MUSCLE (3.8) multiple sequence alignment

ACL167C            ----------MAEE----------QRDALTE-SAELSEQKLEDGFT--------------
Ecym_4511          ----------MSQG----------TEDLVQEQSVELKGSTSDVERSDH----------VD
KLLA0E02311g       ------------------------MSDRVEE-EPERVNNE--------------------
TBLA0A06490        ------------------------------------------------------------
SAKL0G02662g       MCPFFYGKFYQNFEGKTVEIRTTLVKRNLDKRKKSALSMSEDNSETKD----------NT
KLTH0F15928g       ----------MSDQ----------GEGTVALENSQNELSEKQS-----------------
Kwal_55.21408      ----------MSQRDSEITRLG--LMSDSER-QAEVPRDSEEELRKET----------P-
ZYRO0F10164g       ----------MSDP----------QEQAPEA-TAPVQDSSAEKELSNE----------TK
TDEL0D02610        ----------MSEE----------VEDRVES-GQNSTVEPVEEPINGN----------AG
KNAG0B04210        ----------MSQEESAVVDSVATGSDTREEESATQMEETTREDVDTA----------GA
Suva_8.175         ----------MSSESPVGQSQNEQAVGDLGA-VPNNTIDEKPDVTQDN----------ND
YOR123C            ----------MSSESPQDQPQKEQISNNVGVTTNSTSNEETSRSQDDN----------VK
Smik_15.300        ----------MSSEILQDSPQNGQIVGDLDATSNNTSNEKIALTQDFN------------
Skud_15.285        ----------MSSETPMGETQNGEAVDDLDGTPNNGSIDKTDVTQDDNDYEVSEQDNNDD
TPHA0E01730        ----------MSAEESAQDPVNSMAAVTGEKNANENATIVEDNSVAEQ----------VE
Kpol_1062.26       ----------MSEE----------LQSNVVEEKPEDVVDGGEEVVERA------------
KAFR0D05050        ----------MSESV---------IRESLEPDVHEEVDNV--------------------
CAGL0K10230g       ----------MSEEEKHNM-----SEEQVELAPEEPPKEEAEDSVEDG----------KD
NDAI0C01590        ----------MSEERNGSQPAESNTDIDVKTPSLSVEATGVTENIGND----------DI
NCAS0H02080        ----------MSQEEVKEN-----ISTPIEE-ETPVVDNTSPTEITEE----------NK
                                                                               

ACL167C            --------------------------SDQGGSSANENDLFGEDSDVSG------------
Ecym_4511          IDKGQ---------------------SSERGSSDGGDDLFGDDSDQSVI-----------
KLLA0E02311g       --------------------------QIEEKVSDALDDLFGDESEEENQ-----------
TBLA0A06490        -----------------------------------MDDLFGDDEDEEAGDKN-----TQN
SAKL0G02662g       AIQESDASAGLENPIREASGKDNEDDNDNSGEDEEMDDLFGDDSDNAGEGEL--------
KLTH0F15928g       --------------------------PNVEADGEEMDDLFGDDSDQE-------------
Kwal_55.21408      --------------------------AQDGAEGEDMDDLFGDESDNNI------------
ZYRO0F10164g       QEPSG---------------------DEKSGSQDEMEDLFGEDEGEDEE-----------
TDEL0D02610        E-------------------------IEDSGGDDEMDDLFGDEGQASDR-----------
KNAG0B04210        TV------------------------DGDKGGDAGMDDLFGDDDDNAAAGDG--------
Suva_8.175         EKVNNQD-------------------EEEEEEEAELDDLFGDDDDDEKESGN--------
YOR123C            EVNGNDDTK-----------------EEEQEEDAELDDLFGDDNDDDDDDDV-----KKS
Smik_15.300        --------------------------DSKEEEDAELDDLFGDDDDDDNDDDNDDNDGKKS
Skud_15.285        EVNEQDNYDGEVNEKDVNDEKVNKRDDTKEEEDAELDDLFGDDDDDDDDEGT--------
TPHA0E01730        EQGG----------------------EQVEAEEEEIDDLFGDDDNEEDDGEDESILRKKR
Kpol_1062.26       --------------------------ESVEGAGSDMDDLFGDDDDDEDDDEG----VSRR
KAFR0D05050        --------------------------AQDQREPDDMDDLFGDDNDEQKE-----------
CAGL0K10230g       QE------------------------ETMPEKEEEMDDLFGDDEDDEDEEEI--TTGRGR
NDAI0C01590        NVEDEKVGEPDEEKEAEKEGEEGEE-EEEEEEQEGMDDLFGDDEDEDKEQRG--------
NCAS0H02080        K-------------------------EVAEEEADGMDDLFGDEEEEDENKSV--------
                                                       :****::                 

