIIPNSHEQVLSYNSKCQPEKIPEHNDLHRIE-WIKKSD--ASTKVYYGEYAERCLPEGF
SAKL0G03608g       KVIPNAHDAVINFNSKVEPELIHEHNDLHRVE-WIQNGS-----NQFYGEEATRCLPSHF
KLTH0F14960g       KVIPNSHDIAVNFNARVTPEAIPEHNDLHRVD-WIQDAS-----KCYYGKDATRCLPSHF
Kwal_55.21250      KIIPNSHDIVVNFNSRVSPEIIPEHNDLHRID-WIDQPS-----RPYYGKEATRCLPSHF
TBLA0A02530        KVQTNGHEQVLSFNKNSKPEDVTEKNDIEDVNRWINDPQ-----KKYFGSDAIRCSKENF
KNAG0B04020        RVQLSSYDQVNTFNETTKPEIIEDQNDPAKIA-WRGQPDPQEGKTIYVGDEALLCLREHY
NDAI0C01370        RIQPNSCEQVKSFNKISKPEILPISNDPQRIQ-WINEST----NKRYYGSNAERCTDLHF
Kpol_543.10        KIQPNSHERVRTFNEQAKPEIVEDKNDHGRIE-WINNSD-----KIYFGEEAERCNKENF
TPHA0J02790        KIQNNSHERVRSFNIQSKPEKVEDKTEYNRVE-WITNPD-----KIYYGEEASRCSKDAF
NCAS0H02290        RIQPNGHDQVVSFNRLSKPESLPVQNDPAHID-WITDGT-----KRFYGDDALRCTDENF
KAFR0E02530        RIQPNSHEQVKSFNRNAQPETILDNNDPARIR-WITQND-----KVYYGNDALLCPESFF
Smik_15.320        KVPGNAHEQVISFNENSKPEIISEKNDPSPIK-WIFDDS-----KLYYGSDALRCVDEKF
YOR141C            KVPGNAHEQVVSFNENSKPEIISEKNDPSPIE-WIFDDS-----KLYYGSDALRCVDEKF
Suva_8.192         KVPGNAHEQVVSFNESSKPEVVSVKNDPSPIE-WIFDDS-----KLYYGSDALRCVDEKF
Skud_15.304        KVPGNAHEQVVSFNENSKPEIISEKNDPSPIE-WIFDDS-----KLYYGSDALRCVDEKF
ZYRO0D11308g       KVQPNAHEQVINFNKVSKPELIEDKNDYNRIN-WITTPD-----RRYYGADALRCSKDHF
TDEL0A03410        KVPFNAHEQVVSYNKNSKPQMIEDQNDPGAIN-WIKKSS-----KRYYGSEALKCSKETF
                   .:  .. : .  :*    *: :   .:   :  *            : *  *  *    :

CAGL0I07161g       ILRRPF---CKSGIFNLESNNYSSIQDLLGDVSELVDSALSS--DKFNITKSEYKHYKAV
KLLA0E03213g       KLRSPF----LNGSFNLNEPNYNSFQEILFDVEQLIVQSLAM--EKIGIERNQFSNYRVV
AFR135W            VIRYPF----SNGAFNVECPDYSSLQELLNDVTKLITFALSE--TKLGISRSQFPNYKVI
Ecym_2311          LLRYPF----ANGSFNVKSPNYNSLQELLNDVVNLITFALSE--TKLNISKSQFSSYNVV
SAKL0G03608g       TLRYPF----ARGSFNVESPYYMSFQELLGDVQSLLEYCLKQ--EKIDVTKQQFANYKIV
KLTH0F14960g       TVRHPF----WKGRFNIESPDYGSLQELLVDVSELLKFALSQ--PKIDVRPSQIPNYKVV
Kwal_55.21250      TVRHPF----WKGRFNIESPDYSSLQELLNDVCELLKFALSQ--PKIDVKPSQISNYKVV
TBLA0A02530        IIRYPF---INGGSFNIEAPYYRTLSELLSEVCEFLVHILTS--DTFQLKTSDFSSYKIV
KNAG0B04020        MHRRPFGCSEGKYLFNLDEKRYTSLAALLCDVSRLLEHAIDKLLKKRDKDTEKDIKYKAV
NDAI0C01370        KTRKPF---SNNGSFNIASTDYISLQDLLSDVTNLIEHSLTS--SPFDLKPSQFKEHKVV
Kpol_543.10        IIRYPF---NKGGSLNLDSPYYSSLPELLSDVTRLFEYALTK--RDESITQAQIQQCKVI
TPHA0J02790        IIRYPF---VKGGSFNITSPYYNSLPEIIGDISNLFEYALSQ--DRFNLKPSEYSKYKII
NCAS0H02290        IKRYPF---KKGGSFNTSSNSYKSLQDLLSDVVGLIEGTLSS--DKFNIKSSQFSQYKVV
KAFR0E02530        SHRKPFGTCRNGALFNLMGSSYSSVQELLGDVIKLIEFGLNK-----LLEAKNKDKYKAI
Smik_15.320        IIRKPF----KGGSFNINSPYYKSLAELISDVTKLLEYALKS--ETLNVKPAKFNQYKVV
YOR141C            VIRKPF----RGGSFNVKSPYYKSLAELISDVTKLLEHALNS--ETLNVKPTKFNQYKVV
Suva_8.192         VIRKPF----KGGCFNIDSPYYKSLAELISDVIKLLEYALDS--ETLNVKPTKFNQYKVV
Skud_15.304        VVRKPF----QGGSFNINSPYYESLAELISDVTKLLEYALAS--ETLNVKSTKFNQYKVV
ZYRO0D11308g       VIRYPI---VKGGSFNIASPDYRSLQDLMGDFTGLLEHVLRS--PRFQLKRSQFAQYKVV
TDEL0A03410        RIRCPF---TKGGSFNVSSPDYASLQDLINDVISLLEHALSA--EGLNLERAQFSQYKVV
                     * *:        :*     * :.  :: :.  :.   :            .    . :

CAGL0I07161g       IVIPDLFKKSHLETFIRLLLNEMDFRSVALMQESLATCYGAGISTPTCVVNIGAEQIRIA
KLLA0E03213g       LIVPDLFDKTFVESMIHLLLIELDFQSIALIQESLASCYGAGLSNSTCVIDIGAKQTKIA
AFR135W            LIIPDLFEKNYVEQMIRLLLSEMNFQAVALIQESLATCYGAGLSNSTCVIDIGASETKIS
Ecym_2311          LIIPDLFEKSYVEQMIRLLISEMDFQAVALIQESLASCYGAGLSNSTCVIDIGGSETKIS
SAKL0G03608g       LVIPDLYDKNYVETFIHLLLVQMGFQAVAIIQESLATTYGAGISNSTCVVDIGATSTKIA
KLTH0F14960g       IVVPDAFDKAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIA
Kwal_55.21250      IVVPDLYDKAYVETFIRLLLVDLNFQAVAIIQESLASCYGAGIGESTCVVDIGATTTKIA
TBLA0A02530        LVISDIFEKSHLEVMFRLLLNEMQFNAVAIIQESLATCYGAGVGSSTCVVNVGATQTRIA
KNAG0B04020        LVIPDLFEKSHVETMIRLLLSELPFNAVAIVQESLATCYGSGISTSTCVVNVGATGTKVA
NDAI0C01370        LIIPDSFGKSHVELFITLLLTHLKFQAVAIIQESLATCYGAGNSVPTCVVNLGASQTTVA
Kpol_543.10        LVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESLAACYGAGISTASCIVNIGATQTTIA
TPHA0J02790        LVIPDIFEKSHLETMFRVLLKEMKFQAVAIMQESLAASYGAGIGGATCIVNIGATQTRVA
NCAS0H02290        LVIPDSFEKSHVELFIRLLVTELQFQAVAIIQESLSVCYGSGLGGSTCVVNVGSKETTVA
KAFR0E02530        LVIPDLFEKSHVEEMIRLLLTELPFNAVAIIQESLATCYGAGISTSTCVVNVGASETSVS
Smik_15.320        LVIPDIFKKSHIETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGASETRIA
YOR141C            LVIPDIFKKSHVETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAETRIA
Suva_8.192         LVIPDVFKKSHVETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGATETRIA
Skud_15.304        LVIPDVFKKNHVETFIRVLLTELQFQAVAVIQESLATCYGAGISTSTCVVNIGATETRIA
ZYRO0D11308g       LVIPDLFEKSHVETLIRCLITEMQFQAVAIMQESLATCYGAGISTSTCVVNIGATQTRIA
TDEL0A03410        LVIPDLFHKSHVETFIRFLLTEMQFQAVAIIQESLAGCYGAGQSSSTCVVNIGATHTSIA
                   :::.* : * .:* :   *:  : *.::*::****:  **:* . .:*::::*.    ::

CAGL0I07161g       CVDDGTIIQDSAVTLDYGGNDVTNLLAILLQQSKFPYKNWNLSTLYGWKTAEDFKKKFVT
KLLA0E03213g       CVDDGVVVKNSALRLNYGGDDITRLFAHMLLQNKFPYADWNINEPNGWTLAETLKKQCIT
AFR135W            CVDEGQVIQNSCIRLSYGGDDITRLFVELLLQSNFPYPDWNLNTRQGWILAEQLKKTHIT
Ecym_2311          CVDEGQVIQNSCIKLSYGGDDITKLFAELLLQSNFPYEDWNLNTRQGWLLAEQLKKNHIT
SAKL0G03608g       CVDEGTVLGNSAVTLDYGGDDITRLFSQFLLQSKFPYDDWDLSTPHGWMLAESLKKEFTT
KLTH0F14960g       CVDEGLVIDNSVITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLKEKYAT
Kwal_55.21250      CVDEGLVNENSIINLDYGGDDITRLFARFLLESNFPYQDLDLDSPQGWSLVEQLKEKYTT
TBLA0A02530        CVDEGSIVEDSIVSLDYGGDDITKLFSILLLQSGFPYTDLNINAAHDWILAEKLKKDFVT
