MUSCLE (3.8) multiple sequence alignment

KAFR0F00420        ------------------------------------------------------------
TPHA0F02320        ------------------------------------------------------------
Suva_4.36          ------------------------------------------------------------
Skud_4.42          ------------------------------------------------------------
Smik_4.28          ------------------------------------------------------------
YDL211C            ------------------------------------------------------------
CAGL0G05808g       ------------------------------------------------------------
TBLA0B09680        MTVKADTIPSGLQQPWANSLQTPTTTFLISSPAMTMPIENSPVNGLNQNPSTPNMKLDGN
NDAI0H03700        ------------------------------------------------------------
ABL135C            ------------------------------------------------------------
NCAS0D00440        ------------------------------------------------------------
Ecym_6417          ------------------------------------------------------------
CAGL0J11176g       ------------------------------------------------------------
NDAI0F03330        ------------------------------------------------------------
KLLA0D08239g       ------------------------------------------------------------
ZYRO0C09570g       ------------------------------------------------------------
Kpol_1041.6        ------------------------------------------------------------
KAFR0A07500        ------------------------------------------------------------
NCAS0G01940        ------------------------------------------------------------
KNAG0F01310        ------------------------------------------------------------
TDEL0A01230        ------------------------------------------------------------
Suva_14.165        ------------------------------------------------------------
Skud_14.158        ------------------------------------------------------------
YNL176C            ------------------------------------------------------------
Smik_14.154        ------------------------------------------------------------
SAKL0E12760g       ------------------------------------------------------------
KLTH0B06908g       ------------------------------------------------------------
Kwal_33.14461      ------------------------------------------------------------
                                                                               

KAFR0F00420        ------------------------------------------------------------
TPHA0F02320        ------------------------------------------------------------
Suva_4.36          ------------------------------------------------------------
Skud_4.42          ------------------------------------------------------------
Smik_4.28          ------------------------------------------------------------
YDL211C            ------------------------------------------------------------
CAGL0G05808g       ------------------------------------------------------------
TBLA0B09680        PSSIPENSFAVDQQDATNSIQVQQTEATSIQNLNSLETTPANNQPALNTFPTNNQPTTSI
NDAI0H03700        --------------------------------MNQNTTSLTTQPLGSYIDHQITSSSEPT
ABL135C            ------------------------------------------------------------
NCAS0D00440        ------------------------------------------------------------
Ecym_6417          -------------------------------------------------MMPYNNTSSPA
CAGL0J11176g       -----------------------MIHNSSYTEAADIKSLSSFIEESSRVPDYISESNNIG
NDAI0F03330        -------------------------------MEVNFNNTIEDRSSSVVKSLKLTEGNSAS
KLLA0D08239g       ------------------------------------------------------------
ZYRO0C09570g       -----------------MEVSLNTAWQASFPSEQLSSASSTWGDSSSTTSVLNNYPKTSG
Kpol_1041.6        ------------------------------------------------------------
KAFR0A07500        ---------------------------------------------MALNTSYFGDPSLHP
NCAS0G01940        --------------------------------MITNMNLNGTFGYSSAEFDQFSHFSDIS
KNAG0F01310        --------------------------------MAYNGTGPGIPPPSTDIVSELQQSITSG
TDEL0A01230        ------------------------------------------------------------
Suva_14.165        -------------------------------MSSNSTLGKDSLEQVSTSSLSISGQSHSL
Skud_14.158        -------------------------------MSSNSTIGWDTSSQSGTELLSFSEPNSSP
YNL176C            -------------------------------MNSNSTIGRTTLGESDTISLSFSEPSSSL
Smik_14.154        -------------------------------MSSNSTIGKTISAESDKTSLPFSEPSSSL
SAKL0E12760g       ------------------------------------------------------------
KLTH0B06908g       ------------------------------------------------------------
Kwal_33.14461      ------------------------------------------------------------
                                                                               

KAFR0F00420        ------------------------------------------------------------
TPHA0F02320        ------------------------------------------------------------
Suva_4.36          ------------------------------------------------------------
Skud_4.42          ------------------------------------------------------------
Smik_4.28          ------------------------------------------------------------
YDL211C            ------------------------------------------------------------
CAGL0G05808g       ------------------------------------------------------------
TBLA0B09680        NNVANSPIVTTEPFNNEIITTLNTIANQPLAITASINDQPITFSNMPINQPLVSTGPVNI
NDAI0H03700        VTEPGLSSVLTSHSFSSQISVVQPSISQLDSNIPLSSSDST-------------------
ABL135C            ------------------------------------------------------------
NCAS0D00440        ------------------------------------------------------------
Ecym_6417          INIESPKVYPPSSFSSDSKTGLMLYPEVISAISKE-------------------------
CAGL0J11176g       WSSNINNPPLFESSSFDITTQNDNWILTETMQNITTESSSTFSRSVASSVFPSSSQAFVS
NDAI0F03330        AYSPNTYKQPQGTIATSISSTSIVEPSIVDLDTVLTSSSIETIKALA-------------
KLLA0D08239g       ------------------------------------------------------------
ZYRO0C09570g       LSSTTNSDYEQPYSYMSTTNLSPSGSIDASNPTSTISSSSVTSSTTLAPWWSTVSSDPKP
Kpol_1041.6        ------------------------------------------------------------
KAFR0A07500        SSFINTYTIMANYYSSNGPTSRSTLSRESDSNSIEKSSEDL-------------------
NCAS0G01940        STYPTTPQYYSTVLSSGKSVENHSSIFSVVQPTTTSLPS---------------------
KNAG0F01310        AVDPAVYTLLPTSLTAQSSFELQNLPYSSSVAVPTPSSTPV-------------------
TDEL0A01230        ------------------------------------------------------------
Suva_14.165        ISSSTYVSPTPSSTLIAQQGSLTSLPPASSTSVPTYRSSKTISDGSV-------------
Skud_14.158        VSSSTDVLLTSSSTLIPEQGSLTSLPTGSDTYTHTYHSSSSTFDDNM-------------
YNL176C            NSRSTDVVFASTSTLVPQQGSLTSLPPVSSTATPTYYSTSLTYDETL-------------
Smik_14.154        ILLSTNVPLTATSTLIPQQGSLSSFAPVSSSFTSIYYSQSLTTDESA-------------
SAKL0E12760g       ------------------------------------------------------------
KLTH0B06908g       ------------------------------------------------------------
Kwal_33.14461      ------------------------------------------------------------
                                                                               

KAFR0F00420        ----------------------------------MNKKFLLTLFYYYCSPIAAAEP----
TPHA0F02320        -----------------------------------MVLFSMTNKTSSVFPDSLTAL----
Suva_4.36          ------------------------------------MLLNVTSSQFRNKHQPTSEA----
Skud_4.42          ------------------------------------MLLSVTSSRFVNRYQPT-------
Smik_4.28          ------------------------------------MLLNVTSSRYISMPQLKSQN----
YDL211C            ------------------------------------MLLNVTSSQYISTPQSR-------
CAGL0G05808g       -----------------------------------MADSNITMSSSDVYVDGPPTV----
TBLA0B09680        KPFSTSTTIVNQPLVAIESTTNQRIIPSTTLASMPLAIVDSTNSQLVTTSNELVNSRSVN
NDAI0H03700        -------------INSNPTTKLEAKQASLSALNSQTSVFDTDSMEYVDLSPLSLSS----
ABL135C            ------------------------------------MGYNNTSSPIGSGHGSS-------
NCAS0D00440        ------------------------------------MEFNNTITTDGLSQIASADL----
Ecym_6417          ---------------------SLSLGGIPSSSSLESLLYSATSESTETPKHTGDLT----
CAGL0J11176g       PPSIIDIPISSIPESSSISISSDVLSSAITVSQTSSSSYSSLISSYSTIQSTSSSS----
NDAI0F03330        ---------------------ESTFVSSLGPLSNEHSFSPLSSLYAQTWESPVHKT----
KLLA0D08239g       ------------------------------------MLFNTTTDGTDYSSVVSSSD----
ZYRO0C09570g       LKSTADTKSSYLSFSSSSPWWESTSNDIYASPTTSSSNLNTQTSSNSIWSENSDSIWGLN
Kpol_1041.6        ------------------------------------------------------------
KAFR0A07500        ---------------------WGTLYPAGSSSQYSSFLFSSSMDYYGFKSESALQT----
NCAS0G01940        ---------------------LSSFTNAVSSGSAAHSFNDVSSSQQYQETSSLSNL----
KNAG0F01310        ---------------------DVSEVSQVTGGDLFTSSSNSINQYSQYVPSPTDST----
TDEL0A01230        ------------------------------------MVFNSSSVRQSSETGGWSLT----
Suva_14.165        --------HSSFSVSSTYTLISSSIDGQSSGQQTDSSQSDSATTSFSVITPSLSIL----
Skud_14.158        --------YSSFSGSSTYTLVSSSIDSLSSGQNTESSQYDSTTTSYSIITPSLSML----
YNL176C            --------HTSIDVSSTSTLVSSTDSSSSSEQDTYSSQYDPATSSYSIITPSMSIF----
Smik_14.154        --------YSSSAVSSSDIIASTIISSSSSEQHIETSQYDSTTTSYSIITPSLSIL----
SAKL0E12760g       ------------------------------------MIFNTTNLPSSSFLSP--------
KLTH0B06908g       ------------------------------------MLFNATIVSFSSRS----------
Kwal_33.14461      ------------------------------------MQFNATRVTYRSQSRST-------
                                                                               

