MUSCLE (3.8) multiple sequence alignment

TPHA0E01480        -----------------------------------------------------MLKVGVP
TPHA0J02770        -----------------------------------------------------MLRNTAA
TBLA0B02240        -----------------------------------------------------MLRTIAA
KAFR0B06370        -----------------------------------------------------MLRQAML
AFR137C            -----------------------------------------------------MLRQKLF
Ecym_2313          -----------------------------------------------------MFKQSIF
KLLA0E03125g       -----------------------------------------------------MFRQSIV
KLTH0F15048g       -----------------------------------------------------MFKSSFV
Kwal_55.21273      -----------------------------------------------------MFRSQFG
SAKL0G03520g       -----------------------------------------------------MLRSQVL
KNAG0B04070        -----------------------------------------------------MLRNSLL
CAGL0I07227g       -----------------------------------------------------MLGIRSF
Suva_8.188         -----------------------------------------------------MLRNTFL
Skud_15.300        -----------------------------------------------------MLRSNLF
Smik_15.316        -----------------------------------------------------MLRNTFF
YOR136W            -----------------------------------------------------MLRNTFF
NCAS0H02250        MPSRKGYIYIYTNSRQPASLDFNNTYPAAYPSEQHSQLHRNGKQYQYPCNNNIMFRSSIL
NDAI0C01410        -----------------------------------------------------MFRNIIL
ZYRO0D11220g       -----------------------------------------------------MFKSQVC
TDEL0A03370        -----------------------------------------------------MLRSQIC
Kpol_543.8         -----------------------------------------------------MFNSRLQ
Kpol_440.12        -----------------------------------------------------MLRNTIY
                                                                        *:     

TPHA0E01480        LSSKYIGTISKLRYFMTA----ADKISIGNFKGKPNPETGNYTVPFIEGDGVGPEISKSV
TPHA0J02770        IAQKN-TTLLK---ILGSTRSISNQPTIGRFTGKTN-SSGTYTVPFIEGDGVGPEISKSV
TBLA0B02240        ---KQ--SARR---LFSTSSTLRVSGQVGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSV
KAFR0B06370        GRARYTIPTKR---FLSM--QAPRQPSIGRFTGKPDHATGKYTVSFIEGDGIGPEISRSV
AFR137C            ---QG---SRR---WLAS----VRQPSIGRYAGKPN-AAGKYTVSFIEGDGVGPEISQSV
Ecym_2313          ---KG---SRR---YLAS--ASRKQPSIGRFTGKPNPKTGKYTVSFIEGDGIGPEISQSV
KLLA0E03125g       ---KQ---SCR---FLAT----KKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSV
KLTH0F15048g       ---RN---SAR---FLAT----KKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAV
Kwal_55.21273      ---RN---TLR---FFAT----KKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAV
SAKL0G03520g       ---RQ--LPRR---FLSS----KKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSV
KNAG0B04070        ---RNSFTARR---FLAT--SVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSV
CAGL0I07227g       ---RL--NARR---FLAT-----AQPSIGRFTGKPNPSTGKFTVSFIEGDGIGPEISSSV
Suva_8.188         ---RN--TSRR---FLST----VKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSV
Skud_15.300        ---RN--TSRR---FLAT----VKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSV
Smik_15.316        ---RN--TSRR---FLAT----VKQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISKSV
YOR136W            ---RN--TSRR---FLAT----VKQPSIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSV
NCAS0H02250        ---RT--TTRR---LLSV----KHQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISNSV
NDAI0C01410        ---RN--TTRR---FLSV----KNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSV
ZYRO0D11220g       ---RR--AVAR---MFSS-----KQPSIGKFTGKPDPKTGNYKVSFIEGDGIGPEISKSV
TDEL0A03370        ---RR--TVNR---MLAS--ATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSV
Kpol_543.8         ---LR--TVSR---FLST-----GQPSIGRFTGKPDPATGKFTVPFIEGDGVGPEISESV
Kpol_440.12        ---RG--SFAR---MMTT-----GQPNIGRFTGKPNPVTGKYTVPFIEGDGVGPEISKSV
                             .    :        .  :*.: *..:  :* : *.******:***** :*

TPHA0E01480        RTIFKAAKVPIDWVNCDIGPLLINGETTIPQTAVDQINNSLIALKGPLATPVGQGHRSIN
TPHA0J02770        KDIFSAANVPIQWQPCDVGPIFVNGLTTIPEPAVKAIKESLVALKGPLATPVGKGHRSLN
TBLA0B02240        KDIFKAAQVPVDWEYCDVSPLLINGLTTIPEPAVQQINKHKIALKGPLATPIGKGHRSLN
KAFR0B06370        KDIFQAASVPITWETCDVSPILVDGLTTIPDEAVKSINKNLVGLKGPLATPIGKGHRSLN
AFR137C            KDIFSAASVPVEWEYCDVTPLLVNGLTTIPEPAVASINKNLVALKGPLATPIGKGHRSLN
Ecym_2313          KDIFSAAKVPVEWEYCDVTPIFINGLTTIPDPAVQSINKNLVALKGPLATPIGKGHRSLN
KLLA0E03125g       KAIFSAAKVPIEWESCDVSPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLN
KLTH0F15048g       KDIFAAAKAPIQWESCDVSPLFINGLTTIPQPAQDSINKNLIALKGPLATPIGKGHRSLN
Kwal_55.21273      KDIFAAAKAPIQWETCDVTPLFINGLTTIPQPAQDSINKNLIALKGPLATPIGKGHRSLN
SAKL0G03520g       KDIFAAAEVPVEWESCDVTPLFINGLTTIPQPAVDSINKNLIALKGPLATPIGKGHRSLN
KNAG0B04070        KDIFKAAEVPINWEFCDVTPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLN
CAGL0I07227g       KRIFQAADVPVEWETCDVTPIFVNGLTTIPDPAVQSINKNLVALKGPLATPIGKGHRSLN
Suva_8.188         KKIFSAADVPINWEFCDVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLN
Skud_15.300        KKIFNAANVPIEWESCDVNPIFVNGLTTIPDAAVQSITNNLIALKGPLATPIGKGHRSLN
Smik_15.316        KKIFSAANVPIEWEFCDVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLN
YOR136W            KKIFSAANVPIEWESCDVSPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLN
NCAS0H02250        KQIFSAAKVPIEWETCDVTPLFIDGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLN
NDAI0C01410        KQIFDAAKVPIDWEPCDVSPLFINGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLN
ZYRO0D11220g       KDIFAAAKVPVDFESVVVKPILVNGVTSIPEEAQKSINTNLVALKGPLATPVGKGHRSMN
TDEL0A03370        KDIFAAAKVPIVWESCPVTPLLVNGVTTIPEQAQESINRNLVALKGPLATPIGKGHRSMN
Kpol_543.8         KKIFSAAKVPIEWVPCDVGPIFVNGQTTIPEPAVELINKHLIALKGPLATPIGKGHRSLN
Kpol_440.12        KDIFAAAKVPIEWEPCDVGPIFVNGLTTIPDAAVQSINKHLVALKGPLATPIGKGHRSLN
                   . ** **..*: :    : *::::* *:**: *   *.   :.********:*:****:*

TPHA0E01480        LTLRKTFGLFANVRPAKSIPNLASTYENVDLIVIRENTEGEYSGIEHEIVPGVVQSIKLI
TPHA0J02770        LTLRKTFDLFANVRPAKSVPNYKSTYENVDLVLIRENTEGEYSGIEHIVTPGVVQSIKLI
TBLA0B02240        LTLRKTFGLFANVRPARSIRGYETTYKNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLI
KAFR0B06370        LTLRKTFNLFANVRPAKSVRGFKTTYDNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLI
AFR137C            LTLRKTFGLFANVRPAKSIEGYKTTYSDVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLI
Ecym_2313          LTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLI
KLLA0E03125g       LTLRKTFGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHVVAPGVVQSIKLI
KLTH0F15048g       LTLRKTFGLFANVRPAKSVQGYKTAYDNVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLI
Kwal_55.21273      LTLRKTFGLFANVRPAKSIQGFKTAYDNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLI
SAKL0G03520g       LTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLI
KNAG0B04070        LTLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLI
CAGL0I07227g       LTLRKTFNLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHLVSPGVVQSIKLI
Suva_8.188         LTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLI
Skud_15.300        LTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLI
Smik_15.316        LTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLI
YOR136W            LTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLI
NCAS0H02250        LTLRKTFGLFANVRPARSVKGFKTTYPNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLI
NDAI0C01410        LTLRKTFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPGVVQSIKLI
ZYRO0D11220g       LTLRKTFGLFANLRPAKSVEGFKTIYDNVNLVLIRENTEGEYAGIEHAIVPGVVQSIKLI
TDEL0A03370        LTLRKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVIVPGVVQSIKLI
Kpol_543.8         LTLRKTFNLFANVRPARSIPNYKSTYENVDLVLIRENTEGEYSGIEHVITPGVIQSIKLI
Kpol_440.12        LTLRKTFNLFANVRPARSVPNYKTTYQNVDLVLIRENTEGEYSGIEHVISPGVIQSIKLI
                   *******.****:***.*: .  : * :*:*::*********:**** : ***:******

TPHA0E01480        TRKASEKVIKYAFEYTRSIGRSNLIVVHKATIQRRGDGLFVQTAQEMADK--YPDVNLKL
TPHA0J02770        TREASEKVIRYAYEYAIAVGRPRLIVVHKSTIQRLGDGLFVQIANELQSE--YPSIKLET
TBLA0B02240        TRDASERVIRYAYEYARAIGRPRLVVVHKSTIQKLADGLFVNIAKELAPE--FPDIKLET
KAFR0B06370        TRDASERVIRYAFEYAKAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIELDT
AFR137C            TREASERVIRYAFEYARTVGRPKVVVVHKSTIQRLADGLFVNVAQELGRE--YPDIELQT
Ecym_2313          TRDASERVIRYAFEYARAVGRPKVVVVHKSTIQRLADGLFVNVAQEVGKE--YPDIELQP
KLLA0E03125g       TQDASERVIRYAFEYARAVDRSKVLVVHKSTIQRLADGLFVDVAKKLSSE--YPDIELQT
KLTH0F15048g       TQDASERVIRYAFEYARAVERPKVVVVHKSTIQRLADGLFVSVAEQLSKE--YPDIELQT
Kwal_55.21273      TQDASERVIRYAFEYARAVERPKVLVVHKSTIQRLADGLFVSVAEKLAKE--YPDIELQT
SAKL0G03520g       TRDASERVIRYAFEYARAVGRPKVMVVHKSTIQRLADGLFVDVAKELSSE--YPDIQLQL
KNAG0B04070        TRDASERVIRYAFEYAKAIGRPRVVVVHKSTIQRLADGLFVNVAKELSKE--YPEIKLET
CAGL0I07227g       TRDASERVIRYAYEYARAIGRPRLIVVHKSTIQRLADGLFVNVAKELAAE--YPDIQLET
Suva_8.188         TREASERVIRYAFEYARAIGRPRIIVVHKSTIQRLADGLFVNVAKELSKE--YPDITFET
Skud_15.300        TRDASERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKE--YPDIILET
Smik_15.316        TRDASERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKE--YPDITLET
YOR136W            TRDASERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKE--YPDLTLET
NCAS0H02250        TREASERVIRYAFEYCRAIGRPRLVVVHKSTIQRLSDGLFVNVAKELSKE--YPDIQFET
NDAI0C01410        TRDASERVIRYAYEYARAIGRPRVIVVHKSTIQRLADGLFVDVAKELSQE--YPDIQLET
ZYRO0D11220g       TREASERVIRFAYEYARAAERPRLIVVHKSTIQRLSDGLFVDVAKELQSE--FPDIKLET
TDEL0A03370        TREASERVIRYAYEYARAVGRPKLVVVHKSTIQRLADGLFVTVAKELAHE--FPDIQLQT
Kpol_543.8         TREATERVVRYAFEYTQAIGRPRLLVIHKSTIQRMADGLFVKVAEELASE--YPDIKLET
Kpol_440.12        TKDASERVIRYAFEYTRAIGRPRLVVVHKSTIQRMADGLFVNVAKELASE--YPDIELQT
                   *..*:*.*:.:*:**  :  *..::*:**:***. .*****  *:::  :  : .: :. 