ACL167C            ---SDDADEADDGASEDSGSRRSRGTGHGLGA--EDNEEQEMYNRKFYGDDLQQASDLSD
Ecym_4511          ---ERGETD--DENSGGTSVKPTGL---GLSD---EEDEQEMYNRKFYGDDLKKTSYESD
KLLA0E02311g       ---QQSLDEQQNDSDDSSAGTSHHR---VIDD--EEDEEQAMYNRKFLGEDYE-GQSEEE
TBLA0A06490        EIDDDDDDDD-DDDDEGFVRKNRRS---EYDENSDDEQDKAMYEKKFYGEDGFNRSDDDD
SAKL0G02662g       ---EGEEKEGKSPNHLSKSEANHGS---YLEE----DEEQAMYNRKFYGDDVDNDSDAED
KLTH0F15928g       -----------TGSGPGEQEPHSPN---SANE--EEDDEQAMYNRKFYGDKGE-DSNDEG
Kwal_55.21408      -----------DQEDDGTQAREDGE---GEED---EEDEQAMYNRKFYGDNAE-DSNDEG
ZYRO0F10164g       ---DEKRKGSEDENDEGEVTLRHRQ---EMDD--EEAEEHAMYTRKFYGEDVD-RVSDEE
TDEL0D02610        ---GSDEEEGGSSNSDEEESSRRGE--MQMDD--EEAQEHAMYTRKFYGEDAD-NMSDQE
KNAG0B04210        -GRGSDDEDEGDDDDDVTGSSPRRK---RLDM----DEEEEMYNRKFYGEDV--DMSDTE
Suva_8.175         --ENIKSDNSGNSDEESANHRDHHRESLGLDD--DEAEEQAMYTRKFYGEDAN-DFSDQD
YOR123C            ETEKSDSDSDEDDEGENINHRSRHRESLGLDD--DEAEEQAMYTRKFYGEDAN-NFSDQD
Smik_15.300        GIENNNNESGGDSDEESVNHRSRHRESLGLDD--DEAEEQAMYTRKFYGEDLN-DFSDQD
Skud_15.285        --KPENSINSEDSDDEGVDHRSRHRESLGLDD--DEAEEQAMYTRKFYGEDAN-DYSDQD
TPHA0E01730        GVAESGDDDD-EHNDHDDIARRRRG---YMDE--DEDEEHAMYTRKFYGDEDVNKYDEDE
Kpol_1062.26       RIDTQGEGEDDGDEDEDNIGRRRRN---YVDE--DEDEEQAMYTRKFYGEDDY-DKSDQE
KAFR0D05050        ------EDDQEDEEDEGSYGGHRTS---YIDE------EEAMYNRKFYGEEGS-DMSDHE
CAGL0K10230g       NGTTGISDDEEDDDEEGITRRSREREDYDMEDYDDEAKEQEMYTRKFYGEDAV-NYSDDD
NDAI0C01590        ---SDDEEEGFIVEEDDESAQRRPE---DMDD------EEAMYTRKFYGDTD--KYSDNE
NCAS0H02080        ---------DEQSEDDDIGSRPRRT---DIDE------EEAMYTRKFYGDDDYNRYSSDQ
                                                         :  ** .** *:          

ACL167C            EDEAREIKEADLELVKHVVPLLYNKPLEG--------KRLLYYTKVPQFLTIDPVPFDPP
Ecym_4511          VEEEREIKEANVQIMKHVVPYYTTNASEK--------DSSLYYAKVPQFLTIDPIPFDPP
KLLA0E02311g       YE--KKYKEVDVEIVKHVVPYKTANGADD---------KTIYYAKVPQFLTIDPVPFDPP
TBLA0A06490        NE--YEYKESDIELVRHIVPYKTRPSNKE-----LDKHRELYYAKVPPFLMVDPVPFDST
SAKL0G02662g       SQ--REFKEADVEIAKHIVPYKTTSNSQD---------KEVYYAKVPQFLTIDPVPFDPP
KLTH0F15928g       S---QEFREADIDIMKHIVPYSTEPSQGD---------KTIYYTKVPQFLTIDPIPFDPP
Kwal_55.21408      SQ--REFREADVDVVKHVVPYSTVPSEGD---------KTIFYAKVPQFLTIDPIPFDPP
ZYRO0F10164g       EA--QEFREEDVELVRHIVPYRATQGTDK---------PVLYYAKIPEFLTIDPVPFDPP
TDEL0D02610        ESA-NHFTEENVELVRHIVPYKTVGEGAD-------EKSTIYYAKVPEFLTIDPVPFDPP
KNAG0B04210        QAE-HEFKEANVELVKHIVPYKLVPDDAI-------GTNDIYVAKVPPFLMIDPAPFDPT
Suva_8.175         EAT-HTFKEENVELVRHIIPSKANVNETA-------SHNEIFYARIPNFLTIDPIPFDPP
YOR123C            ETT-HTFKEENVELVRHIIPSKANVNETA-------SHNEIFYARIPNFLTIDPIPFDPP
Smik_15.300        EAT-HTFKEENVELVRHIIPSKGIVNETA-------SHNEIFYARIPNFLTIDPVPFDPP
Skud_15.285        EAA-HTFKEENIEIVRHIIPNKANVNETA-------SHNEIFYARIPNFLTIDAVPFDPP
TPHA0E01730        NM--HEFKEADVELVRHIVPYKILEQKNDNSKDDATSKNSTYYARIPPFLTIDPVPFDPP
Kpol_1062.26       EDK-HEFREEDVVLTRHVVPTKITSEEND-------ADTTIYYAKVPPFLTIDPIPFDPP
KAFR0D05050        EE--ALFKEADVELVRHVVPYKTFPENED--------DKTIYYTKVPAFLSIDPLPFDPP
CAGL0K10230g       EP--HTFKESNVDLIRHIIPYKTRTTNNE--------HDEIFYAKVPAFLTIDPVPFDPQ
NDAI0C01590        EDA-HDFKEANVEIIRHMVPYKTSSDQAD---------TTIYYAKVPPFLTIDPIPFDPV
NCAS0H02080        DNALHHFKEENVELIRHMVPYKTSSEKTD--------ETTVYYAKVPPFLTINPVPFDPI
                           * :: : .*::*                     : :.:* ** ::. ***. 