KAFR0F00420        ------------------------------------------------------------
TPHA0F02320        ------------------------------------------------------------
Suva_4.36          ------------------------------------------------------------
Skud_4.42          ------------------------------------------------------------
Smik_4.28          ------------------------------------------------------------
YDL211C            ------------------------------------------------------------
CAGL0G05808g       ------------------------------------------------------------
TBLA0B09680        NLPIIDSNTITSQPLVSVGSLNSQLITNSNDVISQLFTTTWSFDIPRKSRFSGISNSPLA
NDAI0H03700        ------------------------------------------------------------
ABL135C            ------------------------------------------------------------
NCAS0D00440        ------------------------------------------------------------
Ecym_6417          ------------------------------------------------------------
CAGL0J11176g       ------------------------------------------------------------
NDAI0F03330        ------------------------------------------------------------
KLLA0D08239g       ------------------------------------------------------------
ZYRO0C09570g       PILISGSSSGSITVDTSSNTFINSDTNSNFNWWSSTTSSSYEFMSSTGSMWASTFSSPST
Kpol_1041.6        ------------------------------------------------------------
KAFR0A07500        ------------------------------------------------------------
NCAS0G01940        ------------------------------------------------------------
KNAG0F01310        ------------------------------------------------------------
TDEL0A01230        ------------------------------------------------------------
Suva_14.165        ------------------------------------------------------------
Skud_14.158        ------------------------------------------------------------
YNL176C            ------------------------------------------------------------
Smik_14.154        ------------------------------------------------------------
SAKL0E12760g       ------------------------------------------------------------
KLTH0B06908g       ------------------------------------------------------------
Kwal_33.14461      ------------------------------------------------------------
                                                                               

KAFR0F00420        ------------------------------------------------------------
TPHA0F02320        ------------------------------------------------------------
Suva_4.36          ------------------------------------------------------------
Skud_4.42          ------------------------------------------------------------
Smik_4.28          ------------------------------------------------------------
YDL211C            ------------------------------------------------------------
CAGL0G05808g       ------------------------------------------------------------
TBLA0B09680        AVWSVNNQSIATTNSISNLLLANSDSIKNQQLIDANFVNTQQTSSYDTLSNQILTAYYSI
NDAI0H03700        ------------------------------------------------------------
ABL135C            ------------------------------------------------------------
NCAS0D00440        ------------------------------------------------------------
Ecym_6417          ------------------------------------------------------------
CAGL0J11176g       ------------------------------------------------------------
NDAI0F03330        ------------------------------------------------------------
KLLA0D08239g       ------------------------------------------------------------
ZYRO0C09570g       WTTSDDFQNSLSSTSLPWSSSSLVTTSSDEIPGNMEPITSLSDSYSWWNPSTTEFYSPSG
Kpol_1041.6        ------------------------------------------------------------
KAFR0A07500        ------------------------------------------------------------
NCAS0G01940        ------------------------------------------------------------
KNAG0F01310        ------------------------------------------------------------
TDEL0A01230        ------------------------------------------------------------
Suva_14.165        ------------------------------------------------------------
Skud_14.158        ------------------------------------------------------------
YNL176C            ------------------------------------------------------------
Smik_14.154        ------------------------------------------------------------
SAKL0E12760g       ------------------------------------------------------------
KLTH0B06908g       ------------------------------------------------------------
Kwal_33.14461      ------------------------------------------------------------
                                                                               

KAFR0F00420        ------------------------------------------------------------
TPHA0F02320        ------------------------------------------------------------
Suva_4.36          ------------------------------------------------------------
Skud_4.42          ------------------------------------------------------------
Smik_4.28          ------------------------------------------------------------
YDL211C            ------------------------------------------------------------
CAGL0G05808g       ------------------------------------------------------------
TBLA0B09680        NQQPVTTSNVIYNQPLITAGSINNGFVTISDGLENQQLAVVGLASPQPTYTYSTIDNQPL
NDAI0H03700        ------------------------------------------------------------
ABL135C            ------------------------------------------------------------
NCAS0D00440        ------------------------------------------------------------
Ecym_6417          ------------------------------------------------------------
CAGL0J11176g       ------------------------------------------------------------
NDAI0F03330        ------------------------------------------------------------
KLLA0D08239g       ------------------------------------------------------------
ZYRO0C09570g       YTTSKSASPTPSTSPVTSQMDTSPVALPSQSSYNWGSELSIAAISSTITLPSQSSYNWNS
Kpol_1041.6        ------------------------------------------------------------
KAFR0A07500        ------------------------------------------------------------
NCAS0G01940        ------------------------------------------------------------
KNAG0F01310        ------------------------------------------------------------
TDEL0A01230        ------------------------------------------------------------
Suva_14.165        ------------------------------------------------------------
Skud_14.158        ------------------------------------------------------------
YNL176C            --------------------------------------------------------SSTS
Smik_14.154        ------------------------------------------------------------
SAKL0E12760g       ------------------------------------------------------------
KLTH0B06908g       ------------------------------------------------------------
Kwal_33.14461      ------------------------------------------------------------
                                                                               

KAFR0F00420        ------------------------------------------------SRNIYYNPDDVS
TPHA0F02320        -------------------------------------------------------SFDTV
Suva_4.36          ------------------------------------------------------------
Skud_4.42          -----------------------------------------------------------S
Smik_4.28          ------------------------------------------------------------
YDL211C            -----------------------------------------------------------S
CAGL0G05808g       -------------------------------------------------------LNANT
TBLA0B09680        AVVGTVNNQPLYDPNTVNNQPIAVTGSANYQPITTADILAAQPLVAMEPSNIQSIDTTDA
NDAI0H03700        ---------------------------------SLSPSTPISSILPSPSSASVMLTSTST
ABL135C            ------------------------------------------------------------
NCAS0D00440        ------------------------------------------------------------
Ecym_6417          ----------------------------------------LVGSSSSAISSRLTESNTSG
CAGL0J11176g       --------------------------------------------ISENEISSSSRISPGL
NDAI0F03330        --------------------SIAPISTSFATYTSNERASISEQTSSRERPSLSSKTLSFE
KLLA0D08239g       ----------------------------------------------------------TL
ZYRO0C09570g       ELSTTSTTSTSPTFAWLSGWYSSWFLSSSPTMLPSASEAPAIMATMSASSNVLSSYIPQT
Kpol_1041.6        ------------------------------------------------------------
KAFR0A07500        -----TSSSTDASSTTASVIYTVQETTSGIHSSSALPSNTFSDEISGYTSSLSALYSSPT
NCAS0G01940        -----------------------------------NGDMGSSLLSTVNNSPLSSHFSQQT
KNAG0F01310        ----------------------------------------------NHQPTTSSITSSEA
TDEL0A01230        ------------------------------------------------------------
Suva_14.165        ---------------------------------------------SSSSSPSSSLYSDFG
Skud_14.158        -----------------------------SSAPSTLSTLPMSISSPSTLSPPSTLSSTSS
YNL176C            PMSSSSSITSEWSSLTSTTPTLSSSATSLSSSWSSLSSPSSLLVSSSLSLSLSSSYSDTK
Smik_14.154        -----------------------LSKSSILSTKSTSPSTTSVPISLSSSYSSSSSNSNFE
SAKL0E12760g       -----------------------------------------------------------S
KLTH0B06908g       ------------------------------------------------------------
Kwal_33.14461      ------------------------------------------------------------
                                                                               

KAFR0F00420        FENIVTSTIAESTLRSASTAS------------ILKNSVSYGPQDTFNNDAILSATYPSL
TPHA0F02320        LYPTTSTQISYSSSSGSATEE--------------ITSHSFSSTTDIISESNTSLALDSN
Suva_4.36          -----------ATTESCSSLP-------------------------LAAQESTITWSVEP
Skud_4.42          LNGFDTPETCLSPSSAIDLTA------------------ALSTGTEAKTIIESLGCVISS
Smik_4.28          -SISRTRFTSSPVAEPSTALP---------------------IATGSTITTKLLESLESL
YDL211C            LSEIDTSETASLSSATDHIFA-------------------LSTEVVSSITTNLIEGLESS
CAGL0G05808g       SVPMESDPLSISIPSNSVTIH----------TSQNVTDVEPVTANAASSNNTTSMPVSSL
TBLA0B09680        LVMQPLDAKSPVNTEPIATEPIATEPVNTEPVNTEPVNTEPVNTEPVNTEPVNTEPVNTE
NDAI0H03700        SALLDISSSISSTLTTPLAQP------------SSSTTITNAYTTSSSSIDSQYNSLSSN
ABL135C            ----GVEKASRPSSVQSTTQM---------------------GARHSESMNLSVSWLSTD
NCAS0D00440        --ISTATTTLVSSFSASIVQP---------SSTRLDNLGEIANSTLVSTDTSLSQSILAN
Ecym_6417          QLLDSNSGGDTSRSATSYVQP----------------SVSPTPLPTSEAPNTSGHTSVAA
CAGL0J11176g       LSSVPSITTSFSSGISSSVSP--TSSLQQIAEQSSNSSLAENDLLSSSLTILSSVLSSSV
NDAI0F03330        LDPYQNTKFSETQLHELSTEP---DSISTHSISTLMSSFQFISSQTMQSFPPSAKSETFQ
KLLA0D08239g       TESSESFSQSVASLRTDYINP-----------DSGNSTQQPHGMKTRTVLVYPNRSHSDS
ZYRO0C09570g       STSYDPFTTATPTPTSSISQPLISSSTFSSRVFTILSSGSPSSSTIPTYLISSASSASSL
Kpol_1041.6        ----MLTSDEIPSTDEELTTP---------------------------------------
KAFR0A07500        STKIQSSAFDFPSFNSEATIT-----------TSYNSLIQPNSLHVSISSEIPSSTLSDS
NCAS0G01940        LSSTQLQTSSTTALVESLNLP-----------REESSMVGVVSSTRMANSLFDTSSTNFE
KNAG0F01310        YVIPDITSSSYVTASSSSVED---TTWSQILSAFENDTAQWSLADLLTSTEPTTSSYEPP
TDEL0A01230        -------DIAFSSVSTSAEES--------------------TSTWGPAIVTPSSSSLASS
Suva_14.165        KSSLDSASTSFSSSTPSAISP----------SFTSLSSTDIASSQVTSALQATSTESSTI
Skud_14.158        LTISLSLSSSLLSSSSPSSSPASTYSNSEELSLDSASATFSSSITTAISPSYTALFSIFT
YNL176C            LFSFDSRSSIFSPSTPTVISP----------SYTYLSSISATSFQISTTSELSSSWFSTI
Smik_14.154        KFSLDSSSSTSSSLTPTAVSP----------SYTSLSSILTTSSEISVTSKVPSSWSTTF
SAKL0E12760g       LLSLETEPATLSSGDNATTTN--------------------PSYTSTKVIEPSTLWFSSD
KLTH0B06908g       ----RVGTSSSSTQSSSEKEP----------------------------QTSSSVWSSLE
Kwal_33.14461      ---IRTSKSSSSSSESASESP-----------------------DGSRTTEFSESTEEPS
                                                                               