TPHA0E01480        ELIDNTVLNCIMNPEKYADSVSVCPNLYGDILSDLNSGLSTGSLGLTPSANIGETV-LYE
TPHA0J02770        QILDNTVLNVVSNPTLYKDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFE
TBLA0B02240        ELIDNTVLNVVRDPPSYTDAVTVCPNLYGDILSDLNSGLSAGSLGLTPSANIGNEVSIFE
KAFR0B06370        ELIDNTVLNVVMNPSKYSDAVFVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKISIFE
AFR137C            ELLDNTVLNVVTKPEAYKDVVAVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHQVSIFE
Ecym_2313          ELIDNTVLNVVSKPEKYSDSVAVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFE
KLLA0E03125g       ELLDNTVLKTVQHPEAYDDVVVVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFE
KLTH0F15048g       ELIDNTVLHTVRDPTKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHKVSIFE
Kwal_55.21273      ELIDNTVLHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFE
SAKL0G03520g       QLLDNTVLNVVSNPGAYADTVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFE
KNAG0B04070        ELIDNTVLNVVSNPAGYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGNEISIFE
CAGL0I07227g       ELIDNTCLNVVSNPSSYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFE
Suva_8.188         ELIDNKVLNVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFE
Skud_15.300        ELIDNSVLKVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFE
Smik_15.316        ELIDNSVLKVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFE
YOR136W            ELIDNSVLKVVTNPSAYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFE
NCAS0H02250        ELIDNTVLKVVSNPSSYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSGNIGNEISIFE
NDAI0C01410        ELIDNTVLNVVSNPSSYSNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHEVSIFE
ZYRO0D11220g       ELIDNAVLNTVTDPTKYSDAVSVCPNLYGDILSDMNSGLSAGSLGLTPSGNIGHKVSIFE
TDEL0A03370        ELIDNTVLNVVSNPSKYSDVVYVCPNLYGDILSDLNSGLSAGSLGLTPSGNIGHKVSIFE
Kpol_543.8         EIIDKSILNVVSKPELYSDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFE
Kpol_440.12        ELIDNTILNVVTHPESYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFE
                   :::*:  *: :  *  * : * ************:*****:********.***  : ::*

TPHA0E01480        AVHGSAPDIAGQDKANPTALLLSSVMMLNHMGLQKYADMIETAVLTTITSGKEFRTADLG
TPHA0J02770        AVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLEEHASRIENAVLSTIASGPESRTGDLG
TBLA0B02240        AVHGSAPDIAGQNKANPTALLLSSCMMLNYMGLESYSNKIENAILNTIASGSENRTGDLA
KAFR0B06370        AVHGSAPDIAGQNKANPTALLLSSVMMLHHMGLNEYGDKIENAVLKTIAASSKNRTGDLG
AFR137C            AVHGSAPDIAGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSRENRTADLA
Ecym_2313          AVHGSAPDIAGQNCANPTALLLSSVMMLNHMGLHEHADQIESAVLATVASDKKNRTADLA
KLLA0E03125g       AVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLG
KLTH0F15048g       AVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFTTIAAGPESRTGDLG
Kwal_55.21273      AVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLA
SAKL0G03520g       AVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLA
KNAG0B04070        AVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLG
CAGL0I07227g       AVHGSAPDIAGQNKANPTALLLSSVMMLNHMGMTEHADRIEKAVLGTIAGGSEYRTGDLG
Suva_8.188         AVHGSAPDIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLA
Skud_15.300        AVHGSAPDIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLA
Smik_15.316        AVHGSAPDIAGQDKANPTALLLSSVMMLNHMGLTNYADQIQNAVLSTIASGPENRTGDLA
YOR136W            AVHGSAPDIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLA
NCAS0H02250        AVHGSAPDIAGKNMANPTALLLSSVMMLNHMGLSKHADQIENAVLSTIASGPESRTGDLA
NDAI0C01410        AVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLA
ZYRO0D11220g       AVHGSAPDIAGKDKANPTALLLSSVMMLHHMGLHEHASQIEKAVLTTIAAGPESRTGDLK
TDEL0A03370        AVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLA
Kpol_543.8         AVHGSAPDIAGQNKANPTALLLSSVMMLKHMGLDEHANKIENAVLTTIASGSENRTADLS
Kpol_440.12        AVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLNEHATKIENAILSTIASGSENRTGDLA
                   ***********:: ********** ***::**: . .  *: *:: *::.. : **.** 

TPHA0E01480        GSATTTSFTKAVIENLN
TPHA0J02770        GSATTSSFTECVIKKL-
TBLA0B02240        GTATTSSFTESVIKNL-
KAFR0B06370        GTATTTSFTEAVIDNL-
AFR137C            GTASTSSFTNAVIERL-
Ecym_2313          GTATTSSFTKAVIERL-
KLLA0E03125g       GSASTSSFTDAVIERL-
KLTH0F15048g       GSASTSSFAEAVISRL-
Kwal_55.21273      GSASTSSFAEAVISRL-
SAKL0G03520g       GSASTSSFTEAVIKRL-
KNAG0B04070        GSATTSSFTDAVIKNL-
CAGL0I07227g       GSASTTSFTDAIIKKL-
Suva_8.188         GTATTSSFTEAVIKRL-
Skud_15.300        GTATTSSFTEAVIKRL-
Smik_15.316        GAATTSSFTEAVIKRL-
YOR136W            GTATTSSFTEAVIKRL-
NCAS0H02250        GTATTSTFTDAVIKKL-
NDAI0C01410        GKATTSSFTDAVIGRL-
ZYRO0D11220g       GSASTSSFTEAVIKKL-
TDEL0A03370        GSASTSSFTEAVISRL-
Kpol_543.8         GTASTSSFTEEVIQRL-
Kpol_440.12        GTATTSSFTEAVINKL-
                   * *:*::*:. :* .* 

FASTA FORMAT for MUSCLE Version 3.6

>TPHA0E01480
-----------------------------------------------------MLKVGVP
LSSKYIGTISKLRYFMTA----ADKISIGNFKGKPNPETGNYTVPFIEGDGVGPEISKSV
RTIFKAAKVPIDWVNCDIGPLLINGETTIPQTAVDQINNSLIALKGPLATPVGQGHRSIN
LTLRKTFGLFANVRPAKSIPNLASTYENVDLIVIRENTEGEYSGIEHEIVPGVVQSIKLI
TRKASEKVIKYAFEYTRSIGRSNLIVVHKATIQRRGDGLFVQTAQEMADK--YPDVNLKL
ELIDNTVLNCIMNPEKYADSVSVCPNLYGDILSDLNSGLSTGSLGLTPSANIGETV-LYE
AVHGSAPDIAGQDKANPTALLLSSVMMLNHMGLQKYADMIETAVLTTITSGKEFRTADLG
GSATTTSFTKAVIENLN
>TPHA0J02770
-----------------------------------------------------MLRNTAA
IAQKN-TTLLK---ILGSTRSISNQPTIGRFTGKTN-SSGTYTVPFIEGDGVGPEISKSV
KDIFSAANVPIQWQPCDVGPIFVNGLTTIPEPAVKAIKESLVALKGPLATPVGKGHRSLN
LTLRKTFDLFANVRPAKSVPNYKSTYENVDLVLIRENTEGEYSGIEHIVTPGVVQSIKLI
TREASEKVIRYAYEYAIAVGRPRLIVVHKSTIQRLGDGLFVQIANELQSE--YPSIKLET
QILDNTVLNVVSNPTLYKDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFE
AVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLEEHASRIENAVLSTIASGPESRTGDLG
GSATTSSFTECVIKKL-
>TBLA0B02240
-----------------------------------------------------MLRTIAA
---KQ--SARR---LFSTSSTLRVSGQVGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSV
KDIFKAAQVPVDWEYCDVSPLLINGLTTIPEPAVQQINKHKIALKGPLATPIGKGHRSLN
LTLRKTFGLFANVRPARSIRGYETTYKNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLI
TRDASERVIRYAYEYARAIGRPRLVVVHKSTIQKLADGLFVNIAKELAPE--FPDIKLET
ELIDNTVLNVVRDPPSYTDAVTVCPNLYGDILSDLNSGLSAGSLGLTPSANIGNEVSIFE
AVHGSAPDIAGQNKANPTALLLSSCMMLNYMGLESYSNKIENAILNTIASGSENRTGDLA
GTATTSSFTESVIKNL-