KNAG0B04020        CVDEGIVVENSIINLNYGGDDISKLFAVLLLMSNFPYQEWDIDSIPGRMIAEHLKKECLT
NDAI0C01370        CVDEGTVLENSMVSLNYGGNDITNIFATFLLQNDFPYHNWNLNSIEGWKLAEELKEKYIT
Kpol_543.10        CVDEGTVLENSLIKLDYGGDDITRLFTLFLLENNFPFQDLDLDSTHGWTLAEQLKKNYAT
TPHA0J02790        CIDEGTVSEHSLITLDYGGDDITKLFLHLLLQNEFPYQDLDINSSHGWRQIENLKKQFVT
NCAS0H02290        CVDEGIVLDNSLITLDYGSNDVTKLFAKFLLDCDFPYKNWDLNSTEGWRLAEELMKQCVT
KAFR0E02530        CIDEGVVLENSLINLNYGGDDITRLFSVLLKMNNFPYQDWNVESIAGWNIAETLKKQIVT
Smik_15.320        CVDEGTVLEHSAITLDYGGDDITRLFGLFLLQSDFPLQDWKINSEHGWLLAEQLKKNFTT
YOR141C            CVDEGTVLEHSAITLDYGGDDITRLFALFLLQSDFPLQDWKIDSKHGWLLAERLKKNFTT
Suva_8.192         CVDEGTVLENSAVTLDYGGDDITRLFALLLLQSDFPLQDWKINSEHGWLLAEQLKKNFTT
Skud_15.304        CVDEGTVLEHSAVTLNYGGDDITRLFALLLLQSDFPLQDWKIDTKHGWLLAEQLKKNFTT
ZYRO0D11308g       CVDEGTVLQDSCITLDYGSDDITKLFALFLLQSEFPYQDWDIETAHGWHLAEELKKNYTT
TDEL0A03410        CIDEGTVLENSLVSLDYGGDDLTKLFALFLLQSEFPYQDWDINSSHGWILAEELKKKYTT
                   *:*:* :   * : *.**.:*::.::  :*    **  : .:.   ..   * : :   *

CAGL0I07161g       FQDADIAVQLFNFIKRVP----GIP-SEKYDFKVFDEVILAPLGLFYPEIFKYIQERQRP
KLLA0E03213g       FQDADIAIQLYSFIKRDPYARKYTQ-SHKYEYKLFDEVMCAPMGIFFPDIFEVIKPK--Q
AFR135W            FQDADVAVQLFNFFKREP----SVPGAEKFEFKLFNEVMISPMAYFYPQILSFLKP---A
Ecym_2311          FQDADVAVQLFNFFKRNP----NISGAEKYEFKLFNEVMVSPMAYFYPQILALLKP---P
SAKL0G03608g       FQDANVAVQLYNFIKRTP----GEANAQKYEFKVFDEVMLAPMAMFFPKILSLLNPQ--K
KLTH0F14960g       FQDADVTIQLYNFIKRIP----NKPGAEKFEFKVFDEVMTAPMGLFFPHILRLLKDK--N
Kwal_55.21250      FQDADVTIQLYNFIKRIP----GKPGAEKFEFKVFDEVMTAPMGLFFPHVFPLLKEQ--N
TBLA0A02530        FHDANVTVQLYNFIKRVP----GQI-PQKYEFETFEEVMLAPLSLFYPQVLKLLKSEQLA
KNAG0B04020        FQDADITTQLFNFIKRVP----GLP-TEKIEFKTFDEVILAPLALFYPKIFSLLKPNKGK
NDAI0C01370        FQDMDVTVQLFNFIKRLP----GMDTIEKYDFKVFDDVMLAPLTLFFPKILKLMKEQQ-P
Kpol_543.10        FEDANMTVQLYNFVKRIP----GKV-SEKYEFKVFDEVILAPLALFYPDIFQELKKL--D
TPHA0J02790        FEDANITVQLYNFIKNKP----GAQ-AEKLEFKVFDEVINAPLGLFYPEIFRIMAEENEK
NCAS0H02290        FQDADITVQLSNFIKRTP---RGNT-VEKLDFKVFEEVMLAPLALFYPEIFKLLRSKE-S
KAFR0E02530        LQDADVTVQLSNFMKRVF----NEP-TEKYEFKTFDEVMLAPLALFAPRIFSYLRN---E
Smik_15.320        FQDADVAVQLYNFINRSP----NQP-TEKYEFKLFDEVMLAPLALFFPQIFKLIRT---S
YOR141C            FQDADVAVQLYNFMNRSP----NQP-TEKYEFKLFDEVMLAPLALFFPQIFKLIRT---S
Suva_8.192         FQDADIAVQLYNFINRSP----NKP-TEKYEFKLFDEVMLAPLALFFPQIFKLIRA---P
Skud_15.304        FQDADIAVQLYNFINRSP----NQP-SEKYEFKLFDEVMLAPLALFFPQIFKLIRS---S
ZYRO0D11308g       FQDANVTVQLYNFIKRIP----GQQ-AEKFDFKVFDEVILAPLSLFYPGIVAQLRNELKP
TDEL0A03410        FQDANVAVQLYNFIKRVP----DQQ-SEQYEFKVFDEVSLAPLALFYPEIISYLHSKSSQ
                   : * ::: ** .*.:.            : ::: *::*  :*:  * * :.  :      

CAGL0I07161g       TAKEYETTLLKQIEPSRDIYTNSLNDWRSITQRDCEEN--MIYCDAKDDLEIIQHALDLN
KLLA0E03213g       HKP--NEYVIRQCPRSKDIYTLKPNDTKSLTQMLCIQEPTKWYSNLSRDIDIVQKLLNLD
AFR135W            TSY--NKYMAQQLPESRDPYTYKPDNPKSIAQESAFTG--KVYTDINKDLDIIRKLVSVN
Ecym_2311          VEV--NKYVQQQLPPSRDPYTCKPDDPQSVSNLGSLSG--KWYTEMSKDLDIVRKLISIT
SAKL0G03608g       TQQ--EHYVTNQFPRSKDIYTLRDNNPRSISQRECHEN--KTYCDMTRDLDILQKILNLP
KLTH0F14960g       VPV--NKYVTSQLPRSKDMFTCKDNNPKSVSQLACQKK--TTYCDMHRDLDILQKLLNLP
Kwal_55.21250      NPT--NEYVKSQLPRSKDMFTCKDNNLKSVSQLACQKK--NTYCDMGRDLDILQKLLNLP
TBLA0A02530        KYK--NEQVKKQLPASRDIFTSELNDWKSIAQADCLNK--NLYSETSDEISMLKRTLNIH
KNAG0B04020        NLT--NPKLKYQLPDSRDLFTNKANNWKSLSEMDCATN--TLYSDMVQESVLLDNLLGIN
NDAI0C01370        QNR--NKFLQSQLPDSRDIYTTKINDWRSITQEECLES--KLFSYIDNELELLKRTLEVP
Kpol_543.10        SKN--KFNLEDQLPVSRDLYTDSINDWRSVSQLQCLDG--DLYAGNTNELDIITKVLNIN
TPHA0J02790        RRV--NKKLQDQLPPSTDLYTEERDDWRSLSQVQCLDN--DTYSGNDNDLDVITKLLNAN
NCAS0H02290        EEQ--NAELEYQLPPSRDIFTDKINDWRSLSQNDCINH--QTFCDIHDEYELLKKAVDCP
KAFR0E02530        ESK--NSTLQYQLPESKDLFTHELNDWRSMTQEACKNN--GSYCDISDELQLLTALLEVD
Smik_15.320        SDK--NSSLEFQLPESRDLFTNELNDWNSLSQFESKEG--NLYCNLDDDLEILKKILQAH
YOR141C            SHK--NSSLEFQLPESRDLFTNELNDWNSLSQFESKEG--NLYCDLNDDLKILNRILDAH
Suva_8.192         SGK--NSSLEFQLPESRDLFTNELNDWNSLSQFESKEG--DLYCNLNDDLKILNKTLDAH
Skud_15.304        SGK--NSNLEFQLPESRDLFTNELNDWNSLSQFESKEG--DLYSNLNDDLKILNKILEAH
ZYRO0D11308g       RSQ--NEKLESELPISRDIFTDNLDDWRSLSQTECLDN--QLYCGNQDEFQMLCKLLDAP
TDEL0A03410        HSG--NSNVESQLPASRDIFTNTVNDWRSLSQSECLDG--DLYSGNNNNQLIMSKLLDLQ
                        :  :  :   * * :*   :: .*:::  .       :     :  ::   :   

CAGL0I07161g       -THIEDLQSKHI---------EENTDKKCF-------VPLDKAIVQSITNAAINVD--IS
KLLA0E03213g       TDDLDEQNDDESAGSKEETQINDEIEDINLRQYNNLSMPLEKAIIESITNASMLLGDNMS
AFR135W            -DEVEALTSGPSERTSGDTIKTNTRRASNY-------TPLDKAIIESVTTASVLLGDNMS
Ecym_2311          -DKVEALSANSSDGTASDTIVENTEEVSNY-------MPLDKAIIESVTNAAVLLGDNMS
SAKL0G03608g       -DEIDEYSNSNL---------SKKHHHDNI-------TPLEKAIVESITNASISLDNNMS
KLTH0F14960g       -SEIEEYQSS-----------TCANLEPAY-------TPLEKAIVESITNACVSLDNNHS
Kwal_55.21250      -SEIEEYQSA-----------ASANVEPAY-------TALEKAIIESITNACVSLDNNHA
TBLA0A02530        -LNLEEIRDEIDK--------EHEIPNSNY-------TSLEKAIIQSIANASASLD--IS
KNAG0B04020        -SRREGPPKDSGV--------GSETTELNL-------TALDKSVIQSITNATLSLE--PG
NDAI0C01370        -ILLENFQNNS-P--------DNKNDKLNY-------TPLDVAIIQSIMNASTNID--MS
Kpol_543.10        -SSTEEYEGLE-T--------TEVDGRENY-------VPLEKAIIQSITNACVSMD--VS
TPHA0J02790        -LNLDDMDLIN-N--------DQNENEKNY-------TSLDKAIIQSITNAVVTMD--TS
NCAS0H02290        -NTLETFMDNP-P--------EEKKSTFNF-------TPLDKAIVESITTASLGLD--VS
KAFR0E02530        -SKLEAFQSEA-T--------TTLDNKRNM-------LPLDKAIIQSITDACLSLD--PS
Smik_15.320        -NMIDQLQDKPEN--------YGNISKENF-------APLEKAIIQSIANASITAD--VT