KAFR0F00420        VVEN--SSSA--------------------------------------------------
TPHA0F02320        LYRT--SSGD--------------------------------------------------
Suva_4.36          ENTI--SFVE--------------------------------------------------
Skud_4.42          IQGL--SSTE--------------------------------------------------
Smik_4.28          SQVM--STTA--------------------------------------------------
YDL211C            IQVP--ISTA--------------------------------------------------
CAGL0G05808g       SSQQ--NTTT--------------------------------------------------
TBLA0B09680        PVNTEPVNTEPVNTEPVNTEPVNTEPVNTEPVNTEPVNTEPVNTEPIVTVDVLATQQLVA
NDAI0H03700        LLNSMGGNSD--------------------------------------------------
ABL135C            AWSA--AEFA--------------------------------------------------
NCAS0D00440        QITT--DYQV--------------------------------------------------
Ecym_6417          VRDTMPSRKA--------------------------------------------------
CAGL0J11176g       LLHNSGVSSS--------------------------------------------------
NDAI0F03330        DSNV--ISVT--------------------------------------------------
KLLA0D08239g       DSPGIVSPST--------------------------------------------------
ZYRO0C09570g       INTI--DPSS--------------------------------------------------
Kpol_1041.6        ---------E--------------------------------------------------
KAFR0A07500        LNLA--SSSE--------------------------------------------------
NCAS0G01940        MLST--LNNT--------------------------------------------------
KNAG0F01310        LTSS--FLSS--------------------------------------------------
TDEL0A01230        QSSS--KSSS--------------------------------------------------
Suva_14.165        FESSSTSNED--------------------------------------------------
Skud_14.158        TSSQISMTSQ--------------------------------------------------
YNL176C            SSPSTISNKD--------------------------------------------------
Smik_14.154        LSPSTISNED--------------------------------------------------
SAKL0E12760g       EVGT--PTTD--------------------------------------------------
KLTH0B06908g       LSTL--ESTS--------------------------------------------------
Kwal_33.14461      VVER--STTD--------------------------------------------------
                                                                               

KAFR0F00420        ------------------------------------------------------------
TPHA0F02320        ------------------------------------------------------------
Suva_4.36          ------------------------------------------------------------
Skud_4.42          ------------------------------------------------------------
Smik_4.28          ------------------------------------------------------------
YDL211C            ------------------------------------------------------------
CAGL0G05808g       ------------------------------------------------------------
TBLA0B09680        LAPSNIQPIIISNTLADQPVVVTGQIDNQHFETENSQSHPSSVLPINYNTNYGVDINPPN
NDAI0H03700        ------------------------------------------------------------
ABL135C            ------------------------------------------------------------
NCAS0D00440        ------------------------------------------------------------
Ecym_6417          ------------------------------------------------------------
CAGL0J11176g       ------------------------------------------------------------
NDAI0F03330        ------------------------------------------------------------
KLLA0D08239g       ------------------------------------------------------------
ZYRO0C09570g       ------------------------------------------------------------
Kpol_1041.6        ------------------------------------------------------------
KAFR0A07500        ------------------------------------------------------------
NCAS0G01940        ------------------------------------------------------------
KNAG0F01310        ------------------------------------------------------------
TDEL0A01230        ------------------------------------------------------------
Suva_14.165        ------------------------------------------------------------
Skud_14.158        ------------------------------------------------------------
YNL176C            ------------------------------------------------------------
Smik_14.154        ------------------------------------------------------------
SAKL0E12760g       ------------------------------------------------------------
KLTH0B06908g       ------------------------------------------------------------
Kwal_33.14461      ------------------------------------------------------------
                                                                               

KAFR0F00420        ------------------------------------------------------------
TPHA0F02320        ------------------------------------------------------------
Suva_4.36          ------------------------------------------------------------
Skud_4.42          ------------------------------------------------------------
Smik_4.28          ------------------------------------------------------------
YDL211C            ------------------------------------------------------------
CAGL0G05808g       ------------------------------------------------------------
TBLA0B09680        SHFLAYSDTADNQLLNEQVISSTQPPNAIASNNASPIENISTTSSGNLLENLNSFPSQVL
NDAI0H03700        ------------------------------------------------------------
ABL135C            ------------------------------------------------------------
NCAS0D00440        ------------------------------------------------------------
Ecym_6417          ------------------------------------------------------------
CAGL0J11176g       ------------------------------------------------------------
NDAI0F03330        ------------------------------------------------------------
KLLA0D08239g       ------------------------------------------------------------
ZYRO0C09570g       ------------------------------------------------------------
Kpol_1041.6        ------------------------------------------------------------
KAFR0A07500        ------------------------------------------------------------
NCAS0G01940        ------------------------------------------------------------
KNAG0F01310        ------------------------------------------------------------
TDEL0A01230        ------------------------------------------------------------
Suva_14.165        ------------------------------------------------------------
Skud_14.158        ------------------------------------------------------------
YNL176C            ------------------------------------------------------------
Smik_14.154        ------------------------------------------------------------
SAKL0E12760g       ------------------------------------------------------------
KLTH0B06908g       ------------------------------------------------------------
Kwal_33.14461      ------------------------------------------------------------
                                                                               

KAFR0F00420        ------------------------------------------------------------
TPHA0F02320        ------------------------------------------------------------
Suva_4.36          ------------------------------------------------------------
Skud_4.42          ------------------------------------------------------------
Smik_4.28          ------------------------------------------------------------
YDL211C            ------------------------------------------------------------
CAGL0G05808g       ------------------------------------------------------------
TBLA0B09680        GTDLSTTQDKLYTLSGTILSTFSATTQGSQDLFMVSTEPTQVYDTILSQAILSVTMPSGT
NDAI0H03700        ------------------------------------------------------------
ABL135C            ------------------------------------------------------------
NCAS0D00440        ------------------------------------------------------------
Ecym_6417          ------------------------------------------------------------
CAGL0J11176g       ------------------------------------------------------------
NDAI0F03330        ------------------------------------------------------------
KLLA0D08239g       ------------------------------------------------------------
ZYRO0C09570g       ------------------------------------------------------------
Kpol_1041.6        ------------------------------------------------------------
KAFR0A07500        ------------------------------------------------------------
NCAS0G01940        ------------------------------------------------------------
KNAG0F01310        ------------------------------------------------------------
TDEL0A01230        ------------------------------------------------------------
Suva_14.165        ------------------------------------------------------------
Skud_14.158        ------------------------------------------------------------
YNL176C            ------------------------------------------------------------
Smik_14.154        ------------------------------------------------------------
SAKL0E12760g       ------------------------------------------------------------
KLTH0B06908g       ------------------------------------------------------------
Kwal_33.14461      ------------------------------------------------------------
                                                                               

KAFR0F00420        ------------------------------------------------------------
TPHA0F02320        ------------------------------------------------------------
Suva_4.36          ------------------------------------------------------------
Skud_4.42          ------------------------------------------------------------
Smik_4.28          ------------------------------------------------------------
YDL211C            ------------------------------------------------------------
CAGL0G05808g       ------------------------------------------------------------
TBLA0B09680        IPTASVLFSSKSSKRSMNTLLDFSSIIESENLSSALLSSESEYVASFTTANLSPSSSEPP
NDAI0H03700        ------------------------------------------------------------
ABL135C            ------------------------------------------------------------
NCAS0D00440        ------------------------------------------------------------
Ecym_6417          ------------------------------------------------------------
CAGL0J11176g       ------------------------------------------------------------
NDAI0F03330        ------------------------------------------------------------
KLLA0D08239g       ------------------------------------------------------------
ZYRO0C09570g       ------------------------------------------------------------
Kpol_1041.6        ------------------------------------------------------------
KAFR0A07500        ------------------------------------------------------------
NCAS0G01940        ------------------------------------------------------------
KNAG0F01310        ------------------------------------------------------------
TDEL0A01230        ------------------------------------------------------------
Suva_14.165        ------------------------------------------------------------
Skud_14.158        ------------------------------------------------------------
YNL176C            ------------------------------------------------------------
Smik_14.154        ------------------------------------------------------------
SAKL0E12760g       ------------------------------------------------------------
KLTH0B06908g       ------------------------------------------------------------
Kwal_33.14461      ------------------------------------------------------------
                                                                               