ACL167C            SFQGQIEKRMARFSSKEDQLGDSLIDENTIRWRYSRGS--DQRVFKESNAQVIEWSDGTL
Ecym_4511          GFQSQIEQRLKRFSSKEDQLGDRLIDENTIRWRYSRGA--NQQVFKESNAQIIQWSDGTF
KLLA0E02311g       SFQKKVEDRVSKYSSKEDQLGDRLIEENTIRWRYSRDK--DERVFKESNAQIVEWSDGTF
TBLA0A06490        NFESAVKERIKNSLNEDTQITDRLRDENTIRWRYSRDSNDNDKVFKQSNAQIIQWSDGSY
SAKL0G02662g       SFKRNVEGRLAQFSSKEDQLDDRLIDENTIRWRYSRDS--KQQVFKESNAQIIQWSDGTF
KLTH0F15928g       AFQSKIEERAAQRTSVEDQIDDRLIEENTVRWRYSRDK--NQRVFKESNAHIVQWSDGTY
Kwal_55.21408      AFQNKIEQRTAQLSSTEDQIDDRLIEENTVRWRYSRDS--KQQVFKESNAQIVQWSDGTF
ZYRO0F10164g       SFEASVKERLGNKASKEDQLGDRLIDENTVRWRYSRDA--NQQVFKESNAQIVQWSDGTF
TDEL0D02610        SFESKVKERL-NSSSREDQLGDRLIDENTIRWRYSRDE--NQQVYKESNAQIVQWSDGGL
KNAG0B04210        SFEGKVADRLDGSLSKEDRLGDRLIDENTVRWRYSRDT--NQSVFKESNTQIVQWSDGSY
Suva_8.175         SFEAKVNERANNSISKEDQLDDRLIDENTVRWRYSRDN--DQHVFKESNTQIVQWSDGSY
YOR123C            SFEAKVNERASNSASREDQLDDRLIDENTVRWRYSRDK--DQHVFKESNTQIVQWSDGTY
Smik_15.300        SFEAKVNERTSNSASKEDQLDDRLIDENTVRWRYSRDK--DQHVFKESNTQIVQWSDGTY
Skud_15.285        SFEAKVNERAINSTSKEDQLDDRLIDENTVRWRYSRDK--DQHVFKESNTQIVQWSDGSY
TPHA0E01730        QFESEVKERLENTTNVKDRIGDRLIDENTIRWRYSRDA--NQTVFKESNAQIIQWSDGSY
Kpol_1062.26       TFENVVRERLTNGLSKEEQLEDRLIDQNTIRWRYSRDD--NQRVFKESNATIVQWSDGSY
KAFR0D05050        SFENKVKERTSNFSSVEDQLGDRLIDENTIRWRYSRDA--EQRVFKESNAQIVQWSDGSY
CAGL0K10230g       TFEATVDERLSKSASKEDQLGDRLIDENTIRWRYSRDA--EQHVFKESNAQIVQWSDGSF
NDAI0C01590        SFETKVKDRLADYSSREDQLGDRLIDENTIRWRYSRDQ--NQRVFKESNAQIVQWSDGSF
NCAS0H02080        AFESDVRDRLSNYSSKEDQLGDRLIDENTVRWRYSRDA--NQRVFKESNAQIVQWSDGSF
                    *:  :  *     . . .: * * ::**:******.   .: *:*:**: :::****  

ACL167C            SLKLGDEYTDILTNEIENTYLTVSHEQQEIMQCVEGGTISNSMLFIPTSTNSKIHKRLTK
Ecym_4511          SLKLGDEFSDILINDIENTYMTVSHEQEELMQCVEGGEIKKSMLFIPTSTNSKTHQRLSA
KLLA0E02311g       SLKVGDEYTDILVNNTENTYLTVSHEEQELIQCVEGGEITKSMMFVPTSTNSKVHKILSK
TBLA0A06490        SLKLGNDYTDILTNETDNIFLTVSHDQQELMQCYNGGEITKTLMFIPSSTKSKIHQRLTA
SAKL0G02662g       SLRLGDEFSDVLINDTDNTFLTVSHEQQELMQCVEGGEITKTMMFIPTSTSSKIHQRLSK
KLTH0F15928g       SLRLGDEYTDVLINDTEDTYLAVSHDQQELIQSVKGGEVTKNMIFIPTSTNSKSHQRLSK
Kwal_55.21408      SLRLGDEFTDVLINDTEDTYLTVSHDQQELIQSVKGGEVTKNMIFIPTSTNSKSHQRLSK
ZYRO0F10164g       SLKLGDEYTDILSNDTDNTFFAVSHDQQELMQCYEGGEVTKTLMFIPTSTSSRMHQKLTK
TDEL0D02610        SLKLGTEYTDILVNDTDNTFFAVSHDEQELMQCSQGGEVTKSLMFIPTSTNSKMHQKLTK
KNAG0B04210        SLKLGNEYTDILINDTDNTFLTVSHDQQELMQCVEGGLVNKTLMFIPTSTSSKIHQKLSK
Suva_8.175         SLKVGEEYTDILVNDTSNTFLTVSHDQQELMQCYEGGEIKKTLMFIPTSTSSKIHQKLSK
YOR123C            SLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEIKKTLMFIPTSTNSKIHQKLSK
Smik_15.300        SLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEIKKTLMFIPTSTNSKIHQKLSK
Skud_15.285        SLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEIKKTLMFIPTSTNSKIHQKLSK
TPHA0E01730        SLKLGDDYTDLLVNDISNTFLTVSHDQQELMQCVDGGEISKSAMFVPISTNSRLHQRLSK
Kpol_1062.26       SLKLGDEYTDILLNDTDNTFLTVSHDQQELMQCVHGGEISKSLLFVPISTTSKLHQRLSK
KAFR0D05050        SLKLGAEYTDILVNGTDNTFLTVSHDQQELMQCVDGGQINKTLIFIPTSTNSKIHQRLSK
CAGL0K10230g       SLKLGDEYTDIIVNDTDNTFLTVSHDQQELMQCYDGGEITKTMMFIPTSTNSKIHQKLSK
NDAI0C01590        SLKLGDEYTDILVNDTDNTFLTVSHDQQELMQCYNGGEITKTMMFIPTSTNSKIHQQLSK
NCAS0H02080        SLKLGDEYTDILVNETNNTFLAVSHDQQELMQCYNGGEITKTLMFIPTSTNSKIHQQLSK
                   **.:* : :*:: *  .: :::***:::*::*.  ** :.:. :*:* **.*. *: *: 

ACL167C            AIARREAREHSGPSTYIVRKDPELEKRELQKKHDQVLRERRKRQLKEQLD-RDNLE----
Ecym_4511          AIARREAREHSGPSTYIVRMDPELEKKELEKKHDQVIRERRKRQLKEQMD-RENAE-GGI
KLLA0E02311g       AVARRDERGQHGPNTYITRTDPELEKRELEKKHDQILRERRKKQLKEKLE-LENAG----
TBLA0A06490        AVQNRDKKTTSGPGMMLINTDPEIEKKLLEKKQWQMMRDRRRKQLQERENNEVDGITSGF
SAKL0G02662g       AVVRREQREHLGPNTYIVRKDPELEQRELEKKQDQIVRERRKRQLKEQLE-KENRD----
KLTH0F15928g       AVARKEQQEHHGPNTYILRVDPELEQKELEKKQGQIIRERRKRQLREQQE-REGMD----
Kwal_55.21408      AVARKEQREHHGPNTYILRVDPELEQKELEKKQGQIIRERRKRQLREQQE-REGLD----
ZYRO0F10164g       AVMRRDHKQAAGPGTYIVQKDPELERGELEKKQQQVVRERRRRQVKEMES-RE-------
TDEL0D02610        AVIRRDQRQTKGPGVYFVNKDPELEKNELEKKQQQVVRERRKRQLKEIES-RNSPD-IST
KNAG0B04210        AVARRNVMQSAGPGTYIVSVDPEIEKKELERKQGQIFKERRRRQLREKEL-AESPD-TTI