YOR141C            -NIIDQLQDKPEN--------YGNTLKENF-------APLEKAIVQSIANASITAD--VT
Suva_8.192         -TMIDQLQDKPEK--------YGSTSKENL-------TPLEKAIIQSITNASVTAD--VT
Skud_15.304        -TIIDQIQDKPEN--------YGDTSKENF-------APLEKAIIQSIANASITAD--VT
ZYRO0D11308g       -SRLDELQAEN-R--------LEPDIRQNY-------APLEKAIVQSITNACLSFD--VS
TDEL0A03410        -TSFDDFQSKP-P--------MEADSRKNY-------TPLEKAIIQSITNASTPID--VA
                       :                                 .*: ::::*:  *         

CAGL0I07161g       KISQFYSNIIIVGGGANIPALDFILSDRINIWRPAVLGISSFPNFYKSLTKQLKDIQ---
KLLA0E03213g       KLNVLYSNILIVGGSSKIPALDFILTDRINIWRPKLLSISALSTLMEKIGEVIKSYE---
AFR135W            KLVNFYSNLLVIGGSSKVPGLDLILTDRINIWRPRLLSVSTLPVVYKKVSEMVKQVE---
Ecym_2311          KLTNFYSNLLIVGGSSKVPGLDLILTDRINIWRPRLLSVSTLPVIYKKISDMVKQVE---
SAKL0G03608g       RLGNFYSNLLVVGGGSKFPSLDFILTDRINIWRPRLLSVNTISTFYKKVTQQIKDFE---
KLTH0F14960g       KAANFYSNILVVGGSSKFSSLDFILTDRINIWRPRLLSVNTLPTFQNQVSKQVKEFE---
Kwal_55.21250      KAAQFYSNILVVGGSSKFPSLDFILTDRINIWRPRLLSVNTLPTFHNQVSKQVKEFE---
TBLA0A02530        KINSFYSNILLVGGGAKIPSLDFILEDRIKIWRPRLLSVNSFPTFYKKLTKLIKELP---
KNAG0B04020        KMASFYSNILIVGGSSNIPGFDTILKDRINMWRPKLIALASFPNFYNELVKEIKDLETSA
NDAI0C01370        KMSSFYSNILVVGGGSKIPALDFILTDRINIWRPRLLSLTSFPNFYKELSKDIKDLQNHY
Kpol_543.10        KMNQFYANIMVVGGTSNIPQLDFVLTDRINIWRPKALCNTTFPHFFKNISKQVKEIQ---
TPHA0J02790        KMTQFYNNIMVVGGSSSIPSLDFILTDRINIWRPRILSSREFPSFFRNLVKQVKDFN---
NCAS0H02290        KMATFYSNILVVGGGSKIPGFDLMLMDRVNIWRPRLLSLRAFTHFYRELTKQLKELQ---
KAFR0E02530        KMDSFYSNILVVGGSSNIPAFDFMLTDRINIWRPRLLSLSSFPQFYKNLSKEIKDLE--M
Smik_15.320        RMNSFYSNILIVGGSSKIPALDFILTDRINIWRPSLLSSASFPQFYKKLTKEIKDLE---
YOR141C            RMNSFYSNILIVGGSSKIPALDFILTDRINIWRPSLLSSASFPQFYKKLTKEIKDLE---
Suva_8.192         RMSSFYSNILIVGGSSKIPALDFILTDRINIWRPSLLSSTSFPQFYKKLTKEIKDLE---
Skud_15.304        RMNSFYSNILIVGGTSKIPALDFILTDRINIWRPSLLSSASFPQFYKKLTKEIKDLE---
ZYRO0D11308g       KMSSFYSNILVCGGGSNVPAFDFILTDRINIWRPRILSHTSFPDLYKKLSKQIKDIK---
TDEL0A03410        KMSSFYSNILVVGGGSKIPALDFILTDRINIWRPRLLSLTSFPNFYKKLAKQAKDIK---
                   .   :* *::: ** :... :* :* **:::***  :    :. .  .: .  *.     

CAGL0I07161g       ------------------------------T-----------------------------
KLLA0E03213g       ----------------------------TDN-----------------------------
AFR135W            ----------------------------NEI-----------------------------
Ecym_2311          ----------------------------SEI-----------------------------
SAKL0G03608g       ----------------------------QEN-----------------------------
KLTH0F14960g       ----------------------------QTQ-----------------------------
Kwal_55.21250      ----------------------------QTN-----------------------------
TBLA0A02530        ------------------------------N-----------------------------
KNAG0B04020        KTSSAAIVTGGTATATPAPVLNDDDAPKEVP-----------------------------
NDAI0C01370        LKLISTATAATTQTTATATTNNNTTNSTSNSTPAITQVPSGTNISNNLNSTKIDNTPGAE
Kpol_543.10        ------------------------------S-----------------------------
TPHA0J02790        ------------------------------T-----------------------------
NCAS0H02290        ------------------------------S-----------------------------
KAFR0E02530        ESQSTAKLQAQTGSVVPTTGSSTPLATNAGN-----------------------------
Smik_15.320        ----------------------------SHF-----------------------------
YOR141C            ----------------------------GHY-----------------------------
Suva_8.192         ----------------------------SHF-----------------------------
Skud_15.304        ----------------------------SHF-----------------------------
ZYRO0D11308g       ---------------------------NSVK-----------------------------
TDEL0A03410        ----------------------------TAG-----------------------------
                                                                               

CAGL0I07161g       SNKSNTGDKSQEQEVAERSIALVKVELDKLVASLE-IPNSGDHFFTVGVLPAPRNLDPSL
KLLA0E03213g       KLDLEPTDPQAAIAYKKKLSKLIKAEIEAYWDSLQ-TLHSDDDLLPINILPPPHDMDPSM
AFR135W            KKN-NPESEEEIAQSRKKLIKSIKIELENYWESVD-PY---EHVYPIAVLPPPREMDPSM
Ecym_2311          KKN-NVESEEEIQQSRKKLIKSIKIELENYWESVD-PY---EHVYPITVLPPPREMDPSM
SAKL0G03608g       KVS-EVTDPEQLATLKKKLLKMVKLELQSYWESVD-ALGGNENVFPINVLPPPRDMDPAV
KLTH0F14960g       KLS-EIKDEEELAAQKKKLAKTIKVELQSYWEGVD-ALGGNESVFPANVLPAPREMDPAL
Kwal_55.21250      KLS-EIKEEEELLSQKKKLAKTIKMELQSYWEGVD-ALGGNESVFPINVLPAPREMDPAL
TBLA0A02530        YGK-TNKTSEEEESLKKAIDELIKTEFEAYGPILE-QQASNDSFFPVSILPSPRNMDPAE
KNAG0B04020        EVK-ETSSDAKEYELNEKIQKLIEERLEKYLSAIE-RQNGNEHFMPVSVTPAPHNMNPSL
NDAI0C01370        TNEVEEAVNKLKREMDDKINELLKEKLEEYLETVEKAQNGNDHYLPVSVVPAPRDIDPAL
Kpol_543.10        TSK-ASTTPEEEEKIKQSIKELIETELRKYLNSIE-SQGNGDHSYPVAVLPPPRDMNPEV
TPHA0J02790        ANKSNNRPEEGEEEQKKGIAELIKTELKKYKDNLE-SQNANEHLLPVSVLPPPADMDPSV
NCAS0H02290        LKTGDGEEEIKEDELNEKISELIKTELTKYLEVIE-QQSGNEHFLPVEVIPSPNEIDPGS
KAFR0E02530        DGETMADLNEVSKKLSSNINDLIKTKLQDYISNVE-SQNSNEHYFPVGVVPPPRDMSAAI
Smik_15.320        VNAPDKTEEENKLVLQRQIKEKVVEELDEQHQNIE-NQNGNEHVFPISIIPPPRDMNPAL
YOR141C            VNAPDKTEDENKQILQAQIKEKIVEELEEQHQNIE-HQNGNEHIFPVSIIPPPRDMNPAL
Suva_8.192         VSAPEKTEEENKQVLQLQINEKVVAELDEQHQSIE-HQNGNEHLFPISIIPPPRDMNPAL
Skud_15.304        VNAPDKTEEENKQVMQSQIKDKVVAELDEQHQNIE-NQNGNEHLFPVSIIPPPRDMNPAL
ZYRO0D11308g       NGEGKSNGPQEDEQLKEKVQEVIKKELERYHELIE-SQNNADHTLPVSVLPPPRDLDPAI
TDEL0A03410        ----KTGESEEEDQSSKKINEMISAELQAYWDSIE-AQNGSEHLLPVNVLPPPRDMDAAE
                                         :   :      ::      :   .  : *.* ::..  