KAFR0F00420        ------------------------------------------------------------
TPHA0F02320        ------------------------------------------------------------
Suva_4.36          ------------------------------------------------------------
Skud_4.42          ------------------------------------------------------------
Smik_4.28          ------------------------------------------------------------
YDL211C            ------------------------------------------------------------
CAGL0G05808g       ------------------------------------------------------------
TBLA0B09680        SLITMIPDISVSSNFKPSVQYSTNLNSNSGNQFSATNELSIIPTLPLPETPITQIDSQEL
NDAI0H03700        ------------------------------------------------------------
ABL135C            ------------------------------------------------------------
NCAS0D00440        ------------------------------------------------------------
Ecym_6417          ------------------------------------------------------------
CAGL0J11176g       ------------------------------------------------------------
NDAI0F03330        ------------------------------------------------------------
KLLA0D08239g       ------------------------------------------------------------
ZYRO0C09570g       ------------------------------------------------------------
Kpol_1041.6        ------------------------------------------------------------
KAFR0A07500        ------------------------------------------------------------
NCAS0G01940        ------------------------------------------------------------
KNAG0F01310        ------------------------------------------------------------
TDEL0A01230        ------------------------------------------------------------
Suva_14.165        ------------------------------------------------------------
Skud_14.158        ------------------------------------------------------------
YNL176C            ------------------------------------------------------------
Smik_14.154        ------------------------------------------------------------
SAKL0E12760g       ------------------------------------------------------------
KLTH0B06908g       ------------------------------------------------------------
Kwal_33.14461      ------------------------------------------------------------
                                                                               

KAFR0F00420        ---NLSSHASTSAVEPISNNNFSVTATYSINNNASKMSLQNEAGTASSYLSSSTSQGLDH
TPHA0F02320        ---SSINAFQNSSATDLETHFTTSPIHNLTISSHVSSDTSTVAGLVSSSSIESFNQTTSK
Suva_4.36          ---SCVPSSHNYTSSPRSLTA---------------------------------------
Skud_4.42          ---FNCTSVSKPLVA---------------------------------------------
Smik_4.28          ---YNTISLNNYTSSSQSLVK---------------------------------------
YDL211C            ---YGTTSFRNNTSSPQYLVS---------------------------------------
CAGL0G05808g       ---TPVPITPYYSQSYSSISKNSSISTSSLPSITSAISITPASSKNSTSSSTSITSSLFS
TBLA0B09680        NYLTSTTSFDISNIESSNLNAIDSLQSILLGTSNYVFTDYENAPSTPSLGSIEITSLTPT
NDAI0H03700        ---QNIIPTSVTFTN-LDLSPLLASYYALLTTSSSISSAVTTTSTSRSTLQSSSTATLKN
ABL135C            ---TLEGQRNRTESS---------------------------------------------
NCAS0D00440        ---TGIPTFARNATQSVTSSTGSSLLANSLSSETSITSLSDQFELPSSTSTSSKRILPSL
Ecym_6417          ---TESGQSTLYQSSSLSLVYSTAIVAPSDTPSSVQQLHSHNTLFEVTTLESQTHATSVT
CAGL0J11176g       ---SFTDNFSSTLTNSSNSLAILSSISESSLINTITDLPSSSVLLSPNNSESSIKVSSAS
NDAI0F03330        ---TEVQYDNAKESSSHRTIMVDSINTTSLLPSSNSFIKEELKLSTSASPIATRYNLLTS
KLLA0D08239g       ---VWVPPSTDDSTSHTDVDTA--------------------------------------
ZYRO0C09570g       ---STSDLWIYSSSEPQPITSSVPATEDLRSTDTAVPAGWSDTILSGSTPPSPITALWSY
Kpol_1041.6        ------------------------------------------------------------
KAFR0A07500        ---NSISSLPRSSTEVSSLSSETASSDAHTIVQSSTHEPFTSPNQVSVSESMSESSTNSS
NCAS0G01940        ---FITSQMTIPVLQTPSLTYLSPSPSLSSTVKATVHNYTFSSEVTTSSTKLSSYRSTTA
KNAG0F01310        ---GMPVIHKSSLPGRSELDESLAARSTSIIYSSSIPTATSSSLAQLVVSSSSWYSTPVS
TDEL0A01230        ---QWSSAIYVSSSV---------------------------------------------
Suva_14.165        ---ITSSYSDRITSTLIYTSLFSSATNSSTKSDSSKPASTTPSSTVSDTFQSTTSGTHMP
Skud_14.158        ---TTSISFTPSTTSSDDIRFSNFDQGTSILTDTYSSLPLSATDSSLTDKPSKLNSSDSS
YNL176C            ---TTFPSSSRNTSTSFYSSSLSSTNDFSTISKSSKLSPSASSSTVSISTISVPTSSSVS
Smik_14.154        ---ATSSSPDRYTSSPIDTSLITSTVDSSITGQPSMLNRSDSSSTVSADSESTISMPKLT
SAKL0E12760g       ---VTQTTDDIATED---------------------------------------------
KLTH0B06908g       ---TQTIVSTSASIT---------------------------------------------
Kwal_33.14461      ---SIATNATLTQLEPLPTS----------------------------------------
                                                                               

KAFR0F00420        GLPKLNTTLVVSTGKLR-------------------------------------------
TPHA0F02320        SFNHITTITPSIYVQSFRHATTS-------------------------------------
Suva_4.36          ------------------------------------------------------------
Skud_4.42          ------------------------------------------------------------
Smik_4.28          ------------------------------------------------------------
YDL211C            ------------------------------------------------------------
CAGL0G05808g       SSYLTSVTSSYNTTSNIIPFSTSK------------------------------------
TBLA0B09680        SFNSYKASSSATLIGNLIPSFSISDNIIFPDVTTLSDQSLASTNLSQSSTLGEQGVNEPQ
NDAI0H03700        LPLLPSTTNSSSSMPK--------------------------------------------
ABL135C            ------------------------------------------------------------
NCAS0D00440        HLSSLPKLSTT-------------------------------------------------
Ecym_6417          SSSGDSD-----------------------------------------------------
CAGL0J11176g       SSSSRRKASTYTTPSRIPFSNSSEWYTPLP------------------------------
NDAI0F03330        SRKKEMTRNTSVDSFVHTTSMTKI------------------------------------
KLLA0D08239g       ------------------------------------------------------------
ZYRO0C09570g       VGPSNSIIPTTTSDFPSATSLATNDSSDIIPTSNDEPVSSADDLSNYLPTISGVEPTTSV
Kpol_1041.6        ------------------------------------------------------------
KAFR0A07500        VSIPYTKINSFTKGSSALRQSSTT------------------------------------
NCAS0G01940        ASTVPLNVTTIDSTVE--------------------------------------------
KNAG0F01310        STPVFSSATLSSSLSRSAPSSSIK------------------------------------
TDEL0A01230        ------------------------------------------------------------
Suva_14.165        KLVSSQTTSTTSS-----------------------------------------------
Skud_14.158        TFSVASKTTTSIPTLISIISSSSA------------------------------------
YNL176C            SSSSKVPSN---------------------------------------------------
Smik_14.154        STKTSTSLLSSS------------------------------------------------
SAKL0E12760g       ------------------------------------------------------------
KLTH0B06908g       ------------------------------------------------------------
Kwal_33.14461      ------------------------------------------------------------
                                                                               

KAFR0F00420        ------------------------------------------------------------
TPHA0F02320        ------------------------------------------------------------
Suva_4.36          ------------------------------------------------------------
Skud_4.42          ------------------------------------------------------------
Smik_4.28          ------------------------------------------------------------
YDL211C            ------------------------------------------------------------
CAGL0G05808g       ------------------------------------------------------------
TBLA0B09680        SFKYTATNTISSFQGSSLDNSLILSTVNSSLEYVDVIYTTVIISNSAQLYSILDNSQNRI
NDAI0H03700        ------------------------------------------------------------
ABL135C            ------------------------------------------------------------
NCAS0D00440        ------------------------------------------------------------
Ecym_6417          ------------------------------------------------------------
CAGL0J11176g       ------------------------------------------------------------
NDAI0F03330        ------------------------------------------------------------
KLLA0D08239g       ------------------------------------------------------------
ZYRO0C09570g       ISSPVAAPTSLSSDPVATIPTMLFSTTSS-------------------------------
Kpol_1041.6        ------------------------------------------------------------
KAFR0A07500        ------------------------------------------------------------
NCAS0G01940        ------------------------------------------------------------
KNAG0F01310        ------------------------------------------------------------
TDEL0A01230        ------------------------------------------------------------
Suva_14.165        ------------------------------------------------------------
Skud_14.158        ------------------------------------------------------------
YNL176C            ------------------------------------------------------------
Smik_14.154        ------------------------------------------------------------
SAKL0E12760g       ------------------------------------------------------------
KLTH0B06908g       ------------------------------------------------------------
Kwal_33.14461      ------------------------------------------------------------
                                                                               