Suva_8.175         AVVRKNQRQNQGPGTYIINMDPEVEKRELEKKQSQILRDRRKRQLKEKEK-QESPD----
YOR123C            AVIRRNQRQSKGPGTYIVSMDPEVEKKELERKQSQILRDRRRRQLKEKEK-QESPD----
Smik_15.300        AVIRRNQRQNKGPGTYIVSMDPEVEKRELEKKQSQILRDRRRRQLKEKEK-QESPD----
Skud_15.285        AVIRRNQRQNKGPGTYIVNMDPEVEKKELEKKQSQVLRDRRRRQLKEREK-QESPD----
TPHA0E01730        AIARRDQNSTESPRSMIINVDPEIEKKELEKKQSQIFRDRRKRKQREIETEQEALDSPGF
Kpol_1062.26       AIVRRNATETMGPRSMIVNIDPELEKKELEKKQSQVFRERRKKKQKEIEA-LESLETTGF
KAFR0D05050        AIARRDQRVHSGPGTMIVNLDPEVEKRELEKKQTQIIRERRRRQMKEQER-LESPE----
CAGL0K10230g       AVSRRNARQNLGPGSYIIKQDPEIEKKELEKLQGQIIRERRKRQQKEIET-RENAE----
NDAI0C01590        AVTRRNQRQNLGPGTMIIEKDPELEKKELEKKQGQILRERRKRQLKEREI-QESPD-TTF
NCAS0H02080        AVTRRNQREHLGPGTMIINRDPEVEKRELEKKQGQIIRDRRRRQLKEKEL-LESPD-TTM
                   *: ..:     .*   :   ***:*.  *:. : *:..:**..: .*             

ACL167C            GGLAQGSFEFKKAAGRAAPY-SR-SMEDEYDDEDGFIDDDDDLEALSDNDDAADS-----
Ecym_4511          VETGYFGFKKGNGRSMMAEMYGK-HHQDEYDDEDGFIDDSEEEESGSYDEENAAGS----
KLLA0E02311g       --DSPEPQFNIQKNLS-----KR-HNLDEYEYDDGFVAQDDEEEDDEEEEEDEDFSGED-
TBLA0A06490        SKRDNSPSINSQSIKGSRSDRNHDYRRNEYE-EDDFIVDDEDEEVDGMVDDDDDNA----
SAKL0G02662g       ---SVEPLGVRKSATSSF---GV-GRRNEYE-EDDFLVDDEEEEEEGGISGEE-------
KLTH0F15928g       ---SPAPTSKPRSASRPGY--SQ-TRYDEYE-DDGFMVDDEENESDGGVGGDGNEDE---
Kwal_55.21408      ---SPAPAAKPKSTSSLGY--SQ-SRYDEYE-DDGFMVDDENNETGEDDEGEDDED----
ZYRO0F10164g       ---ASGDPDRRAAISAEAEPMGN-IRRNEYE-QDDFLVDDDDEEEYASGSGEE-------
TDEL0D02610        GLNGYRKTPVTASDEQDSYY-GS-SKRNEYE-QDDFLVDDDEEEEAGYSEEDDVL-----
KNAG0B04210        GGPRSGSAGSWHGTPRTARMVGRKSREDEYE-EDDFLVDDDEDEDEFQDEEEEEDA----
Suva_8.175         ---VGFETAFRKQSSPTAY--GA-TRRNEYE-EDDFLVDDDEEEEAEFDD----------
YOR123C            ---AAFETGFRKQNSPTTY--GA-SRRNEYE-EDDFLVDDDEEEEAAFDDEE--------
Smik_15.300        ---AAFETGFRKQSSPTAY--GT-SRRNEYE-EDDFLVDDDEEEEAEFDDDDDNE-----
Skud_15.285        ---AAFETGFRKQSSPTSY--GI-SRRNEYE-EDDFLVDDDEEEEAGFDDGDDE------
TPHA0E01730        SQGNYGSSSSRKRGQTPSYDPRR-ERADEYE-EDDFIVDDEGEEDDDVEDDVED------
Kpol_1062.26       G-NNSYSASRKRSTTPMSY--GG-SRRDEYE-EDDFIVDDEEEEPEYAGEEDDDDLDGFE
KAFR0D05050        --LGAFSHSNRRSQTPSQGYERT-HREDEYE-EDDFLVDDDEEDESVELESGA-------
CAGL0K10230g       --NGFAETGEFKRGNTPS---RS-SRQNEYE-DDGFLVDDEDEEDFI-------------
NDAI0C01590        --DVRGSASSKNRSPAPSSY-RG-SRQDEYE-EDDFLVDDDEEEEFVGDEDEE-------
NCAS0H02080        --DVSGGYETRKRNTPNPSL-GS-RRQDEYE-EDDFLVDDEDEEDFIEDD----------
                                              :**: :*.*: :.:  :                

ACL167C            -LPGSPTASQD----EEDDLNAARLQQLKREGAAKYA-------AAP-----PAPRADEE
Ecym_4511          -LMDEESDGED----DEDDLNAERLKQLKIEGAARYQHGSTTTTSPSDLDTKQDPENNDG
KLLA0E02311g       -NDVGDEEESDGGDSEKEYENAKRLREVKQTGAQEYQ-------ED--------------
TBLA0A06490        -EEEEEEEEEE----DEDDLNAERLRNAKRQGYQE-D-------DDERDARNEEEQSSSS
SAKL0G02662g       -EEEAEEEDDD----DEDDLNAERLRQLKREGAAQYE-------QKD------EESGSEE
KLTH0F15928g       -EDLLDDEEEE----DDDDLNAERLRQLKRKGAAQYN-------TQEASDNNVESDDAED
Kwal_55.21408      -DLLDDNNEEE----EDDDLNAERLRQLKRSGASQYR-------SEGSEDDHVADEEPQD
ZYRO0F10164g       -GEEEEEEDEG----NVSDEGAERLRRLKREGANNYE-------E---------------
TDEL0D02610        -DDNNDDQEAE----DEEDAKAERLRQLKRQGTERYT-------EPE---------PESD
KNAG0B04210        -EEEEEEEEEGAEEEERERANAQRLTEAKRNSDLMHK-------NDH---------DSAE
Suva_8.175         -DDDNEEEEEE----EADEDNAARLRNLKREGAAMYK-------EEG--------GDDDS
YOR123C            -DDNEEEEEEE----DADEENASRLRNLKREGAAMYR-------EEE-------EEEKDR
Smik_15.300        -EEEEEEEEEEEEEEDADEANAARLRSLKKEGAAMYR-------QEE---------NEDN
Skud_15.285        -EEEEEEEEEE----EADQENAARLRNLKREGAAMYK-------EEE--------KDDDS
TPHA0E01730        -EEDEDEEEEE----EEEERNLERLKNSKTQNDFEVE-------ED--------------
Kpol_1062.26       EEEEEQEEEEEGEDEDADEKRAERLRELKRQGTAAYN-------DDE---------KSGS
KAFR0D05050        -DEEDDEEEEEAQFSDEDEARAERLKEMKRSNKVVIE-------E-----------ENDE
CAGL0K10230g       -DDGEEEEEEE----EDDDLDADRLRNAKRQGEHAFT-------ED----------DDEE
NDAI0C01590        -EEEEEEEEEE----DEDDRKAKRLKEIKKGGAQEYA-------DRE-------ESDMEE
NCAS0H02080        -EEEEEEEEEE----DNDEEKAERLRNAKRSGYDEDN-------QES-------GTENES
                                  : .     **   *  .                            