>KAFR0B06370
-----------------------------------------------------MLRQAML
GRARYTIPTKR---FLSM--QAPRQPSIGRFTGKPDHATGKYTVSFIEGDGIGPEISRSV
KDIFQAASVPITWETCDVSPILVDGLTTIPDEAVKSINKNLVGLKGPLATPIGKGHRSLN
LTLRKTFNLFANVRPAKSVRGFKTTYDNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLI
TRDASERVIRYAFEYAKAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIELDT
ELIDNTVLNVVMNPSKYSDAVFVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKISIFE
AVHGSAPDIAGQNKANPTALLLSSVMMLHHMGLNEYGDKIENAVLKTIAASSKNRTGDLG
GTATTTSFTEAVIDNL-
>AFR137C
-----------------------------------------------------MLRQKLF
---QG---SRR---WLAS----VRQPSIGRYAGKPN-AAGKYTVSFIEGDGVGPEISQSV
KDIFSAASVPVEWEYCDVTPLLVNGLTTIPEPAVASINKNLVALKGPLATPIGKGHRSLN
LTLRKTFGLFANVRPAKSIEGYKTTYSDVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLI
TREASERVIRYAFEYARTVGRPKVVVVHKSTIQRLADGLFVNVAQELGRE--YPDIELQT
ELLDNTVLNVVTKPEAYKDVVAVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHQVSIFE
AVHGSAPDIAGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSRENRTADLA
GTASTSSFTNAVIERL-
>Ecym_2313
-----------------------------------------------------MFKQSIF
---KG---SRR---YLAS--ASRKQPSIGRFTGKPNPKTGKYTVSFIEGDGIGPEISQSV
KDIFSAAKVPVEWEYCDVTPIFINGLTTIPDPAVQSINKNLVALKGPLATPIGKGHRSLN
LTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLI
TRDASERVIRYAFEYARAVGRPKVVVVHKSTIQRLADGLFVNVAQEVGKE--YPDIELQP
ELIDNTVLNVVSKPEKYSDSVAVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFE
AVHGSAPDIAGQNCANPTALLLSSVMMLNHMGLHEHADQIESAVLATVASDKKNRTADLA
GTATTSSFTKAVIERL-
>KLLA0E03125g
-----------------------------------------------------MFRQSIV
---KQ---SCR---FLAT----KKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSV
KAIFSAAKVPIEWESCDVSPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLN
LTLRKTFGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHVVAPGVVQSIKLI
TQDASERVIRYAFEYARAVDRSKVLVVHKSTIQRLADGLFVDVAKKLSSE--YPDIELQT
ELLDNTVLKTVQHPEAYDDVVVVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFE
AVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLG
GSASTSSFTDAVIERL-
>KLTH0F15048g
-----------------------------------------------------MFKSSFV
---RN---SAR---FLAT----KKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAV
KDIFAAAKAPIQWESCDVSPLFINGLTTIPQPAQDSINKNLIALKGPLATPIGKGHRSLN
LTLRKTFGLFANVRPAKSVQGYKTAYDNVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLI
TQDASERVIRYAFEYARAVERPKVVVVHKSTIQRLADGLFVSVAEQLSKE--YPDIELQT
ELIDNTVLHTVRDPTKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHKVSIFE
AVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFTTIAAGPESRTGDLG
GSASTSSFAEAVISRL-
>Kwal_55.21273
-----------------------------------------------------MFRSQFG
---RN---TLR---FFAT----KKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAV
KDIFAAAKAPIQWETCDVTPLFINGLTTIPQPAQDSINKNLIALKGPLATPIGKGHRSLN
LTLRKTFGLFANVRPAKSIQGFKTAYDNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLI
TQDASERVIRYAFEYARAVERPKVLVVHKSTIQRLADGLFVSVAEKLAKE--YPDIELQT
ELIDNTVLHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFE
AVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLA
GSASTSSFAEAVISRL-
>SAKL0G03520g
-----------------------------------------------------MLRSQVL
---RQ--LPRR---FLSS----KKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSV
KDIFAAAEVPVEWESCDVTPLFINGLTTIPQPAVDSINKNLIALKGPLATPIGKGHRSLN
LTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLI
TRDASERVIRYAFEYARAVGRPKVMVVHKSTIQRLADGLFVDVAKELSSE--YPDIQLQL
QLLDNTVLNVVSNPGAYADTVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFE
AVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLA
GSASTSSFTEAVIKRL-
>KNAG0B04070
-----------------------------------------------------MLRNSLL
---RNSFTARR---FLAT--SVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSV
KDIFKAAEVPINWEFCDVTPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLN
LTLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLI
TRDASERVIRYAFEYAKAIGRPRVVVVHKSTIQRLADGLFVNVAKELSKE--YPEIKLET
ELIDNTVLNVVSNPAGYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGNEISIFE
AVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLG
GSATTSSFTDAVIKNL-
>CAGL0I07227g
-----------------------------------------------------MLGIRSF
---RL--NARR---FLAT-----AQPSIGRFTGKPNPSTGKFTVSFIEGDGIGPEISSSV
KRIFQAADVPVEWETCDVTPIFVNGLTTIPDPAVQSINKNLVALKGPLATPIGKGHRSLN
LTLRKTFNLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHLVSPGVVQSIKLI
TRDASERVIRYAYEYARAIGRPRLIVVHKSTIQRLADGLFVNVAKELAAE--YPDIQLET
ELIDNTCLNVVSNPSSYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFE
AVHGSAPDIAGQNKANPTALLLSSVMMLNHMGMTEHADRIEKAVLGTIAGGSEYRTGDLG
GSASTTSFTDAIIKKL-
>Suva_8.188
-----------------------------------------------------MLRNTFL
---RN--TSRR---FLST----VKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSV
KKIFSAADVPINWEFCDVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLN
LTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLI
TREASERVIRYAFEYARAIGRPRIIVVHKSTIQRLADGLFVNVAKELSKE--YPDITFET
ELIDNKVLNVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFE
AVHGSAPDIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLA
GTATTSSFTEAVIKRL-
>Skud_15.300
-----------------------------------------------------MLRSNLF
---RN--TSRR---FLAT----VKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSV
KKIFNAANVPIEWESCDVNPIFVNGLTTIPDAAVQSITNNLIALKGPLATPIGKGHRSLN
LTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLI
TRDASERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKE--YPDIILET
ELIDNSVLKVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFE
AVHGSAPDIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLA
GTATTSSFTEAVIKRL-
>Smik_15.316
-----------------------------------------------------MLRNTFF
---RN--TSRR---FLAT----VKQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISKSV
KKIFSAANVPIEWEFCDVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLN
LTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLI
TRDASERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKE--YPDITLET
ELIDNSVLKVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFE
AVHGSAPDIAGQDKANPTALLLSSVMMLNHMGLTNYADQIQNAVLSTIASGPENRTGDLA
GAATTSSFTEAVIKRL-
>YOR136W
-----------------------------------------------------MLRNTFF
---RN--TSRR---FLAT----VKQPSIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSV
KKIFSAANVPIEWESCDVSPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLN
LTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLI
TRDASERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKE--YPDLTLET
ELIDNSVLKVVTNPSAYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFE
AVHGSAPDIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLA
GTATTSSFTEAVIKRL-
>NCAS0H02250
MPSRKGYIYIYTNSRQPASLDFNNTYPAAYPSEQHSQLHRNGKQYQYPCNNNIMFRSSIL
---RT--TTRR---LLSV----KHQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISNSV
KQIFSAAKVPIEWETCDVTPLFIDGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLN
LTLRKTFGLFANVRPARSVKGFKTTYPNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLI
TREASERVIRYAFEYCRAIGRPRLVVVHKSTIQRLSDGLFVNVAKELSKE--YPDIQFET
ELIDNTVLKVVSNPSSYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSGNIGNEISIFE
AVHGSAPDIAGKNMANPTALLLSSVMMLNHMGLSKHADQIENAVLSTIASGPESRTGDLA
GTATTSTFTDAVIKKL-
>NDAI0C01410
-----------------------------------------------------MFRNIIL
---RN--TTRR---FLSV----KNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSV
KQIFDAAKVPIDWEPCDVSPLFINGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLN
LTLRKTFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPGVVQSIKLI
TRDASERVIRYAYEYARAIGRPRVIVVHKSTIQRLADGLFVDVAKELSQE--YPDIQLET
ELIDNTVLNVVSNPSSYSNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHEVSIFE
AVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLA
GKATTSSFTDAVIGRL-
>ZYRO0D11220g
-----------------------------------------------------MFKSQVC
---RR--AVAR---MFSS-----KQPSIGKFTGKPDPKTGNYKVSFIEGDGIGPEISKSV
KDIFAAAKVPVDFESVVVKPILVNGVTSIPEEAQKSINTNLVALKGPLATPVGKGHRSMN
LTLRKTFGLFANLRPAKSVEGFKTIYDNVNLVLIRENTEGEYAGIEHAIVPGVVQSIKLI
TREASERVIRFAYEYARAAERPRLIVVHKSTIQRLSDGLFVDVAKELQSE--FPDIKLET
ELIDNAVLNTVTDPTKYSDAVSVCPNLYGDILSDMNSGLSAGSLGLTPSGNIGHKVSIFE
AVHGSAPDIAGKDKANPTALLLSSVMMLHHMGLHEHASQIEKAVLTTIAAGPESRTGDLK
GSASTSSFTEAVIKKL-
>TDEL0A03370
-----------------------------------------------------MLRSQIC
---RR--TVNR---MLAS--ATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSV
KDIFAAAKVPIVWESCPVTPLLVNGVTTIPEQAQESINRNLVALKGPLATPIGKGHRSMN
LTLRKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVIVPGVVQSIKLI
TREASERVIRYAYEYARAVGRPKLVVVHKSTIQRLADGLFVTVAKELAHE--FPDIQLQT
ELIDNTVLNVVSNPSKYSDVVYVCPNLYGDILSDLNSGLSAGSLGLTPSGNIGHKVSIFE
AVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLA
GSASTSSFTEAVISRL-
>Kpol_543.8
-----------------------------------------------------MFNSRLQ
---LR--TVSR---FLST-----GQPSIGRFTGKPDPATGKFTVPFIEGDGVGPEISESV
KKIFSAAKVPIEWVPCDVGPIFVNGQTTIPEPAVELINKHLIALKGPLATPIGKGHRSLN
LTLRKTFNLFANVRPARSIPNYKSTYENVDLVLIRENTEGEYSGIEHVITPGVIQSIKLI
TREATERVVRYAFEYTQAIGRPRLLVIHKSTIQRMADGLFVKVAEELASE--YPDIKLET
EIIDKSILNVVSKPELYSDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFE
AVHGSAPDIAGQNKANPTALLLSSVMMLKHMGLDEHANKIENAVLTTIASGSENRTADLS
GTASTSSFTEEVIQRL-
>Kpol_440.12
-----------------------------------------------------MLRNTIY
---RG--SFAR---MMTT-----GQPNIGRFTGKPNPVTGKYTVPFIEGDGVGPEISKSV
KDIFAAAKVPIEWEPCDVGPIFVNGLTTIPDAAVQSINKHLVALKGPLATPIGKGHRSLN
LTLRKTFNLFANVRPARSVPNYKTTYQNVDLVLIRENTEGEYSGIEHVISPGVIQSIKLI
TKDASERVIRYAFEYTRAIGRPRLVVVHKSTIQRMADGLFVNVAKELASE--YPDIELQT
ELIDNTILNVVTHPESYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFE
AVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLNEHATKIENAILSTIASGSENRTGDLA
GTATTSSFTEAVINKL-