KAFR0F00420        ------------------------------------------------------------
TPHA0F02320        ------------------------------------------------------------
Suva_4.36          ------------------------------------------------------------
Skud_4.42          ------------------------------------------------------------
Smik_4.28          ------------------------------------------------------------
YDL211C            ------------------------------------------------------------
CAGL0G05808g       ------------------------------------------------------------
TBLA0B09680        NSFGPILSTSSRHLHINSIESETSIGDSFYTIRNNSTSDLQLLSTQSEEVLSTINANSSF
NDAI0H03700        ------------------------------------------------------------
ABL135C            ------------------------------------------------------------
NCAS0D00440        ------------------------------------------------------------
Ecym_6417          ------------------------------------------------------------
CAGL0J11176g       ------------------------------------------------------------
NDAI0F03330        ------------------------------------------------------------
KLLA0D08239g       ------------------------------------------------------------
ZYRO0C09570g       ------------------------------------------------------------
Kpol_1041.6        ------------------------------------------------------------
KAFR0A07500        ------------------------------------------------------------
NCAS0G01940        ------------------------------------------------------------
KNAG0F01310        ------------------------------------------------------------
TDEL0A01230        ------------------------------------------------------------
Suva_14.165        ------------------------------------------------------------
Skud_14.158        ------------------------------------------------------------
YNL176C            ------------------------------------------------------------
Smik_14.154        ------------------------------------------------------------
SAKL0E12760g       ------------------------------------------------------------
KLTH0B06908g       ------------------------------------------------------------
Kwal_33.14461      ------------------------------------------------------------
                                                                               

KAFR0F00420        -----------------------------------------------------------G
TPHA0F02320        -----------------------------------------------------------K
Suva_4.36          -----------------------------------------------------------S
Skud_4.42          -----------------------------------------------------------N
Smik_4.28          -----------------------------------------------------------N
YDL211C            -----------------------------------------------------------N
CAGL0G05808g       -----------------------------------------------------------S
TBLA0B09680        TVSFSTLTSYDSSSFLPVFSATSTIDAYNTSSSQEHFELQYTTSMPTTDLYNSRVNFLSS
NDAI0H03700        -----------------------------------------------------------E
ABL135C            -----------------------------------------------------------G
NCAS0D00440        -----------------------------------------------------------R
Ecym_6417          -----------------------------------------------------------A
CAGL0J11176g       -----------------------------------------------------------T
NDAI0F03330        -----------------------------------------------------------V
KLLA0D08239g       -----------------------------------------------------------M
ZYRO0C09570g       -------------------SSSDWYESTPMTSGIESSQVVAFSSVPSDSSATSSIWFELT
Kpol_1041.6        ------------------------------------------------------------
KAFR0A07500        -----------------------------------------------------------S
NCAS0G01940        -----------------------------------------------------------R
KNAG0F01310        -----------------------------------------------------------R
TDEL0A01230        -----------------------------------------------------------Y
Suva_14.165        -----------------------------------------------------------S
Skud_14.158        -----------------------------------------------------------P
YNL176C            -----------------------------------------------------------R
Smik_14.154        -----------------------------------------------------------S
SAKL0E12760g       ------------------------------------------------------------
KLTH0B06908g       -----------------------------------------------------------A
Kwal_33.14461      -----------------------------------------------------------T
                                                                               

KAFR0F00420        SSLLPHNHLTSSKFTSSVSFSYVMPTKSSLAKSSSSSTSSLLSSSTLL-----------S
TPHA0F02320        LSSSTPSTLISTISSTSVYPSSSYSSEYSNYSTASPASISRYSLWSS------------D
Suva_4.36          ASPSIKSNITIDEWLTSAPKTLPLTPTPTIQPPTTEPTTPSSTIFAS------------T
Skud_4.42          YSSSVISNITLDRWLISSLKTFSSSAKPTIHPSTTEITTPLFTTHVT------------S
Smik_4.28          CSSSVKSNITIDRWLISSLKSFSSSLMPTMQPSTTELTTPLFTTFAP------------T
YDL211C            CTSSVQSNITIDRGLLSTLKTFTTSQVPTIEPSTTKLTTPLSTTFTS------------T
CAGL0G05808g       TETYISSQSTSFSISSESSVQISSSSSSSSSPSSSSSPNSSSALSSS------------S
TBLA0B09680        LDTSRIVDTSKDNWSSYVTSGSDEKTLYSRSRPSYTKTTIDNSTISSSSSVIQPIEINLK
NDAI0H03700        ASKVVHSSSTASIYLSTRIIDVSSSCSSSALSHMTRLSSSLSSSSIESDNSQQSSTSSFT
ABL135C            FTSTSSTSARSDRWAQT-------------------------------------------
NCAS0D00440        SKYSSYAQVSSSSDITSSLVSPEYTSSSSTTIPVTTLTSTVHDTITS------------S
Ecym_6417          ESSSSSENDGRESTEDTSDLSVTFVTLTVSLNPTVVIHSTVLSTVYP------------T
CAGL0J11176g       PSISSSTNDTSSLLSELALIGISSSSSSSSSSQFYTSSTSSSSLVSSSENYSSSQPTTIE
NDAI0F03330        DYSMYTPQLFGQKQGSSEYSYQNFSPSASKMPTLRSSIRTLPALKLNATTSITRGYIENL
KLLA0D08239g       VTVLEMSSGPSNIVMQTIYPENTATQEYTSVEGTEATATVPTPTWLT-------------
ZYRO0C09570g       PPTSSDSSFFVPSSSSLFPISMTYSWTSPVVESSSQSPISSSSSTTSAEGNTFSKTSSGS
Kpol_1041.6        ------------------------------------------------------------
KAFR0A07500        IYSSFNKNVTSTGIQTAIKPSFLPTSLTLVSKSSSESHPTSSATSTK------------L
NCAS0G01940        PTMSPHSVTKITNTTSSLSTGGSISSSSVEEKKSSRASTSFVSTTYS------------T
KNAG0F01310        ITSILSLPPLTSQYLNSSLTTTTISSLSPSSSSSAPPFSSSSAVFYNSTSELPFAATEPT
TDEL0A01230        DVSSSSPTVFSSDQTSVSTLVPSYPWSSVSSSSSKQSFSSDFATTST-------------
Suva_14.165        SRPSSSSDASTSSYTSSFSSDSRYSSEQTTYTSSSSVPMTTPTPYTT------------T
Skud_14.158        SSNRIPSGGTKSTYLSSSASNVTYSSQLMISTSSSDVPLTTSALTTT------------T
YNL176C            PSSSSSSDDTTSAYSSTYTFQSLQSTTSSSIPPTTQTPSTSTISTSP------------I
Smik_14.154        LSSSPLLDSTKTSHSSPSLANNTYSLISMASTSGSSVPFTTQEVSAT------------L
SAKL0E12760g       -TTSPLGFVTLTETLDTTYVEVTTIATTVYTEETYLAISQQETSQVT------------L
KLTH0B06908g       VEPSATMLTSSDDSITTTTSDTSLPAATSSLPSSS-------------------------
Kwal_33.14461      MSSDSSDQNSSESSENAESEGSTATTSTTSHGATSETASSTSLT----------------
                                                                               

KAFR0F00420        YVS------------------------------------------------YTVSMANEK
TPHA0F02320        LES----------STLFTSTASSSNSE------------------------YSISTNSSK
Suva_4.36          ITT----------SES-----------------------------------YTMFTSKNS
Skud_4.42          ATS----------ET------------------------------------YSAFTDQKS
Smik_4.28          TTS----------EI------------------------------------YSVFTSDES
YDL211C            STS----------EI------------------------------------YSVFTSENS
CAGL0G05808g       SSS----------SNTESSSSSTPI--------------------------ISSTISKNY
TBLA0B09680        STSHLVSFNSSHKSTQKDTSTISIQGSVSRPETTPFISSTASSRDVHSKKYVESYISSGF
NDAI0H03700        SSS----------SSSSSSSSSSQTQMYS----------------------ISEDLTNSQ
ABL135C            ---------------------------------------------------EEAVGTPQM
NCAS0D00440        TSS----------SSSSSSTSEYYS--------------------------ISHDSKSTS
Ecym_6417          PSQ----------TTQDRSSIPPISSI------------------------NLDAIPTDK
CAGL0J11176g       PIT----------STISSSYSDLSNDGE-----------------------ILSSTLGKS
NDAI0F03330        KPS----------SSSKSESSSFHSKISNVENSLIKSSTSTNEELLLTAILYSVYPSSNI
KLLA0D08239g       ---------------------------------------------------LTTEVPSSE
ZYRO0C09570g       SSN----------HSSKSGISSPSYLHFSSQSNSTSSTNAD----------YSVSYGTRS
Kpol_1041.6        ---------------------------------------------------YLVSSRSGE
KAFR0A07500        SDT----------SSAASLISRSTVE-------------------------IISYTNSGT
NCAS0G01940        STI----------FPSSTESQIYNTSLTT----------------------SRVLRTRDP
KNAG0F01310        STS----------DDFTSSATAVSSSTSL----------------------YSVSDASKA
TDEL0A01230        SAS----------SPG-----------------------------------YTVSSDSKS
Suva_14.165        TST----------TPLTSSSQTYSIGV------------------------VSSSEDSQT
Skud_14.158        VAT----------PSTSTSNPAYNMGP------------------------ISSSGDSKT
YNL176C            PTS----------SQVFNTVA------------------------------ISSSEDSKT
Smik_14.154        FST----------SSMPTSSPAYNTGA------------------------LSSSEGSST
SAKL0E12760g       GES----------TTQRATHTS-----------------------------ESLLLASSE
KLTH0B06908g       -------------------------------------------------------VPAGK
Kwal_33.14461      ---------------------------------------------------SSASVPSGK
                                                                               