ACL167C            VALKRRKVAVLDSDDE---
Ecym_4511          SAPKRRKVAVLDSDDE---
KLLA0E02311g       AQAKKRKIAVLDDEDDE--
TBLA0A06490        EVTKRRKIAVIDDEDDE--
SAKL0G02662g       SSHKRRKIAVLDDEEEDE-
KLTH0F15928g       SAMKRRKVAVLDDEDDE--
Kwal_55.21408      STLKRRKVAVLDDEDDE--
ZYRO0F10164g       --RKRRRVAVIDDEEDE--
TDEL0D02610        PSTKRRKVAIIDDEDDE--
KNAG0B04210        SPEKRRKVAVIDDEDDEDE
Suva_8.175         NESKRRRVAVIEDDEDED-
YOR123C            SETKRRRVAVIEDDEDED-
Smik_15.300        NETKRRRVAVIEDDEEED-
Skud_15.285        NETKRRRVAVIEDDEDEE-
TPHA0E01730        --SKRRKVAVIDDEDDE--
Kpol_1062.26       ESPKRRKVAVIEDDEDD--
KAFR0D05050        NSPKRRKGPVISDDEDED-
CAGL0K10230g       DDNKRRKTAIISSEEDD--
NDAI0C01590        GSSKRRKVAVLSDDEEDE-
NCAS0H02080        SSSKKRRVAVINDDEDDE-
                      *.*. .::..:::   

FASTA FORMAT for MUSCLE Version 3.6

>ACL167C
----------MAEE----------QRDALTE-SAELSEQKLEDGFT--------------
--------------------------SDQGGSSANENDLFGEDSDVSG------------
---SDDADEADDGASEDSGSRRSRGTGHGLGA--EDNEEQEMYNRKFYGDDLQQASDLSD
EDEAREIKEADLELVKHVVPLLYNKPLEG--------KRLLYYTKVPQFLTIDPVPFDPP
SFQGQIEKRMARFSSKEDQLGDSLIDENTIRWRYSRGS--DQRVFKESNAQVIEWSDGTL
SLKLGDEYTDILTNEIENTYLTVSHEQQEIMQCVEGGTISNSMLFIPTSTNSKIHKRLTK
AIARREAREHSGPSTYIVRKDPELEKRELQKKHDQVLRERRKRQLKEQLD-RDNLE----
GGLAQGSFEFKKAAGRAAPY-SR-SMEDEYDDEDGFIDDDDDLEALSDNDDAADS-----
-LPGSPTASQD----EEDDLNAARLQQLKREGAAKYA-------AAP-----PAPRADEE
VALKRRKVAVLDSDDE---
>Ecym_4511
----------MSQG----------TEDLVQEQSVELKGSTSDVERSDH----------VD
IDKGQ---------------------SSERGSSDGGDDLFGDDSDQSVI-----------
---ERGETD--DENSGGTSVKPTGL---GLSD---EEDEQEMYNRKFYGDDLKKTSYESD
VEEEREIKEANVQIMKHVVPYYTTNASEK--------DSSLYYAKVPQFLTIDPIPFDPP
GFQSQIEQRLKRFSSKEDQLGDRLIDENTIRWRYSRGA--NQQVFKESNAQIIQWSDGTF
SLKLGDEFSDILINDIENTYMTVSHEQEELMQCVEGGEIKKSMLFIPTSTNSKTHQRLSA
AIARREAREHSGPSTYIVRMDPELEKKELEKKHDQVIRERRKRQLKEQMD-RENAE-GGI
VETGYFGFKKGNGRSMMAEMYGK-HHQDEYDDEDGFIDDSEEEESGSYDEENAAGS----
-LMDEESDGED----DEDDLNAERLKQLKIEGAARYQHGSTTTTSPSDLDTKQDPENNDG
SAPKRRKVAVLDSDDE---
>KLLA0E02311g
------------------------MSDRVEE-EPERVNNE--------------------
--------------------------QIEEKVSDALDDLFGDESEEENQ-----------
---QQSLDEQQNDSDDSSAGTSHHR---VIDD--EEDEEQAMYNRKFLGEDYE-GQSEEE
YE--KKYKEVDVEIVKHVVPYKTANGADD---------KTIYYAKVPQFLTIDPVPFDPP
SFQKKVEDRVSKYSSKEDQLGDRLIEENTIRWRYSRDK--DERVFKESNAQIVEWSDGTF
SLKVGDEYTDILVNNTENTYLTVSHEEQELIQCVEGGEITKSMMFVPTSTNSKVHKILSK
AVARRDERGQHGPNTYITRTDPELEKRELEKKHDQILRERRKKQLKEKLE-LENAG----
--DSPEPQFNIQKNLS-----KR-HNLDEYEYDDGFVAQDDEEEDDEEEEEDEDFSGED-
-NDVGDEEESDGGDSEKEYENAKRLREVKQTGAQEYQ-------ED--------------
AQAKKRKIAVLDDEDDE--
>TBLA0A06490
------------------------------------------------------------
-----------------------------------MDDLFGDDEDEEAGDKN-----TQN
EIDDDDDDDD-DDDDEGFVRKNRRS---EYDENSDDEQDKAMYEKKFYGEDGFNRSDDDD
NE--YEYKESDIELVRHIVPYKTRPSNKE-----LDKHRELYYAKVPPFLMVDPVPFDST
NFESAVKERIKNSLNEDTQITDRLRDENTIRWRYSRDSNDNDKVFKQSNAQIIQWSDGSY
SLKLGNDYTDILTNETDNIFLTVSHDQQELMQCYNGGEITKTLMFIPSSTKSKIHQRLTA
AVQNRDKKTTSGPGMMLINTDPEIEKKLLEKKQWQMMRDRRRKQLQERENNEVDGITSGF
SKRDNSPSINSQSIKGSRSDRNHDYRRNEYE-EDDFIVDDEDEEVDGMVDDDDDNA----
-EEEEEEEEEE----DEDDLNAERLRNAKRQGYQE-D-------DDERDARNEEEQSSSS