CAGL0I07161g       LDWKGASVLAQIKLIEELYISRNDWDVHGNRVLQYKCIFAY---
KLLA0E03213g       LTWKGGSVFSKIKLLEELNITKQDWNMLGNRILQYKCIFEYFDH
AFR135W            LTWKGGSVFGRIKLCEELYITAMDWEMLGSRILKYKCIFDY---
Ecym_2311          LTWKGGSVFGRIKLCEELYITEMDWEMLGSRILKYKCIFDY---
SAKL0G03608g       LTWKGGSVLARIKLVEELYITAKDWDVLGSRILQYKCIFDY---
KLTH0F14960g       LTWKGGSVFARLKLIEELYVSESDWDILGSRILQYKCIFDY---
Kwal_55.21250      LTWKGGSVFARLKLIEELYVSANDWDVLNSRILQYKCIFDY---
TBLA0A02530        LIWKGASVLAQIKLVEELFVTTADWDMHGSRILQHKCIFTY---
KNAG0B04020        LPWRGAGVLAQIKLIEELFVTNIDWDVHGSRVLQHKCIFTY---
NDAI0C01370        ILWKGASVLAQLKIIEELYMTNADWDVHGSRILQYKSIFPY---
Kpol_543.10        LNWKGASVLAQIKLIEELFVTNTDWDMLGSRILQYKCLFTY---
TPHA0J02790        LNWKGASVLGQLKLIEELYVTNADWDMLGSRILQYKCLFPY---
NCAS0H02290        IAWKGASVLAQIKLVEELFITNGDWDVHGNRILQYKSILTY---
KAFR0E02530        LSWKGASVLAQIKLVEELFITNLDWDMHGSRILQHKCIFTY---
Smik_15.320        IIWKGASVLAQIKLVEELFITNNDWDVHGSRILQYKCIFTY---
YOR141C            IIWKGASVLAQIKLVEELFITNSDWDVHGSRILQYKCIFTY---
Suva_8.192         IIWKGASVLAQIKLVEELFITNNDWDVHGSRILQYKCIFTY---
Skud_15.304        IIWKGASVLAQIKLVEELFITNNDWDVHGSRILQYKCIFTY---
ZYRO0D11308g       LIWKGASVLAQIKLVEELYLTGADWDIHGSRILQYKCIFTY---
TDEL0A03410        LAWKGACVLAQIKLVEELYLTSTDWDIHGSRILQYKCLFTY---
                   : *.*. *:..:*: *** ::  **:: ..*:*::*.:: *   

FASTA FORMAT for MUSCLE Version 3.6

>CAGL0I07161g
--------MSRESSVNSSMVED-----------------EDSASDMDADLDEENARKH--
-----------------------------------GRSDDGEDTGDDNADDNADDNADDN
GDADTSVDGASTRR----------------------------------GKKKYQKYPDLD
PLKAPP----GKKVPLHLLEKRRLGRLKAAEEFARKLKVVGIERVENLNLPQSGLFSPVP
LINQKNYSSDYLRKDENAFAVRERKQMRNSNAN------------NSAHAKTSE-LGSGA
QSASMASSASLDALVDTDTKLQSVEDIDFNDPRLTIVIHPGSDSIKIGLATDEEPVSIPN
LVAVPRSQVV---------NPVDE--TPVNVLNIELDDQFHELTNQLKYNFKERMKYYKR
KMQSNAHEQVTSFNSNSKPEEVSDKNDQGKID-WIYNAD-----KKYYGEDAQRCIGDEF
ILRRPF---CKSGIFNLESNNYSSIQDLLGDVSELVDSALSS--DKFNITKSEYKHYKAV
IVIPDLFKKSHLETFIRLLLNEMDFRSVALMQESLATCYGAGISTPTCVVNIGAEQIRIA
CVDDGTIIQDSAVTLDYGGNDVTNLLAILLQQSKFPYKNWNLSTLYGWKTAEDFKKKFVT
FQDADIAVQLFNFIKRVP----GIP-SEKYDFKVFDEVILAPLGLFYPEIFKYIQERQRP
TAKEYETTLLKQIEPSRDIYTNSLNDWRSITQRDCEEN--MIYCDAKDDLEIIQHALDLN
-THIEDLQSKHI---------EENTDKKCF-------VPLDKAIVQSITNAAINVD--IS
KISQFYSNIIIVGGGANIPALDFILSDRINIWRPAVLGISSFPNFYKSLTKQLKDIQ---
------------------------------T-----------------------------
SNKSNTGDKSQEQEVAERSIALVKVELDKLVASLE-IPNSGDHFFTVGVLPAPRNLDPSL
LDWKGASVLAQIKLIEELYISRNDWDVHGNRVLQYKCIFAY---
>KLLA0E03213g
--------MDTEIDPTESPSKE-------------------PSKEPSKEPLLGSDGKI--
------------------------------------------------------------
------------------------------------------------------------
-SKDIP----SKKVPQHLLEKRRLGRIKAAEEFAKKLKIIGIERQENEHIAQPITLKPVS
VINQKNYSSNYLKNDDQIFYMRERKHLRQQGQTGGS------SSAPAAGIGTPA-LDDDN
MA--------------------DSNAIED-DELDSIIIHPGSSFIKIGPNYDIFPQQVPN
LVAVPTHGGT----------------VPSPQEDISNNEIFQQLKDDIQFDFKERMRYYKR
RIMPNSTEQAAAFNAKSDPELVPDLNDFGRIE-WIKDRS-----KSYYGHDATQCLPSDF
KLRSPF----LNGSFNLNEPNYNSFQEILFDVEQLIVQSLAM--EKIGIERNQFSNYRVV
LIVPDLFDKTFVESMIHLLLIELDFQSIALIQESLASCYGAGLSNSTCVIDIGAKQTKIA
CVDDGVVVKNSALRLNYGGDDITRLFAHMLLQNKFPYADWNINEPNGWTLAETLKKQCIT
FQDADIAIQLYSFIKRDPYARKYTQ-SHKYEYKLFDEVMCAPMGIFFPDIFEVIKPK--Q
HKP--NEYVIRQCPRSKDIYTLKPNDTKSLTQMLCIQEPTKWYSNLSRDIDIVQKLLNLD
TDDLDEQNDDESAGSKEETQINDEIEDINLRQYNNLSMPLEKAIIESITNASMLLGDNMS
KLNVLYSNILIVGGSSKIPALDFILTDRINIWRPKLLSISALSTLMEKIGEVIKSYE---
----------------------------TDN-----------------------------
KLDLEPTDPQAAIAYKKKLSKLIKAEIEAYWDSLQ-TLHSDDDLLPINILPPPHDMDPSM
LTWKGGSVFSKIKLLEELNITKQDWNMLGNRILQYKCIFEYFDH
>AFR135W
--------MYLAMQYHHSSRRQ-----------------WIVSMDDEREMSVEMDVSI--
--------------------------------------MDPIPTTEGKVS----------
-------------------------------------------------------KPETA
GAAAGQ----GKKVPQHLLEKRRLGRIKAAEEFARKLKKIGIEKQDNLHISQTGLFRPLP
LINQKNYSSDYLRKDDQIFSMRERKSLRSGNVN------------PVNSSQPPT-LLAEA
GEDDLKLNG-------------DEDGIDDTEDANTIVIHPGSRSLKIGLSTDVFPLSVPS
CVAVARRASQ----------------RLEPQQRYDKDEDFMEHLQQIQSDFKERMRYYKR
KIIPNSHEQVLSYNSRAQPEKIPEHNDLHRIE-WIKDAP---EGTIYYGEGAERCLPENF
VIRYPF----SNGAFNVECPDYSSLQELLNDVTKLITFALSE--TKLGISRSQFPNYKVI
LIIPDLFEKNYVEQMIRLLLSEMNFQAVALIQESLATCYGAGLSNSTCVIDIGASETKIS
CVDEGQVIQNSCIRLSYGGDDITRLFVELLLQSNFPYPDWNLNTRQGWILAEQLKKTHIT
FQDADVAVQLFNFFKREP----SVPGAEKFEFKLFNEVMISPMAYFYPQILSFLKP---A
TSY--NKYMAQQLPESRDPYTYKPDNPKSIAQESAFTG--KVYTDINKDLDIIRKLVSVN
-DEVEALTSGPSERTSGDTIKTNTRRASNY-------TPLDKAIIESVTTASVLLGDNMS
KLVNFYSNLLVIGGSSKVPGLDLILTDRINIWRPRLLSVSTLPVVYKKVSEMVKQVE---
----------------------------NEI-----------------------------
KKN-NPESEEEIAQSRKKLIKSIKIELENYWESVD-PY---EHVYPIAVLPPPREMDPSM
LTWKGGSVFGRIKLCEELYITAMDWEMLGSRILKYKCIFDY---
>Ecym_2311