KAFR0F00420        DYLI-YTQVYIFTDETTSFTSGLPTTITLPKSSVESGEVPT--THIAA-TIITTPVSVYK
TPHA0F02320        LYLI-YTQTYVVTGSSIAFTTDILMTTRINPTKFQQNGTPT--YTYGS-NTITTNLAYYN
Suva_4.36          IYVV-YEQEYEITESTTSFSTHFPQTTGLK----GTNAPLT--FTIPY-NTITGDAKLYR
Skud_4.42          IYVV-YDQEYKITELTTTFNTHFPQTTVLK----EAGALLT--FTIPS-NTITGDAKLYQ
Smik_4.28          IYVV-YDQIYKITESSTTFNTHFPQTTVLK----EADTPLT--FTIPT-NTITGDAKLYQ
YDL211C            VYII-YDQEYKFTERSTTFNTHFPQTTVLQ----ESNPPLT--FTIPS-NTITGDAKLYQ
CAGL0G05808g       IIYI-YDQKFEFTDASTTFDTDIPVETRIK---VTPNKMVS--FTPPT-GILTTDAALYQ
TBLA0B09680        IYFV-FNETFNFTDSTTNLITDLPTTTRVL----ANCT-TS--INFPS-QTLTENIQVYE
NDAI0H03700        LYYIYYTQDYYFTNSITTIETGLPMRTTIS----AQTPPVV--SNIPTISVITTDVSFYQ
ABL135C            TFVV-YSQRYKLTASYTTLCTLIPTTTTLP----YSET-AT--YSAPT-TVITTDIAFYK
NCAS0D00440        VYYMYYSQAYYFTDSSETFTTELPQKTRIT----TTGLNPTLSFVVPQ-NTITTDAAFYQ
Ecym_6417          TYVI-YTQNYQFTASYTTFNTGLPVTSVMP----TEVY-ST--FSTPT-SVITTDVGLYK
CAGL0J11176g       VYYS-YIQTFDITASTTTFETALPIVTAFN----LKDS-YT--FSKPS-SIITTDLHFYK
NDAI0F03330        YFYV-YTQMYDFTDSSTTFITGLPTTVSLQ----GSPT-TL--LTIPT-STITKGTAFYK
KLLA0D08239g       TVVY-YTRDFIFTDTSTTFTKGLPTLTVIP----TE---AT--FTTPT-GPVVTDTSFYE
ZYRO0C09570g       AYYI-YTQTYVITASTTTFETGIPTTVGMP----RSGS-ST--FSTPQ-PAVTQDIGFYN
Kpol_1041.6        LYYI-FTQTYEFVNSETDFTEGFVTTKSIN----RKEA-AT--YKFSA-TTITTDASYYK
KAFR0A07500        VYYV-YTQNYDFTDATTTFATGLPTTITVA----ETAASSI--TALPV-STITTDVSVYN
NCAS0G01940        VAVV-YTQTYEFTDSRTSFLTGIVTTATIT----GDAT-ST--FDIST-PTITKDTKLYQ
KNAG0F01310        FYYI-YQQPYVFTDTTTTFTTDLPKTTSIM----KGRS-QS--FVVPS-STVTAPVKAYK
TDEL0A01230        AFII-YTQQYYITGSSTTFETGLPTTTVRA----KTAT-SS--FSVPS-ATQTRDFEFYQ
Suva_14.165        IYYF-YTQAYDITGSSTTFTTGLPTTVALA----KSAVRSS--FSVPS-STVTADMSFYQ
Skud_14.158        IYYF-YTQAYDITGSSTTFATGLPTTIALA----KSAA-TS--FLAPS-STITADMSFYQ
YNL176C            IYYF-YTQTYDITDSSTTFVTGLPTTIAVA----KSEV-TS--FSAPS-STITADMSFYQ
Smik_14.154        IYYF-YTQAYDITGSTTTFVTGLPTTIALA----KSAV-SS--FSVPS-STITADMSFYQ
SAKL0E12760g       TYYV-YTQNYEITASTTTFTTGLPTTLIIP----TSAS-ST--FSIPT-SVITTDAAFYK
KLTH0B06908g       TAVV-YTRSYVFTASSTTFGTKLPMTTVMA----TKKA-AT--FSAPT-AAVTTDLSFYQ
Kwal_33.14461      TAIV-YTRSYVFTASTTTFTTALPLTTTLA----TKKA-ST--FSAPT-AAVTTDVSFYQ
                        :   : ..     :   :                             .     * 

KAFR0F00420        AWEAK-------------NNEQQTKATRRHNLVIGCCVGCICGSLLIIGVFCLAFY--MK
TPHA0F02320        NLVT-GKTT---------------STSSKNGKIAGGVIGALLGFIIICIVTLVNFR--RK
Suva_4.36          KLLP-GALD---------TQNTSDKDNKNTGVIVGSTVGTIIGVVVVIFIVFVVIR--NK
Skud_4.42          VLS--GELN---------VQNSPDKKNKKTGVIVGSTVGVIIGVVVIIFIGFTIIR--NK
Smik_4.28          NLS--GAL----------NTQEGSNSYRKTGVIVGSTVGVVIGVVVVIFIGLIIIR--NK
YDL211C            -YLS-GALN---------TQDTSDANNRRTGVIVGSTVGVVIGVVIVIFIGFIIIR--NR
CAGL0G05808g       KYLA-GTLD---------WNSHDTDARIRNSKIIGGVVGSVCGLLVCSVVIFLLFF--RR
TBLA0B09680        NWIHNGGT----------KPYTTHHGSSSTGAIVGGVVGGVGGTLLVVIVLGYLYW--HK
NDAI0H03700        HWLDSGSIDDDDNGSDDSNSKSGGGNNKNKGTIIGSIVGSIGGFLLCCLIIWFMFF--RR
ABL135C            GLVP-G--DD--------DKSAARVNGAQKRTIIGSVVGSVCGLLMCAMAAYYLLH--LR
NCAS0D00440        RWLN-GGMDDI-------SSDGGSQSSSNKNTIIGSVVGSVVGVFLCGIIIWAILF--RK
Ecym_6417          AWSN-NLFGNP-------TPSANPYKGSKKNMIIGTVLGSVCGFFFCLSVFCFMLF--RK
CAGL0J11176g       DWLS-GALD---------SNEENGNKSKNAGTIAGSVVGSVVGLLVCTLIVWYFYI--RK
NDAI0F03330        EWLN-GNLDSQQLT----SNSHDQTRTNKKGAIIGGVVSGICVASLCAAIIWVFIIRVRR
KLLA0D08239g       RWLS-GALD-----------SNSTSSGSNKDTIIGGVIGSVGGLALMILVIYLLF---RK
ZYRO0C09570g       YHLNKD------------NHHNSRRGGNDTGAIVGGVVGGVCGVVGCCLATWILLR--RR
Kpol_1041.6        HLTN--------------EKNYHHKSNSDPGTIAGSVVGSIAGFMICIFLVWFLVL--RK
KAFR0A07500        NWEK--------------STKVSSSSQKSTTSIIGGVVGGVGGLLLCSLVLYLILIWRRR
NCAS0G01940        NWLNGGSLDNTG------EPSASHSRITNKGAIIGGVIGGVCGILICSLLVWFVFK--RR
KNAG0F01310        KWLDGGGLDD--------SSSSGPTAHSKTGTIVGSVVGSVGGVLLCAVLIWFVMF--RR
TDEL0A01230        NWLN-GSLG-----------ESGSPTTPAKNKIIGGVVGGVGGLLLCSIVIWLMFF--RR
Suva_14.165        HWLN-GGLD---------SNQNQDTSKSNTGTIVGSIVGSIGGILVCAVIVWFLLF--KR
Skud_14.158        HWLD-GSLD---------NNQNQGTSKSNTGTIVGSVVGGVGGILVCALVVWFILF--KK
YNL176C            HWLD-GSLD---------NNKNQGTSKTNTGTIVGSVVGSVGGILICVLVVWFMLV--RK
Smik_14.154        HWLD-GSLD---------SNQSQGTSKSNTGTIVGSVVGSVGGVLISALVLWFILI--RK
SAKL0E12760g       NWLS-GSLD----------SDKSYSSRSNKHTIIGATVGSVCGFLLCLLMLWLMFF--RK
KLTH0B06908g       NWLS-GTLGSTS------SSSSGSLSKTHRNTIIGSVVGSVCGFLLVLGFLWFVLC--RR
Kwal_33.14461      SWLS-GTLGST-------SSGQGSMTPGHRNTIIGSVVGGVCGFILAATFIWFLVF--RR
                                                   : *  :. :                  .