EVTKRRKIAVIDDEDDE--
>SAKL0G02662g
MCPFFYGKFYQNFEGKTVEIRTTLVKRNLDKRKKSALSMSEDNSETKD----------NT
AIQESDASAGLENPIREASGKDNEDDNDNSGEDEEMDDLFGDDSDNAGEGEL--------
---EGEEKEGKSPNHLSKSEANHGS---YLEE----DEEQAMYNRKFYGDDVDNDSDAED
SQ--REFKEADVEIAKHIVPYKTTSNSQD---------KEVYYAKVPQFLTIDPVPFDPP
SFKRNVEGRLAQFSSKEDQLDDRLIDENTIRWRYSRDS--KQQVFKESNAQIIQWSDGTF
SLRLGDEFSDVLINDTDNTFLTVSHEQQELMQCVEGGEITKTMMFIPTSTSSKIHQRLSK
AVVRREQREHLGPNTYIVRKDPELEQRELEKKQDQIVRERRKRQLKEQLE-KENRD----
---SVEPLGVRKSATSSF---GV-GRRNEYE-EDDFLVDDEEEEEEGGISGEE-------
-EEEAEEEDDD----DEDDLNAERLRQLKREGAAQYE-------QKD------EESGSEE
SSHKRRKIAVLDDEEEDE-
>KLTH0F15928g
----------MSDQ----------GEGTVALENSQNELSEKQS-----------------
--------------------------PNVEADGEEMDDLFGDDSDQE-------------
-----------TGSGPGEQEPHSPN---SANE--EEDDEQAMYNRKFYGDKGE-DSNDEG
S---QEFREADIDIMKHIVPYSTEPSQGD---------KTIYYTKVPQFLTIDPIPFDPP
AFQSKIEERAAQRTSVEDQIDDRLIEENTVRWRYSRDK--NQRVFKESNAHIVQWSDGTY
SLRLGDEYTDVLINDTEDTYLAVSHDQQELIQSVKGGEVTKNMIFIPTSTNSKSHQRLSK
AVARKEQQEHHGPNTYILRVDPELEQKELEKKQGQIIRERRKRQLREQQE-REGMD----
---SPAPTSKPRSASRPGY--SQ-TRYDEYE-DDGFMVDDEENESDGGVGGDGNEDE---
-EDLLDDEEEE----DDDDLNAERLRQLKRKGAAQYN-------TQEASDNNVESDDAED
SAMKRRKVAVLDDEDDE--
>Kwal_55.21408
----------MSQRDSEITRLG--LMSDSER-QAEVPRDSEEELRKET----------P-
--------------------------AQDGAEGEDMDDLFGDESDNNI------------
-----------DQEDDGTQAREDGE---GEED---EEDEQAMYNRKFYGDNAE-DSNDEG
SQ--REFREADVDVVKHVVPYSTVPSEGD---------KTIFYAKVPQFLTIDPIPFDPP
AFQNKIEQRTAQLSSTEDQIDDRLIEENTVRWRYSRDS--KQQVFKESNAQIVQWSDGTF
SLRLGDEFTDVLINDTEDTYLTVSHDQQELIQSVKGGEVTKNMIFIPTSTNSKSHQRLSK
AVARKEQREHHGPNTYILRVDPELEQKELEKKQGQIIRERRKRQLREQQE-REGLD----
---SPAPAAKPKSTSSLGY--SQ-SRYDEYE-DDGFMVDDENNETGEDDEGEDDED----
-DLLDDNNEEE----EDDDLNAERLRQLKRSGASQYR-------SEGSEDDHVADEEPQD
STLKRRKVAVLDDEDDE--
>ZYRO0F10164g
----------MSDP----------QEQAPEA-TAPVQDSSAEKELSNE----------TK
QEPSG---------------------DEKSGSQDEMEDLFGEDEGEDEE-----------
---DEKRKGSEDENDEGEVTLRHRQ---EMDD--EEAEEHAMYTRKFYGEDVD-RVSDEE
EA--QEFREEDVELVRHIVPYRATQGTDK---------PVLYYAKIPEFLTIDPVPFDPP
SFEASVKERLGNKASKEDQLGDRLIDENTVRWRYSRDA--NQQVFKESNAQIVQWSDGTF
SLKLGDEYTDILSNDTDNTFFAVSHDQQELMQCYEGGEVTKTLMFIPTSTSSRMHQKLTK
AVMRRDHKQAAGPGTYIVQKDPELERGELEKKQQQVVRERRRRQVKEMES-RE-------
---ASGDPDRRAAISAEAEPMGN-IRRNEYE-QDDFLVDDDDEEEYASGSGEE-------
-GEEEEEEDEG----NVSDEGAERLRRLKREGANNYE-------E---------------
--RKRRRVAVIDDEEDE--
>TDEL0D02610
----------MSEE----------VEDRVES-GQNSTVEPVEEPINGN----------AG
E-------------------------IEDSGGDDEMDDLFGDEGQASDR-----------
---GSDEEEGGSSNSDEEESSRRGE--MQMDD--EEAQEHAMYTRKFYGEDAD-NMSDQE
ESA-NHFTEENVELVRHIVPYKTVGEGAD-------EKSTIYYAKVPEFLTIDPVPFDPP
SFESKVKERL-NSSSREDQLGDRLIDENTIRWRYSRDE--NQQVYKESNAQIVQWSDGGL
SLKLGTEYTDILVNDTDNTFFAVSHDEQELMQCSQGGEVTKSLMFIPTSTNSKMHQKLTK
AVIRRDQRQTKGPGVYFVNKDPELEKNELEKKQQQVVRERRKRQLKEIES-RNSPD-IST
GLNGYRKTPVTASDEQDSYY-GS-SKRNEYE-QDDFLVDDDEEEEAGYSEEDDVL-----
-DDNNDDQEAE----DEEDAKAERLRQLKRQGTERYT-------EPE---------PESD
PSTKRRKVAIIDDEDDE--
>KNAG0B04210
----------MSQEESAVVDSVATGSDTREEESATQMEETTREDVDTA----------GA
TV------------------------DGDKGGDAGMDDLFGDDDDNAAAGDG--------
-GRGSDDEDEGDDDDDVTGSSPRRK---RLDM----DEEEEMYNRKFYGEDV--DMSDTE