-------------------------------------------MDDEREMSVEMDVSM--
--------------------------------------EVTAAATEGKVT----------
-------------------------------------------------------KPETG
GVASTQ----SKKVPQHLLEKRRLGRIKAAEEFARKLKKIGIEKQDNIHISQTGLFRVHS
LINQKNYSSDYLRKDDQIFSMRERKNLRSGNVN-------SITNSSQPLIALPD-VQDDE
VKTNG-----------------DEDGLDDTADTNTIVIHPGSRSLKIGLSTDVFPLSIPS
CVAIARSEQV----------------EVPSQPRYDNDEEFMGNLQQIQSDFKERMRYYKR
KIIPNSHEQVLSYNSKCQPEKIPEHNDLHRIE-WIKKSD--ASTKVYYGEYAERCLPEGF
LLRYPF----ANGSFNVKSPNYNSLQELLNDVVNLITFALSE--TKLNISKSQFSSYNVV
LIIPDLFEKSYVEQMIRLLISEMDFQAVALIQESLASCYGAGLSNSTCVIDIGGSETKIS
CVDEGQVIQNSCIKLSYGGDDITKLFAELLLQSNFPYEDWNLNTRQGWLLAEQLKKNHIT
FQDADVAVQLFNFFKRNP----NISGAEKYEFKLFNEVMVSPMAYFYPQILALLKP---P
VEV--NKYVQQQLPPSRDPYTCKPDDPQSVSNLGSLSG--KWYTEMSKDLDIVRKLISIT
-DKVEALSANSSDGTASDTIVENTEEVSNY-------MPLDKAIIESVTNAAVLLGDNMS
KLTNFYSNLLIVGGSSKVPGLDLILTDRINIWRPRLLSVSTLPVIYKKISDMVKQVE---
----------------------------SEI-----------------------------
KKN-NVESEEEIQQSRKKLIKSIKIELENYWESVD-PY---EHVYPITVLPPPREMDPSM
LTWKGGSVFGRIKLCEELYITEMDWEMLGSRILKYKCIFDY---
>SAKL0G03608g
--------MTEDTPE----------------PHDTSVMEEDPALPGALDEYDEEVGVS--
-----------------------------TGENGTPLSMTPVPPATSGKV----------
------------------------------------------------------KKPDT-
--HIPP----GKKVPMHLLEKRRLGRIKAAEEFAKKLKTIGIEKRDNSALQQTGLFKPLL
LINQKNYSSDYLKKDDQIFAMRERKSLRNPNSG----NGNGNTGNNAVSNATPEVIPEEE
DND-------------------DNDDAEGTDDLNTIVIHPGSKFLKIGFATDVLPQSVPS
CIAIPRATKN-----------------SVRSPQIREPSEFDGLKSAIQQDFKERMRYYKR
KVIPNAHDAVINFNSKVEPELIHEHNDLHRVE-WIQNGS-----NQFYGEEATRCLPSHF
TLRYPF----ARGSFNVESPYYMSFQELLGDVQSLLEYCLKQ--EKIDVTKQQFANYKIV
LVIPDLYDKNYVETFIHLLLVQMGFQAVAIIQESLATTYGAGISNSTCVVDIGATSTKIA
CVDEGTVLGNSAVTLDYGGDDITRLFSQFLLQSKFPYDDWDLSTPHGWMLAESLKKEFTT
FQDANVAVQLYNFIKRTP----GEANAQKYEFKVFDEVMLAPMAMFFPKILSLLNPQ--K
TQQ--EHYVTNQFPRSKDIYTLRDNNPRSISQRECHEN--KTYCDMTRDLDILQKILNLP
-DEIDEYSNSNL---------SKKHHHDNI-------TPLEKAIVESITNASISLDNNMS
RLGNFYSNLLVVGGGSKFPSLDFILTDRINIWRPRLLSVNTISTFYKKVTQQIKDFE---
----------------------------QEN-----------------------------
KVS-EVTDPEQLATLKKKLLKMVKLELQSYWESVD-ALGGNENVFPINVLPPPRDMDPAV
LTWKGGSVLARIKLVEELYITAKDWDVLGSRILQYKCIFDY---
>KLTH0F14960g
--------------MTSSQALE---------PPS-----EDVPMGDAEDAEMEHEGDY--
-----------------------------STADQTPLSMTPALSSNPNAS----------
------------------------------------------------------KVKKPD
P-HAKQ----QTKVPGHLLEKRRLGRQKAAEQYAQKMKTIGIEKRDNPLLHQLGLFKPLS
LINQKNYSSDYLKRDDQIFAMRERKSLRNANAN----------------QATPD-MPEDD
----------------------DQESVDGESDAQTIVIHPGSRNLKIGLATEVLPQSIPC
CVAVPKRPRT----------------SDSTPEPQVDEEEYISAKESIQQDFKERMRYYKR
KVIPNSHDIAVNFNARVTPEAIPEHNDLHRVD-WIQDAS-----KCYYGKDATRCLPSHF
TVRHPF----WKGRFNIESPDYGSLQELLVDVSELLKFALSQ--PKIDVRPSQIPNYKVV
IVVPDAFDKAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIA
CVDEGLVIDNSVITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLKEKYAT
FQDADVTIQLYNFIKRIP----NKPGAEKFEFKVFDEVMTAPMGLFFPHILRLLKDK--N
VPV--NKYVTSQLPRSKDMFTCKDNNPKSVSQLACQKK--TTYCDMHRDLDILQKLLNLP
-SEIEEYQSS-----------TCANLEPAY-------TPLEKAIVESITNACVSLDNNHS
KAANFYSNILVVGGSSKFSSLDFILTDRINIWRPRLLSVNTLPTFQNQVSKQVKEFE---
----------------------------QTQ-----------------------------
KLS-EIKDEEELAAQKKKLAKTIKVELQSYWEGVD-ALGGNESVFPANVLPAPREMDPAL
LTWKGGSVFARLKLIEELYVSESDWDILGSRILQYKCIFDY---
>Kwal_55.21250
--------------MTSSLAQE---------PAS-----EDMPMGDVEEEEIEHEGDY--
-----------------------------STADQTPMSMTPALSSHSNAS----------
------------------------------------------------------KVKKPD
P-QVKQ----NTKVPGHLLEKRRLGRQKAAEQYAQKMKTIGIEKRDNPLLHQLGLFKPLS
LINQKNYSSDYLKRDDQIFAMRERKSLRNATAS----------------QSTPD-MPDDD
----------------------DQESVDGDSELNTIVIHPGSKSLKIGFATDVLPQSIPS
CVAVPKRSQS----------------LQGETKQPHDTEEYQETKDSIQQDFKERMRYYKR
KIIPNSHDIVVNFNSRVSPEIIPEHNDLHRID-WIDQPS-----RPYYGKEATRCLPSHF
TVRHPF----WKGRFNIESPDYSSLQELLNDVCELLKFALSQ--PKIDVKPSQISNYKVV
IVVPDLYDKAYVETFIRLLLVDLNFQAVAIIQESLASCYGAGIGESTCVVDIGATTTKIA
CVDEGLVNENSIINLDYGGDDITRLFARFLLESNFPYQDLDLDSPQGWSLVEQLKEKYTT
FQDADVTIQLYNFIKRIP----GKPGAEKFEFKVFDEVMTAPMGLFFPHVFPLLKEQ--N
NPT--NEYVKSQLPRSKDMFTCKDNNLKSVSQLACQKK--NTYCDMGRDLDILQKLLNLP
-SEIEEYQSA-----------ASANVEPAY-------TALEKAIIESITNACVSLDNNHA
KAAQFYSNILVVGGSSKFPSLDFILTDRINIWRPRLLSVNTLPTFHNQVSKQVKEFE---
----------------------------QTN-----------------------------
KLS-EIKEEEELLSQKKKLAKTIKMELQSYWEGVD-ALGGNESVFPINVLPAPREMDPAL
LTWKGGSVFARLKLIEELYVSANDWDVLNSRILQYKCIFDY---
>TBLA0A02530
--------MSEDQNSSADDQIG--------TPIGNTQEQGQDQDDDANSNYDSNEDSIDV
Q----------------------------DLADDSTIDIKQDSDNENENEDIGDDKSEEK
HNVISNKVIIKRKPGRKRRPNNDYGETPLAD-----------------TKIPSKKNPKID
SSK-------NKKFHLHLLEKRRLGRLKAAEEFAKKLKQSGIEKIETLTVNPTGLFQPAM
LINQKNYSSDYLKKDSQIFAMRNRKEIRENAQT------------TTSLNNTPD-FQEGR