KAFR0F00420        RSKKNEIM----------------------------------------------------
TPHA0F02320        SNKSNQLF---------LNKNNKRTKMYHTNGRKVNY-----------------------
Suva_4.36          RNVKTRSK----------------NGFSHDIGKRVGY-----------------------
Skud_4.42          RNVKNRSK----------------KGFSHNIGQRISC-----------------------
Smik_4.28          RNMKKRSK----------------KGFSHDIGKRVSC-----------------------
YDL211C            RNVKNHSK----------------KGFSHDIGKRVSC-----------------------
CAGL0G05808g       KRNTHNYM----------PD----DDLTSIKDEKGSY-YGFSTENTPYKPAISTRDLTAS
TBLA0B09680        GTFRKERR-----------RNGKPRTKPQIPANRANK-----------------------
NDAI0H03700        GRRRGNNG----------NLMRDSINNERKLGGRHYDSF---------------------
ABL135C            RQRRKQYS----------VA----REFTHELGRRL-E-YTTDPD-----EPAERAPPG--
NCAS0D00440        ARNKKRIDKTILNSINDHDDAEMKYGFSHDIGSRTTY-----------------------
Ecym_6417          KKALRKSK----------AE----RGFTHEIGCRL-D-YPVTEQ-----HDRSRGNVGVG
CAGL0J11176g       RRRNQKWK-------------------SFEVPSR--------------------------
NDAI0F03330        RRSRKNG-----------------VLFQQDQNRRYSN-YC---------GNIVQVDTN--
KLLA0D08239g       RRRRNLIE----------HE----KSFSHDIGRKM-G-YD--------------------
ZYRO0C09570g       RNHKRSAE----------SP----QGFSEEIGNRVENTSPSETPRTYFQEKPEEYIASNT
Kpol_1041.6        RNKKSDSS----------VK----GQFTHAVGRKITN-FDSFN------SNSEYDINDNP
KAFR0A07500        RKHKKDIE----------EE-----RFRRYVNSGT-D-YD--------------------
NCAS0G01940        RRGRGERE----------SC-----LKGSDVEGRF-------------------------
KNAG0F01310        RKHLRLRK----------ESSPSLEGFHHGLGRRTYN-YN---------ATALSRD----
TDEL0A01230        RKNKAE------------PT----VGFTYEIGRRA-G-YP---------SQSQSVDID--
Suva_14.165        RKNKRELK----------EN----SSFRHEIGRRT-G-FP---------TTAQARETS--
Skud_14.158        RKAKRAFK----------ES----DSFSHEIGRRT-G-FP---------TTAQAKETS--
YNL176C            RKAKRHFK----------EN----DSFCHEIGRRT-G-FP---------TTAQAKEAS--
Smik_14.154        RKAKKTFK----------DA----DLFYHEIGRRT-G-FP---------TTDQAKEAS--
SAKL0E12760g       RKNKIQAD----------ER-----GFSHEIGRRL-D-SPPEAPEAAEFSPSELTNPKNA
KLTH0B06908g       RKNR-ASQ----------SR-----SFSHEIGTRL-D-YPVAPP-----RPSQTQVPE--
Kwal_33.14461      GKRR-ATK----------NQ-----NFSHEIGTRL-E-YPPISP-----STDQPRSPD--
                                                                               

KAFR0F00420        -------------------------------------------DQEESIIDPFQGEFDYD
TPHA0F02320        ----DEEMVNNNYEIPRDV----------PEDVSNPFTDKTRTIATSPSTHAFQKEFNFE
Suva_4.36          ----------------------------------------DEVIKGEPISNPFRNEFDFK
Skud_4.42          ----------------------------------------DKVAKGEPMPNPFLNEVNYK
Smik_4.28          ----------------------------------------DEVAKGQSLSNPFLNELCYK
YDL211C            ----------------------------------------DEVTETEAPSNPFLNVLNYK
CAGL0G05808g       NQRLKKLFSKKENSTPTKN-----------------WKKATTEYMSTPSTNPFQDEFDFD
TBLA0B09680        ----------------------------------------NLNMSRKISSNPFDDSFQDE
NDAI0H03700        ----------------------------------------DNTKSPSNITDPFQNEFGFH
ABL135C            ----------RGAQRPTTR-----------------GGNARGDRQLEKTADPFGDEYAGL
NCAS0D00440        ----------------------------------------SSTQQQDRNRDPFGNEFEFD
Ecym_6417          LSADLPPLLKSKYRLGVHKKKRSESALKEFYKRRDLSNGRRASIDSTNSSNPFRDEFDFQ
CAGL0J11176g       ----------------------------------------SKDVEYNNNDNPFNNEFDFQ
NDAI0F03330        ----------KKSRWLNSK----------------------KYNNSNTWTDTGSVKVNSS
KLLA0D08239g       ----------DIGTFIAQS---------------------QQTTKTTTRVSTTAHNNNKV
ZYRO0C09570g       GNNENQLFSIFRTQRISRT------PGVDLARNQFFDPNFPCSSETKGIEDPFRDKYNSR
Kpol_1041.6        ISEGTIFQPHDNWTILNRQ---------------------RSDYFNDNGNRKNSKDVNNK
KAFR0A07500        ----------STYQ--------------------------KEEGSTYFNKNPFRNEFDFQ
NCAS0G01940        ----------NTGSFSGGH------------------RYYTGKNDSSMDSNPFRQEFNFN
KNAG0F01310        ----------------------------------------TQNKETSPQRDPFKREFDFN
TDEL0A01230        ----------QEKTQPTRQ---APFLARIKNKAIAQISKNRNSVPQNEESDPFQEEFDFR
Suva_14.165        ----------VHAQDPAAQ---------------------QTNTESSSTNNPFSNEFNFR
Skud_14.158        ----------LHAQESGAQ---------------------QGSIENASTSNPFSNEFNFK
YNL176C            ----------LQAQDSGSQ---------------------QRNTETASANNPFSNEFNFK
Smik_14.154        ----------IQAQDSGSQ---------------------QANGEIASTNNPFSNEFNFK
SAKL0E12760g       RSVDDEAFLKGKYKMLGKRLPPLPLW--SKKNLNSDENFPVIPEKEEKDVNPFKDEFDFQ
KLTH0B06908g       ---DDEAFLKSKYKSLGRK---LPLWHKSESHPTRGGTAEAESAQGEPKGNPFQDEFDFQ
Kwal_33.14461      ---EDEMFLKSKYKSLGGK---LPLWQGNNTNLQTKEVARGAPQQQKPRGNPFQDEFDFQ
                                                                               

KAFR0F00420        EGN-------KESSPSERK-----------------EHALSDENNTIDNWSSGDGFNSVT
TPHA0F02320        NRK-------APEIPRPRKIFNDDIVINDHDINGNVQFPSSVPFADNNTNSNIVRISSTD
Suva_4.36          ARSTSEGT--RDLFGDGRKTRRSDYLESVYTA----HPYYGTDDHETRRFSYLSSLNEST
Skud_4.42          VVISGGDR--RNLRENDRKIRRDNSSDSLFTE----HPYYGTENREAVRFSCPSSYTESS
Smik_4.28          VITNGEGL--RDSFDNRRDIRRGNSSDSLFIA----HPYYGTEDNETESISYLSSFNESN
YDL211C            VTTNGEGK--RDSFENGRDLHRASSSDGIYIA----HPYYGMADHESGRFSYVSSYNESA
CAGL0G05808g       KRLPS-----PPNLDNKDMTPSDKIINPRNGENDVSIPHLLLPDNESISLISEPEIEQST
TBLA0B09680        ----------KAALPDQDS---SSSLDSHL------TPPATNPHN---------SIANTS
NDAI0H03700        DRSIN-----VNIVNNNDN-----------------TLQGNDGMNPMGRFSYGSSMVDSS
ABL135C            GHG-------PEAAALPVS----------------------GDAYFTSRYSYVSSMDETT
NCAS0D00440        NREA--------------------------------GGAGTIPVGAANRSSYPSYYSSSS
Ecym_6417          QRT-------QPPPVPPRVLRPAVHMQT--------SRATLKLNGLFNRYSYVSSVNDET
CAGL0J11176g       HRV-------PPPLPPQRK---NHNSIG--------VPPSSMGLSNTRSADYHMRFSYIS
NDAI0F03330        KRVQ------PPPVPPPRKTTINRIPST--------FTLANSLLPSDIRLSYTSSTTGSS
KLLA0D08239g       SKS-------LPSVPPYVA---DSVR----------RPQTTNPFDD----EYVVSIADPE
ZYRO0C09570g       GRSHGQVQVTPPRVPPPRK---MHSNTQHP------IPSKNINSSRDNRSSLVSSLNDSS
Kpol_1041.6        SAGKE-----APKLPPPRK---NLAVR---------NEEAGNTKGSHNSLNSSSTMSSSN
KAFR0A07500        SRI-------PPLLPLPRK---NDNARQET------TPPLFLQTTNLDRSSFISHSSEDM
NCAS0G01940        ----------KPVVPPPRN-----------------GGVRASTLPHDNRFSLNSSLTGSS
KNAG0F01310        HRGEMSQRPAAPPIPPPRK---TVPTGTTPSNGQPLRHPLPMADETHARFSYMSSEYGSS
TDEL0A01230        KRP-------QPPIPPARSRHDTNQEAST-------RPAYDVPIDH--RFSYVSSLTDSS
Suva_14.165        ARGTA-----PPPPPPPRN---GIILDNSS------QNISNDSMNPDNRFSYVSSFTYSS
Skud_14.158        ARG-------APPVPLPRN---GMTINNFS------QTMRNDAMNAENRFSYGSSFTYSS
YNL176C            ARGN------PPPVPPPRN---VTAMNGSF------QNMRSNFMDQENRFSYGSSFTYSS
Smik_14.154        ARG-------VPPVPPLRD---TVATNNPS------YNIQNSFMNSENRFSYGSSFTYSS
SAKL0E12760g       QRL-------PPSPAPPAQ---------------------PHLSHYNNRFSFMSSMSEST
KLTH0B06908g       RRLS------RPPAPPP-------------------VPPRDVPN--------LSHFADDS
Kwal_33.14461      NRRL------PPPPPPPAR-----------------STETPLPRAD---------FYESD
                                                                               