QAE-HEFKEANVELVKHIVPYKLVPDDAI-------GTNDIYVAKVPPFLMIDPAPFDPT
SFEGKVADRLDGSLSKEDRLGDRLIDENTVRWRYSRDT--NQSVFKESNTQIVQWSDGSY
SLKLGNEYTDILINDTDNTFLTVSHDQQELMQCVEGGLVNKTLMFIPTSTSSKIHQKLSK
AVARRNVMQSAGPGTYIVSVDPEIEKKELERKQGQIFKERRRRQLREKEL-AESPD-TTI
GGPRSGSAGSWHGTPRTARMVGRKSREDEYE-EDDFLVDDDEDEDEFQDEEEEEDA----
-EEEEEEEEEGAEEEERERANAQRLTEAKRNSDLMHK-------NDH---------DSAE
SPEKRRKVAVIDDEDDEDE
>Suva_8.175
----------MSSESPVGQSQNEQAVGDLGA-VPNNTIDEKPDVTQDN----------ND
EKVNNQD-------------------EEEEEEEAELDDLFGDDDDDEKESGN--------
--ENIKSDNSGNSDEESANHRDHHRESLGLDD--DEAEEQAMYTRKFYGEDAN-DFSDQD
EAT-HTFKEENVELVRHIIPSKANVNETA-------SHNEIFYARIPNFLTIDPIPFDPP
SFEAKVNERANNSISKEDQLDDRLIDENTVRWRYSRDN--DQHVFKESNTQIVQWSDGSY
SLKVGEEYTDILVNDTSNTFLTVSHDQQELMQCYEGGEIKKTLMFIPTSTSSKIHQKLSK
AVVRKNQRQNQGPGTYIINMDPEVEKRELEKKQSQILRDRRKRQLKEKEK-QESPD----
---VGFETAFRKQSSPTAY--GA-TRRNEYE-EDDFLVDDDEEEEAEFDD----------
-DDDNEEEEEE----EADEDNAARLRNLKREGAAMYK-------EEG--------GDDDS
NESKRRRVAVIEDDEDED-
>YOR123C
----------MSSESPQDQPQKEQISNNVGVTTNSTSNEETSRSQDDN----------VK
EVNGNDDTK-----------------EEEQEEDAELDDLFGDDNDDDDDDDV-----KKS
ETEKSDSDSDEDDEGENINHRSRHRESLGLDD--DEAEEQAMYTRKFYGEDAN-NFSDQD
ETT-HTFKEENVELVRHIIPSKANVNETA-------SHNEIFYARIPNFLTIDPIPFDPP
SFEAKVNERASNSASREDQLDDRLIDENTVRWRYSRDK--DQHVFKESNTQIVQWSDGTY
SLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEIKKTLMFIPTSTNSKIHQKLSK
AVIRRNQRQSKGPGTYIVSMDPEVEKKELERKQSQILRDRRRRQLKEKEK-QESPD----
---AAFETGFRKQNSPTTY--GA-SRRNEYE-EDDFLVDDDEEEEAAFDDEE--------
-DDNEEEEEEE----DADEENASRLRNLKREGAAMYR-------EEE-------EEEKDR
SETKRRRVAVIEDDEDED-
>Smik_15.300
----------MSSEILQDSPQNGQIVGDLDATSNNTSNEKIALTQDFN------------
--------------------------DSKEEEDAELDDLFGDDDDDDNDDDNDDNDGKKS
GIENNNNESGGDSDEESVNHRSRHRESLGLDD--DEAEEQAMYTRKFYGEDLN-DFSDQD
EAT-HTFKEENVELVRHIIPSKGIVNETA-------SHNEIFYARIPNFLTIDPVPFDPP
SFEAKVNERTSNSASKEDQLDDRLIDENTVRWRYSRDK--DQHVFKESNTQIVQWSDGTY
SLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEIKKTLMFIPTSTNSKIHQKLSK
AVIRRNQRQNKGPGTYIVSMDPEVEKRELEKKQSQILRDRRRRQLKEKEK-QESPD----
---AAFETGFRKQSSPTAY--GT-SRRNEYE-EDDFLVDDDEEEEAEFDDDDDNE-----
-EEEEEEEEEEEEEEDADEANAARLRSLKKEGAAMYR-------QEE---------NEDN
NETKRRRVAVIEDDEEED-
>Skud_15.285
----------MSSETPMGETQNGEAVDDLDGTPNNGSIDKTDVTQDDNDYEVSEQDNNDD
EVNEQDNYDGEVNEKDVNDEKVNKRDDTKEEEDAELDDLFGDDDDDDDDEGT--------
--KPENSINSEDSDDEGVDHRSRHRESLGLDD--DEAEEQAMYTRKFYGEDAN-DYSDQD
EAA-HTFKEENIEIVRHIIPNKANVNETA-------SHNEIFYARIPNFLTIDAVPFDPP
SFEAKVNERAINSTSKEDQLDDRLIDENTVRWRYSRDK--DQHVFKESNTQIVQWSDGSY
SLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEIKKTLMFIPTSTNSKIHQKLSK
AVIRRNQRQNKGPGTYIVNMDPEVEKKELEKKQSQVLRDRRRRQLKEREK-QESPD----
---AAFETGFRKQSSPTSY--GI-SRRNEYE-EDDFLVDDDEEEEAGFDDGDDE------
-EEEEEEEEEE----EADQENAARLRNLKREGAAMYK-------EEE--------KDDDS
NETKRRRVAVIEDDEDEE-
>TPHA0E01730
----------MSAEESAQDPVNSMAAVTGEKNANENATIVEDNSVAEQ----------VE
EQGG----------------------EQVEAEEEEIDDLFGDDDNEEDDGEDESILRKKR
GVAESGDDDD-EHNDHDDIARRRRG---YMDE--DEDEEHAMYTRKFYGDEDVNKYDEDE
NM--HEFKEADVELVRHIVPYKILEQKNDNSKDDATSKNSTYYARIPPFLTIDPVPFDPP
QFESEVKERLENTTNVKDRIGDRLIDENTIRWRYSRDA--NQTVFKESNAQIIQWSDGSY
SLKLGDDYTDLLVNDISNTFLTVSHDQQELMQCVDGGEISKSAMFVPISTNSRLHQRLSK