GEANQAA---------------QDEDINLGDPSTTIVIHPGSKFLKIGYAQDPNPILIPS
CVAVPKNQFL--------DTVSELN-DNFNYSK-DQSEKFDEYKNELLKSFKERMRFYKR
KVQTNGHEQVLSFNKNSKPEDVTEKNDIEDVNRWINDPQ-----KKYFGSDAIRCSKENF
IIRYPF---INGGSFNIEAPYYRTLSELLSEVCEFLVHILTS--DTFQLKTSDFSSYKIV
LVISDIFEKSHLEVMFRLLLNEMQFNAVAIIQESLATCYGAGVGSSTCVVNVGATQTRIA
CVDEGSIVEDSIVSLDYGGDDITKLFSILLLQSGFPYTDLNINAAHDWILAEKLKKDFVT
FHDANVTVQLYNFIKRVP----GQI-PQKYEFETFEEVMLAPLSLFYPQVLKLLKSEQLA
KYK--NEQVKKQLPASRDIFTSELNDWKSIAQADCLNK--NLYSETSDEISMLKRTLNIH
-LNLEEIRDEIDK--------EHEIPNSNY-------TSLEKAIIQSIANASASLD--IS
KINSFYSNILLVGGGAKIPSLDFILEDRIKIWRPRLLSVNSFPTFYKKLTKLIKELP---
------------------------------N-----------------------------
YGK-TNKTSEEEESLKKAIDELIKTEFEAYGPILE-QQASNDSFFPVSILPSPRNMDPAE
LIWKGASVLAQIKLVEELFVTTADWDMHGSRILQHKCIFTY---
>KNAG0B04020
-----MESELGTTAEVPVLEED---------ANSAASSSQDPGRDDGLHDSAQEDVSVMD
DDTSGE-----DDEEEDDDDDDDERDDHVSKKMKVGLSKVGSPSGSSNNDDNNNDEDKKN
NKNNNDGAVAAMETAVGDVPSATASPTPSVV-----------------MNGAADEKQEKD
SKSAA-----GKKVPLHLLEKRRLGRIKAAEEFAKKLKQIGIEKVDSTTLPSTGGLKPLI
VINQKNYSSDYIRKDDQIFALRERKFLRSAGTS------------NTTTTTTNN-GSNTN
GVGSASHTPEVATSTIPNEFTLKSDDIDFTDATTTIVIQPGSESIKIGFATDETPLVIPN
CVAVPHSGET------------PIG-NAANLTR-DQPDQFLQFKEELQTSFKERMRHYKR
RVQLSSYDQVNTFNETTKPEIIEDQNDPAKIA-WRGQPDPQEGKTIYVGDEALLCLREHY
MHRRPFGCSEGKYLFNLDEKRYTSLAALLCDVSRLLEHAIDKLLKKRDKDTEKDIKYKAV
LVIPDLFEKSHVETMIRLLLSELPFNAVAIVQESLATCYGSGISTSTCVVNVGATGTKVA
CVDEGIVVENSIINLNYGGDDISKLFAVLLLMSNFPYQEWDIDSIPGRMIAEHLKKECLT
FQDADITTQLFNFIKRVP----GLP-TEKIEFKTFDEVILAPLALFYPKIFSLLKPNKGK
NLT--NPKLKYQLPDSRDLFTNKANNWKSLSEMDCATN--TLYSDMVQESVLLDNLLGIN
-SRREGPPKDSGV--------GSETTELNL-------TALDKSVIQSITNATLSLE--PG
KMASFYSNILIVGGSSNIPGFDTILKDRINMWRPKLIALASFPNFYNELVKEIKDLETSA
KTSSAAIVTGGTATATPAPVLNDDDAPKEVP-----------------------------
EVK-ETSSDAKEYELNEKIQKLIEERLEKYLSAIE-RQNGNEHFMPVSVTPAPHNMNPSL
LPWRGAGVLAQIKLIEELFVTNIDWDVHGSRVLQHKCIFTY---
>NDAI0C01370
--------MSQETPESSVIYEE---------PIDIPI-EDDDEDDDVDEEDVKAESLTST
DKQQNHIPAEDNVDYDNDNDNDNDTNTKKMDPPTISRSVTATPIDQSLSTKHPRDSERED
NDDNDNQENENENEDELPSSSGANTPKASTPPLTPTPTTASTNKKLKSKEEAYKKYPKMD
PKKVPP----GKKVPLHLLEKRRLGRIKAAEEFAKKLKEAGIEKVESVTVPPTGLFQPLN
LINQKNYSSIYLKNDDQIFCLRDDKSLKNTSPN-------------QTSTATPDNIVESV
ATGINNKS--------------TGDQLNLNDPTKTIIIHTGSHSLKIGKALDENPIIVPN
CVAIPKQEYEGMTRNINTKDSIPTPPENNIFDSIAQSDEFNDLKLEIETNFKERMKYYKR
RIQPNSCEQVKSFNKISKPEILPISNDPQRIQ-WINEST----NKRYYGSNAERCTDLHF
KTRKPF---SNNGSFNIASTDYISLQDLLSDVTNLIEHSLTS--SPFDLKPSQFKEHKVV
LIIPDSFGKSHVELFITLLLTHLKFQAVAIIQESLATCYGAGNSVPTCVVNLGASQTTVA
CVDEGTVLENSMVSLNYGGNDITNIFATFLLQNDFPYHNWNLNSIEGWKLAEELKEKYIT
FQDMDVTVQLFNFIKRLP----GMDTIEKYDFKVFDDVMLAPLTLFFPKILKLMKEQQ-P
QNR--NKFLQSQLPDSRDIYTTKINDWRSITQEECLES--KLFSYIDNELELLKRTLEVP
-ILLENFQNNS-P--------DNKNDKLNY-------TPLDVAIIQSIMNASTNID--MS
KMSSFYSNILVVGGGSKIPALDFILTDRINIWRPRLLSLTSFPNFYKELSKDIKDLQNHY
LKLISTATAATTQTTATATTNNNTTNSTSNSTPAITQVPSGTNISNNLNSTKIDNTPGAE
TNEVEEAVNKLKREMDDKINELLKEKLEEYLETVEKAQNGNDHYLPVSVVPAPRDIDPAL
ILWKGASVLAQLKIIEELYMTNADWDVHGSRILQYKSIFPY---
>Kpol_543.10
MASDDETANGSAVGNSSVVFEEQVADVASGEGNSSEVSGDKQNSNNKVDEVDEIEEDE--
------------IEGEDDEDEEE------QDQPSEMSSIMGTPIGDHGSVGNGKHSEFSP
KKRKLDNKIIESTDSKKQD-----------------------------KAESPEKGNNTD
SGNATPSTTENKKVPRHLLEKRRLGRLKAAEAFAAKLKKTGIERVDNSHLQQTGLFGQML
LVNQKNCSSDYLKKDDQVFALRERKTLRNNTTV-------------STTANTPD-VVDLK
ALNNGSSASLVDEVLNK-----NDDDIDFNDPTTTIVIHPGSRYLKIGFAKDETPLVVPS
CVAIPKNSLY--------SENV----RELSIDKIEDSERLVGMKAQLQQSFRERMRYYKR
KIQPNSHERVRTFNEQAKPEIVEDKNDHGRIE-WINNSD-----KIYFGEEAERCNKENF
IIRYPF---NKGGSLNLDSPYYSSLPELLSDVTRLFEYALTK--RDESITQAQIQQCKVI
LVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESLAACYGAGISTASCIVNIGATQTTIA
CVDEGTVLENSLIKLDYGGDDITRLFTLFLLENNFPFQDLDLDSTHGWTLAEQLKKNYAT
FEDANMTVQLYNFVKRIP----GKV-SEKYEFKVFDEVILAPLALFYPDIFQELKKL--D
SKN--KFNLEDQLPVSRDLYTDSINDWRSVSQLQCLDG--DLYAGNTNELDIITKVLNIN
-SSTEEYEGLE-T--------TEVDGRENY-------VPLEKAIIQSITNACVSMD--VS
KMNQFYANIMVVGGTSNIPQLDFVLTDRINIWRPKALCNTTFPHFFKNISKQVKEIQ---
------------------------------S-----------------------------
TSK-ASTTPEEEEKIKQSIKELIETELRKYLNSIE-SQGNGDHSYPVAVLPPPRDMNPEV
LNWKGASVLAQIKLIEELFVTNTDWDMLGSRILQYKCLFTY---
>TPHA0J02790
-----MTIAAKTIEKEGATKEEIASNNDLKVDVDGSNRVDDSKDDEVDDDDDDDDDEDDD
---------------DDDDDDNEDDDHASMIAQSELSSVVGTPTGDFGKSDAFHDD-KKR
KLDESSPDKNAEKP----------------------------------NSEMTNRSDISN
GSNKPV----STKMSTSVLERRRLGRQRAAAAYAIKLQKTGIEKKENDNIQSTGLFRPIP
LVNQKNCSSDYLKTNSQIFALRERKVLRNNTNIININSGNNSNSTSGTTANTPE-VSDLK
NVNSESNVSLIDETILKN----NPDNIVFDDPTTTIVIHPGSRYLKIGFAKDDSPLVIPN
CVAFPKNSLY--------SENV----EETIVSK-EESDNFKTKKNQIQQSFRDRMRYYKR
KIQNNSHERVRSFNIQSKPEKVEDKTEYNRVE-WITNPD-----KIYYGEEASRCSKDAF
IIRYPF---VKGGSFNITSPYYNSLPEIIGDISNLFEYALSQ--DRFNLKPSEYSKYKII
LVIPDIFEKSHLETMFRVLLKEMKFQAVAIMQESLAASYGAGIGGATCIVNIGATQTRVA
CIDEGTVSEHSLITLDYGGDDITKLFLHLLLQNEFPYQDLDINSSHGWRQIENLKKQFVT
FEDANITVQLYNFIKNKP----GAQ-AEKLEFKVFDEVINAPLGLFYPEIFRIMAEENEK
RRV--NKKLQDQLPPSTDLYTEERDDWRSLSQVQCLDN--DTYSGNDNDLDVITKLLNAN
-LNLDDMDLIN-N--------DQNENEKNY-------TSLDKAIIQSITNAVVTMD--TS
KMTQFYNNIMVVGGSSSIPSLDFILTDRINIWRPRILSSREFPSFFRNLVKQVKDFN---
------------------------------T-----------------------------
ANKSNNRPEEGEEEQKKGIAELIKTELKKYKDNLE-SQNANEHLLPVSVLPPPADMDPSV
LNWKGASVLGQLKLIEELYVTNADWDMLGSRILQYKCLFPY---
>NCAS0H02290
----------MSANDTSSVYEE---------PIEIPL--DNDEEDDNMDSMVEDNA----
-----------------------------NGKEQSSQNAVGSGSTSHDDEDEEEEEHDHE
EEEDQDDEEDDDDSKELITTSGTATPTRTLTPMGSANGKTTK------EEGPQKKVQKVE
PNKVPL----GKKVPLHLLEKRRLGRIKAAKEFAKKLKEIGIEKVESVPVPMTGMFQPLL
LINQKNYSSDYLRKDEQIFALRERKTLRSNTTQ------------NISSSNTPE-VTDLQ
SVRETSNFTTANG---------NNDEILLNDPNTTIVIHPGSSFLKVGFALDEVPELIPN
CVALPKTDFN--------NTNIIKS-KQTSVNI-EDNEKFESLKAEMEESFEERMRYYKR
RIQPNGHDQVVSFNRLSKPESLPVQNDPAHID-WITDGT-----KRFYGDDALRCTDENF
IKRYPF---KKGGSFNTSSNSYKSLQDLLSDVVGLIEGTLSS--DKFNIKSSQFSQYKVV
LVIPDSFEKSHVELFIRLLVTELQFQAVAIIQESLSVCYGSGLGGSTCVVNVGSKETTVA
CVDEGIVLDNSLITLDYGSNDVTKLFAKFLLDCDFPYKNWDLNSTEGWRLAEELMKQCVT
FQDADITVQLSNFIKRTP---RGNT-VEKLDFKVFEEVMLAPLALFYPEIFKLLRSKE-S
EEQ--NAELEYQLPPSRDIFTDKINDWRSLSQNDCINH--QTFCDIHDEYELLKKAVDCP
-NTLETFMDNP-P--------EEKKSTFNF-------TPLDKAIVESITTASLGLD--VS
KMATFYSNILVVGGGSKIPGFDLMLMDRVNIWRPRLLSLRAFTHFYRELTKQLKELQ---
------------------------------S-----------------------------
LKTGDGEEEIKEDELNEKISELIKTELTKYLEVIE-QQSGNEHFLPVEVIPSPNEIDPGS
IAWKGASVLAQIKLVEELFITNGDWDVHGNRILQYKSILTY---
>KAFR0E02530
--------MTGETPESSIVYED---------PIEIPL----DDDSDDEQPSQQDHNDL--
------------------------------------RSSTNTPLAERAATIDGEEDVDGD
DDIESNNSVK--------------------------------------TVKIDGKDVQLS
YGKTMA----GTKVPKHLLERRRIGRIKAAEAFAKKLKKIGIEKIENITLPQTGLFQPLN
LINQKNYSSDYIRKDDQIFALRERKTLRSSTNA------------NNNNTSTPKAVVDLK
TGV-------------------MDDEIDLNDPNSTIIIQPGSETMKIGFALDETPLLIPN
LVAIPKKDDS--------KGPS----TESKLNT-EQSEEFEDLKNELHSTFKERMRYYKR
RIQPNSHEQVKSFNRNAQPETILDNNDPARIR-WITQND-----KVYYGNDALLCPESFF
SHRKPFGTCRNGALFNLMGSSYSSVQELLGDVIKLIEFGLNK-----LLEAKNKDKYKAI
LVIPDLFEKSHVEEMIRLLLTELPFNAVAIIQESLATCYGAGISTSTCVVNVGASETSVS
CIDEGVVLENSLINLNYGGDDITRLFSVLLKMNNFPYQDWNVESIAGWNIAETLKKQIVT
LQDADVTVQLSNFMKRVF----NEP-TEKYEFKTFDEVMLAPLALFAPRIFSYLRN---E
ESK--NSTLQYQLPESKDLFTHELNDWRSMTQEACKNN--GSYCDISDELQLLTALLEVD
-SKLEAFQSEA-T--------TTLDNKRNM-------LPLDKAIIQSITDACLSLD--PS
KMDSFYSNILVVGGSSNIPAFDFMLTDRINIWRPRLLSLSSFPQFYKNLSKEIKDLE--M
ESQSTAKLQAQTGSVVPTTGSSTPLATNAGN-----------------------------
DGETMADLNEVSKKLSSNINDLIKTKLQDYISNVE-SQNSNEHYFPVGVVPPPRDMSAAI
LSWKGASVLAQIKLVEELFITNLDWDMHGSRILQHKCIFTY---
>Smik_15.320
--------MSQEEAESSIVYEE---------PIDIPL-----DDDDDGDEMEEEENNVPL
SSQADQ------EVEDNDSDDSVNN----EIGSETPRSVTGLSADPRDVAEEEEEEDEEG
EEEEEDEEEEDNDDENENELEDSRDKRAQPTAQ---------------TSKRYKKYPKLD
PAKAPP----GKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIEKVEATTLPATGLFQPLM
LINQKNYSSDYLKKDDQIFALRDRKFLRNNNTT------------QVSSTNTPD-VIDLK
NLPHSEANT--AS---------LNEEIDLNDSTATIVIHPGSNSVKIGFPKDEHPVLVPN
CVAVPKKWLN--------LESSEND-EIFSLQR-EQSEKFHSIKSDMEKNFRERMRYYKR
KVPGNAHEQVISFNENSKPEIISEKNDPSPIK-WIFDDS-----KLYYGSDALRCVDEKF
IIRKPF----KGGSFNINSPYYKSLAELISDVTKLLEYALKS--ETLNVKPAKFNQYKVV
LVIPDIFKKSHIETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGASETRIA
CVDEGTVLEHSAITLDYGGDDITRLFGLFLLQSDFPLQDWKINSEHGWLLAEQLKKNFTT
FQDADVAVQLYNFINRSP----NQP-TEKYEFKLFDEVMLAPLALFFPQIFKLIRT---S
SDK--NSSLEFQLPESRDLFTNELNDWNSLSQFESKEG--NLYCNLDDDLEILKKILQAH
-NMIDQLQDKPEN--------YGNISKENF-------APLEKAIIQSIANASITAD--VT
RMNSFYSNILIVGGSSKIPALDFILTDRINIWRPSLLSSASFPQFYKKLTKEIKDLE---
----------------------------SHF-----------------------------
VNAPDKTEEENKLVLQRQIKEKVVEELDEQHQNIE-NQNGNEHVFPISIIPPPRDMNPAL
IIWKGASVLAQIKLVEELFITNNDWDVHGSRILQYKCIFTY---
>YOR141C
--------MSQEEAESSIIYEE---------PIDIPL------EDDDDEDELEEENSVPL
SSQADQ------ENAENESDDSVDN----VVGSETPRSVTGLSVDPRDVADEEDED-EEG
EDEDEDEDDNDVDNEDENDNDNANENENELGSSRDKRAPPAVQ-----TSKRYKKYPKLD
PAKAPP----GKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIEKVETTTLPATGLFQPLM
LINQKNYSSDYLKKDDQIFALRDRKFLRNNNTS------------QISSTNTPD-VIDLK
SLPHSEASA--AP---------LNDEIDLNDPTATIVIHPGSNSIKIGFPKDDHPVVVPN
CVAVPKKWLD--------LENSEHV-ENVCLQR-EQSEEFNNIKSEMEKNFRERMRYYKR
KVPGNAHEQVVSFNENSKPEIISEKNDPSPIE-WIFDDS-----KLYYGSDALRCVDEKF
VIRKPF----RGGSFNVKSPYYKSLAELISDVTKLLEHALNS--ETLNVKPTKFNQYKVV
LVIPDIFKKSHVETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAETRIA
CVDEGTVLEHSAITLDYGGDDITRLFALFLLQSDFPLQDWKIDSKHGWLLAERLKKNFTT
FQDADVAVQLYNFMNRSP----NQP-TEKYEFKLFDEVMLAPLALFFPQIFKLIRT---S
SHK--NSSLEFQLPESRDLFTNELNDWNSLSQFESKEG--NLYCDLNDDLKILNRILDAH
-NIIDQLQDKPEN--------YGNTLKENF-------APLEKAIVQSIANASITAD--VT