AIARRDQNSTESPRSMIINVDPEIEKKELEKKQSQIFRDRRKRKQREIETEQEALDSPGF
SQGNYGSSSSRKRGQTPSYDPRR-ERADEYE-EDDFIVDDEGEEDDDVEDDVED------
-EEDEDEEEEE----EEEERNLERLKNSKTQNDFEVE-------ED--------------
--SKRRKVAVIDDEDDE--
>Kpol_1062.26
----------MSEE----------LQSNVVEEKPEDVVDGGEEVVERA------------
--------------------------ESVEGAGSDMDDLFGDDDDDEDDDEG----VSRR
RIDTQGEGEDDGDEDEDNIGRRRRN---YVDE--DEDEEQAMYTRKFYGEDDY-DKSDQE
EDK-HEFREEDVVLTRHVVPTKITSEEND-------ADTTIYYAKVPPFLTIDPIPFDPP
TFENVVRERLTNGLSKEEQLEDRLIDQNTIRWRYSRDD--NQRVFKESNATIVQWSDGSY
SLKLGDEYTDILLNDTDNTFLTVSHDQQELMQCVHGGEISKSLLFVPISTTSKLHQRLSK
AIVRRNATETMGPRSMIVNIDPELEKKELEKKQSQVFRERRKKKQKEIEA-LESLETTGF
G-NNSYSASRKRSTTPMSY--GG-SRRDEYE-EDDFIVDDEEEEPEYAGEEDDDDLDGFE
EEEEEQEEEEEGEDEDADEKRAERLRELKRQGTAAYN-------DDE---------KSGS
ESPKRRKVAVIEDDEDD--
>KAFR0D05050
----------MSESV---------IRESLEPDVHEEVDNV--------------------
--------------------------AQDQREPDDMDDLFGDDNDEQKE-----------
------EDDQEDEEDEGSYGGHRTS---YIDE------EEAMYNRKFYGEEGS-DMSDHE
EE--ALFKEADVELVRHVVPYKTFPENED--------DKTIYYTKVPAFLSIDPLPFDPP
SFENKVKERTSNFSSVEDQLGDRLIDENTIRWRYSRDA--EQRVFKESNAQIVQWSDGSY
SLKLGAEYTDILVNGTDNTFLTVSHDQQELMQCVDGGQINKTLIFIPTSTNSKIHQRLSK
AIARRDQRVHSGPGTMIVNLDPEVEKRELEKKQTQIIRERRRRQMKEQER-LESPE----
--LGAFSHSNRRSQTPSQGYERT-HREDEYE-EDDFLVDDDEEDESVELESGA-------
-DEEDDEEEEEAQFSDEDEARAERLKEMKRSNKVVIE-------E-----------ENDE
NSPKRRKGPVISDDEDED-
>CAGL0K10230g
----------MSEEEKHNM-----SEEQVELAPEEPPKEEAEDSVEDG----------KD
QE------------------------ETMPEKEEEMDDLFGDDEDDEDEEEI--TTGRGR
NGTTGISDDEEDDDEEGITRRSREREDYDMEDYDDEAKEQEMYTRKFYGEDAV-NYSDDD
EP--HTFKESNVDLIRHIIPYKTRTTNNE--------HDEIFYAKVPAFLTIDPVPFDPQ
TFEATVDERLSKSASKEDQLGDRLIDENTIRWRYSRDA--EQHVFKESNAQIVQWSDGSF
SLKLGDEYTDIIVNDTDNTFLTVSHDQQELMQCYDGGEITKTMMFIPTSTNSKIHQKLSK
AVSRRNARQNLGPGSYIIKQDPEIEKKELEKLQGQIIRERRKRQQKEIET-RENAE----
--NGFAETGEFKRGNTPS---RS-SRQNEYE-DDGFLVDDEDEEDFI-------------
-DDGEEEEEEE----EDDDLDADRLRNAKRQGEHAFT-------ED----------DDEE
DDNKRRKTAIISSEEDD--
>NDAI0C01590
----------MSEERNGSQPAESNTDIDVKTPSLSVEATGVTENIGND----------DI
NVEDEKVGEPDEEKEAEKEGEEGEE-EEEEEEQEGMDDLFGDDEDEDKEQRG--------
---SDDEEEGFIVEEDDESAQRRPE---DMDD------EEAMYTRKFYGDTD--KYSDNE
EDA-HDFKEANVEIIRHMVPYKTSSDQAD---------TTIYYAKVPPFLTIDPIPFDPV
SFETKVKDRLADYSSREDQLGDRLIDENTIRWRYSRDQ--NQRVFKESNAQIVQWSDGSF
SLKLGDEYTDILVNDTDNTFLTVSHDQQELMQCYNGGEITKTMMFIPTSTNSKIHQQLSK
AVTRRNQRQNLGPGTMIIEKDPELEKKELEKKQGQILRERRKRQLKEREI-QESPD-TTF
--DVRGSASSKNRSPAPSSY-RG-SRQDEYE-EDDFLVDDDEEEEFVGDEDEE-------
-EEEEEEEEEE----DEDDRKAKRLKEIKKGGAQEYA-------DRE-------ESDMEE
GSSKRRKVAVLSDDEEDE-
>NCAS0H02080
----------MSQEEVKEN-----ISTPIEE-ETPVVDNTSPTEITEE----------NK
K-------------------------EVAEEEADGMDDLFGDEEEEDENKSV--------
---------DEQSEDDDIGSRPRRT---DIDE------EEAMYTRKFYGDDDYNRYSSDQ
DNALHHFKEENVELIRHMVPYKTSSEKTD--------ETTVYYAKVPPFLTINPVPFDPI
AFESDVRDRLSNYSSKEDQLGDRLIDENTVRWRYSRDA--NQRVFKESNAQIVQWSDGSF
SLKLGDEYTDILVNETNNTFLAVSHDQQELMQCYNGGEITKTLMFIPTSTNSKIHQQLSK
AVTRRNQREHLGPGTMIINRDPEVEKRELEKKQGQIIRDRRRRQLKEKEL-LESPD-TTM
--DVSGGYETRKRNTPNPSL-GS-RRQDEYE-EDDFLVDDEDEEDFIEDD----------
-EEEEEEEEEE----DNDEEKAERLRNAKRSGYDEDN-------QES-------GTENES
SSSKKRRVAVINDDEDDE-