RMNSFYSNILIVGGSSKIPALDFILTDRINIWRPSLLSSASFPQFYKKLTKEIKDLE---
----------------------------GHY-----------------------------
VNAPDKTEDENKQILQAQIKEKIVEELEEQHQNIE-HQNGNEHIFPVSIIPPPRDMNPAL
IIWKGASVLAQIKLVEELFITNSDWDVHGSRILQYKCIFTY---
>Suva_8.192
--------MSQEEAESSVVYEE---------PIDIPL------EDDDEDEMEEEENNVRL
SSQADQ------ENGDNDSDDSVDN----GVGSETPRSVTGLSADPRDAAEEEEEEEEEE
EEEEDDNDGDNDNDNDNDDDNDNDNDGEGLKDKRAQPTAQ--------TSKRYKKYPKLD
PAKAPP----GKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIEKVEATTLPATGLFQPLL
LINQKNYSSDYLKKDDQIFALRDRKFLRNNNTT------------QVSSTNTPD-VVDMK
SLPNSEPST--AP---------LNDEIDLNDPTATIVIHPGSNSIKIGFPKDEHPIVVPN
CVAVPKKWLN--------LANDQNE-GNISLQR-KQSEEFESIKSEMEKNFRERMRYYKR
KVPGNAHEQVVSFNESSKPEVVSVKNDPSPIE-WIFDDS-----KLYYGSDALRCVDEKF
VIRKPF----KGGCFNIDSPYYKSLAELISDVIKLLEYALDS--ETLNVKPTKFNQYKVV
LVIPDVFKKSHVETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGATETRIA
CVDEGTVLENSAVTLDYGGDDITRLFALLLLQSDFPLQDWKINSEHGWLLAEQLKKNFTT
FQDADIAVQLYNFINRSP----NKP-TEKYEFKLFDEVMLAPLALFFPQIFKLIRA---P
SGK--NSSLEFQLPESRDLFTNELNDWNSLSQFESKEG--DLYCNLNDDLKILNKTLDAH
-TMIDQLQDKPEK--------YGSTSKENL-------TPLEKAIIQSITNASVTAD--VT
RMSSFYSNILIVGGSSKIPALDFILTDRINIWRPSLLSSTSFPQFYKKLTKEIKDLE---
----------------------------SHF-----------------------------
VSAPEKTEEENKQVLQLQINEKVVAELDEQHQSIE-HQNGNEHLFPISIIPPPRDMNPAL
IIWKGASVLAQIKLVEELFITNNDWDVHGSRILQYKCIFTY---
>Skud_15.304
--------MSQEEAESSVVYEE---------PIDIPL-EDDDDDDDDEDEMEEEENNVPL
SSQADQ---------DNDSDDSADN----GIGSETPGSVMGLSADPRDVAEEEDDEEEGE
DEEEEEEDNDDDEENDNDNADGNDNENELGSSKSERGEPGVQ------TSKRYKKYPKLD
PAKAPP----GKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIEKVEATTLPATGLFQPLM
LINQKNYSSDYLKKDDQIFALRDRKFLRNNNTT------------QVSSTNTPD-VVDLK
NLSHTEPST--AP---------LNDEIDLNDPTATIVIHPGSNSIKIGFPKDEHPIIVPN
CVAVPKKWLN--------LGNGPNE-DNISLQR-EQSDEFENIKSEMEKNFRERMRYYKR
KVPGNAHEQVVSFNENSKPEIISEKNDPSPIE-WIFDDS-----KLYYGSDALRCVDEKF
VVRKPF----QGGSFNINSPYYESLAELISDVTKLLEYALAS--ETLNVKSTKFNQYKVV
LVIPDVFKKNHVETFIRVLLTELQFQAVAVIQESLATCYGAGISTSTCVVNIGATETRIA
CVDEGTVLEHSAVTLNYGGDDITRLFALLLLQSDFPLQDWKIDTKHGWLLAEQLKKNFTT
FQDADIAVQLYNFINRSP----NQP-SEKYEFKLFDEVMLAPLALFFPQIFKLIRS---S
SGK--NSNLEFQLPESRDLFTNELNDWNSLSQFESKEG--DLYSNLNDDLKILNKILEAH
-TIIDQIQDKPEN--------YGDTSKENF-------APLEKAIIQSIANASITAD--VT
RMNSFYSNILIVGGTSKIPALDFILTDRINIWRPSLLSSASFPQFYKKLTKEIKDLE---
----------------------------SHF-----------------------------
VNAPDKTEEENKQVMQSQIKDKVVAELDEQHQNIE-NQNGNEHLFPVSIIPPPRDMNPAL
IIWKGASVLAQIKLVEELFITNNDWDVHGSRILQYKCIFTY---
>ZYRO0D11308g
---------MSQEAESEPVYEE---------PIDIPL--EEEDDDDEDDEADEVGESHTP
STTQQKLRAEAEAHGDADEDEDMD-----TMHANASRSGTSTPLGNANTAAGDDDEMDDD
ELDDDDGDENNKKRD---------------------------------SQGKFKKYPKLD
PAKAPP----GKKVPLHLLEKRRLGRIKAAEEFARKLKKIGIEKVETNTLPPTGLFQPMI
LINQKNYSSDYLKKDEQVFALRDRKVLRNNTQV-------------PSMANTPD-VADLK
RENGNTTELNEAA---------GDEDIDLSDANTTLVIHPGSNSLKVGFAKDESPFVIPS
CVAIPKSELH--------NQIPMDQKNQTCYTR-DQPTEFEEIKAEMQHSFRERMRFYKR
KVQPNAHEQVINFNKVSKPELIEDKNDYNRIN-WITTPD-----RRYYGADALRCSKDHF
VIRYPI---VKGGSFNIASPDYRSLQDLMGDFTGLLEHVLRS--PRFQLKRSQFAQYKVV
LVIPDLFEKSHVETLIRCLITEMQFQAVAIMQESLATCYGAGISTSTCVVNIGATQTRIA
CVDEGTVLQDSCITLDYGSDDITKLFALFLLQSEFPYQDWDIETAHGWHLAEELKKNYTT
FQDANVTVQLYNFIKRIP----GQQ-AEKFDFKVFDEVILAPLSLFYPGIVAQLRNELKP
RSQ--NEKLESELPISRDIFTDNLDDWRSLSQTECLDN--QLYCGNQDEFQMLCKLLDAP
-SRLDELQAEN-R--------LEPDIRQNY-------APLEKAIVQSITNACLSFD--VS
KMSSFYSNILVCGGGSNVPAFDFILTDRINIWRPRILSHTSFPDLYKKLSKQIKDIK---
---------------------------NSVK-----------------------------
NGEGKSNGPQEDEQLKEKVQEVIKKELERYHELIE-SQNNADHTLPVSVLPPPRDLDPAI
LIWKGASVLAQIKLVEELYLTGADWDIHGSRILQYKCIFTY---
>TDEL0A03410
--------MSQDTSEKSVVYEE---------PIDIPL-EEDDDEDEEDDEVEEHDQEHDS
------------VKEEDDEEDDENN----LHAAEISRSATATPIGQRNHVE---------
--DEEDEDYNDEDAK---------------------------------SQERAKKHPRLD
PAKAPP----GKKVPLHLLEKRRLGRIKAAEEFAKKLKQIGIEKIESTTLPATGLFQPVL
LINQKNYSSDYLKKDEQIFALRERKTLRNNTQT-------------SSINNTPD-VIDIK
NTNTEVPDYI-AA---------ADEDIDLSDANTTLVIHPGSRHLRIGFAKDEVPLVVPS
CVAIPKTELN--------DEF-----QEAPLKR-EQPEEFEELKSTIQHSFRERMRYYKR
KVPFNAHEQVVSYNKNSKPQMIEDQNDPGAIN-WIKKSS-----KRYYGSEALKCSKETF
RIRCPF---TKGGSFNVSSPDYASLQDLINDVISLLEHALSA--EGLNLERAQFSQYKVV
LVIPDLFHKSHVETFIRFLLTEMQFQAVAIIQESLAGCYGAGQSSSTCVVNIGATHTSIA
CIDEGTVLENSLVSLDYGGDDLTKLFALFLLQSEFPYQDWDINSSHGWILAEELKKKYTT
FQDANVAVQLYNFIKRVP----DQQ-SEQYEFKVFDEVSLAPLALFYPEIISYLHSKSSQ
HSG--NSNVESQLPASRDIFTNTVNDWRSLSQSECLDG--DLYSGNNNNQLIMSKLLDLQ
-TSFDDFQSKP-P--------MEADSRKNY-------TPLEKAIIQSITNASTPID--VA
KMSSFYSNILVVGGGSKIPALDFILTDRINIWRPRLLSLTSFPNFYKKLAKQAKDIK---
----------------------------TAG-----------------------------
----KTGESEEEDQSSKKINEMISAELQAYWDSIE-AQNGSEHLLPVNVLPPPRDMDAAE
LAWKGACVLAQIKLVEELYLTSTDWDIHGSRILQYKCLFTY---