KAFR0F00420        SSTRSSLSSYRDTDHDKINFD------------------------------------SLL
TPHA0F02320        SSIQSSDLSSSDITGSTITID----------------PFVSSAPHYPGNHSNSINDDGYL
Suva_4.36          GSSM---EETSSNASTITRPN-------------------------------IEQTNSFL
Skud_4.42          GSST---EEMSSNASTITRPN-------------------------------IEQTNSFL
Smik_4.28          GSSI---EETSSNASTITRPN-------------------------------IEQTNSFL
YDL211C            ESSI---EETSSSASTITRPN-------------------------------IQQTNSFL
CAGL0G05808g       NTDTNEQFSYVS-SMNSYGPG--------------------SSFVPSSVGDYSTLSPTSI
TBLA0B09680        ISNY---ESLVSSGETSISLN-----------------------SPSSASFIEPNSHAFL
NDAI0H03700        G----IDDGYSSMSSTSLYLGQNYDRDGMDGTSDPFGQSSNNNSTRQQQQQQQINTHGFL
ABL135C            TDQQSDNSYSSELDSIPIHLA------------------PNERTDRQHMGAANTGSQSFL
NCAS0D00440        GSGMITDSSFGGSSMGSLNID-------------------THDGMAHGDQTRSNDYQSFL
Ecym_6417          TDNLSSDIYSSESGSIPILLA-----------------PRSRSDAANPSQVTHVGSQSFL
CAGL0J11176g       SSTD-SSDDYSDSMQSALHIG----------------------SDSGRERSNDVPEMGYL
NDAI0F03330        IDLS-QLGSYSSMSTTPIRVV--------------------PELHDNTTGTHSSNKQGFL
KLLA0D08239g       SQTPSTTSLHSSFVSSSTDEG------------------THDTEMSVTYDENPQNAHGYL
ZYRO0C09570g       FASS-LQGDYSTLSSGPIRLD----------------------PSVNGSNIPENPDGGFF
Kpol_1041.6        FELG---FDFSTISSTSLRYE--------------------YPIDNIFEDEEDSNVPGFF
KAFR0A07500        TDTP---GDYSTVSTTSMRLW-------------------GRYDSPTTNNASNSDSQGFL
NCAS0G01940        IGSTINSGSYSSMSSNSIRLG----------------------SDFEDNRNSAQLANGFL
KNAG0F01310        MDSS-EINDSLSTASSSLRLG-----------------------TRHDSGVPRNGNQGFL
TDEL0A01230        YISS-AEGDYSSLSSTSVRLP-------------------------SDVPNHSESSHGFL
Suva_14.165        LGSS-TQGGFSALSSNSINLG----------------HGLNNSVPNDERGSAQDKTHGFL
Skud_14.158        LGSS-TQGGFSTLSSNSIRLG----------------HGLDNNASNDGRSPSQNNPEGFL
YNL176C            LGSS-TQGGFSTLSSNSIRLG----------------RGLDNDISHDERNTVQNNSQGFL
Smik_14.154        SGSS-TQNGFSTLSSNSIRLG----------------HGLDNNASMDGGCSVENNSQGFL
SAKL0E12760g       SSS----GEYTESDTSLIELW----------------QQGPQSSAQDQNTRLPHTSQSLL
KLTH0B06908g       DASSSSSENSVNDSSSSIQLT--------------------------RPARAARSTQSFL
Kwal_33.14461      ASSS--SGSSVDDSTSSIQLT--------------------------RPAGAARSTQSFL
                                                                              :

KAFR0F00420        R-----EVI--
TPHA0F02320        K-----EIF--
Suva_4.36          R-----EII--
Skud_4.42          R-----EII--
Smik_4.28          R-----EVI--
YDL211C            R-----EII--
CAGL0G05808g       HIDEDGSIL--
TBLA0B09680        S-----ELI--
NDAI0H03700        R-----EII--
ABL135C            K-----EVI--
NCAS0D00440        R-----EII--
Ecym_6417          K-----EVL--
CAGL0J11176g       R-----EII--
NDAI0F03330        R-----EII--
KLLA0D08239g       T-----ELIEH
ZYRO0C09570g       L-----EVI--
Kpol_1041.6        R-----EVF--
KAFR0A07500        R-----EIF--
NCAS0G01940        R-----EII--
KNAG0F01310        R-----EII--
TDEL0A01230        R-----EVI--
Suva_14.165        R-----EII--
Skud_14.158        R-----EII--
YNL176C            R-----EII--
Smik_14.154        R-----EII--
SAKL0E12760g       R-----EVI--
KLTH0B06908g       H-----EVL--
Kwal_33.14461      Q-----EVL--
                         .::  

FASTA FORMAT for MUSCLE Version 3.6

>KAFR0F00420
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------MNKKFLLTLFYYYCSPIAAAEP----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------SRNIYYNPDDVS
FENIVTSTIAESTLRSASTAS------------ILKNSVSYGPQDTFNNDAILSATYPSL
VVEN--SSSA--------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---NLSSHASTSAVEPISNNNFSVTATYSINNNASKMSLQNEAGTASSYLSSSTSQGLDH
GLPKLNTTLVVSTGKLR-------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------G
SSLLPHNHLTSSKFTSSVSFSYVMPTKSSLAKSSSSSTSSLLSSSTLL-----------S
YVS------------------------------------------------YTVSMANEK
DYLI-YTQVYIFTDETTSFTSGLPTTITLPKSSVESGEVPT--THIAA-TIITTPVSVYK
AWEAK-------------NNEQQTKATRRHNLVIGCCVGCICGSLLIIGVFCLAFY--MK
RSKKNEIM----------------------------------------------------
-------------------------------------------DQEESIIDPFQGEFDYD
EGN-------KESSPSERK-----------------EHALSDENNTIDNWSSGDGFNSVT
SSTRSSLSSYRDTDHDKINFD------------------------------------SLL
R-----EVI--
>TPHA0F02320
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------MVLFSMTNKTSSVFPDSLTAL----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------------SFDTV
LYPTTSTQISYSSSSGSATEE--------------ITSHSFSSTTDIISESNTSLALDSN
LYRT--SSGD--------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---SSINAFQNSSATDLETHFTTSPIHNLTISSHVSSDTSTVAGLVSSSSIESFNQTTSK
SFNHITTITPSIYVQSFRHATTS-------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------K
LSSSTPSTLISTISSTSVYPSSSYSSEYSNYSTASPASISRYSLWSS------------D
LES----------STLFTSTASSSNSE------------------------YSISTNSSK
LYLI-YTQTYVVTGSSIAFTTDILMTTRINPTKFQQNGTPT--YTYGS-NTITTNLAYYN
NLVT-GKTT---------------STSSKNGKIAGGVIGALLGFIIICIVTLVNFR--RK
SNKSNQLF---------LNKNNKRTKMYHTNGRKVNY-----------------------
----DEEMVNNNYEIPRDV----------PEDVSNPFTDKTRTIATSPSTHAFQKEFNFE
NRK-------APEIPRPRKIFNDDIVINDHDINGNVQFPSSVPFADNNTNSNIVRISSTD
SSIQSSDLSSSDITGSTITID----------------PFVSSAPHYPGNHSNSINDDGYL
K-----EIF--
>Suva_4.36
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------MLLNVTSSQFRNKHQPTSEA----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------ATTESCSSLP-------------------------LAAQESTITWSVEP
ENTI--SFVE--------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---SCVPSSHNYTSSPRSLTA---------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------S
ASPSIKSNITIDEWLTSAPKTLPLTPTPTIQPPTTEPTTPSSTIFAS------------T
ITT----------SES-----------------------------------YTMFTSKNS
IYVV-YEQEYEITESTTSFSTHFPQTTGLK----GTNAPLT--FTIPY-NTITGDAKLYR
KLLP-GALD---------TQNTSDKDNKNTGVIVGSTVGTIIGVVVVIFIVFVVIR--NK
RNVKTRSK----------------NGFSHDIGKRVGY-----------------------
----------------------------------------DEVIKGEPISNPFRNEFDFK
ARSTSEGT--RDLFGDGRKTRRSDYLESVYTA----HPYYGTDDHETRRFSYLSSLNEST
GSSM---EETSSNASTITRPN-------------------------------IEQTNSFL
R-----EII--
>Skud_4.42
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------MLLSVTSSRFVNRYQPT-------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------S
LNGFDTPETCLSPSSAIDLTA------------------ALSTGTEAKTIIESLGCVISS
IQGL--SSTE--------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---FNCTSVSKPLVA---------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------N
YSSSVISNITLDRWLISSLKTFSSSAKPTIHPSTTEITTPLFTTHVT------------S
ATS----------ET------------------------------------YSAFTDQKS
IYVV-YDQEYKITELTTTFNTHFPQTTVLK----EAGALLT--FTIPS-NTITGDAKLYQ
VLS--GELN---------VQNSPDKKNKKTGVIVGSTVGVIIGVVVIIFIGFTIIR--NK
RNVKNRSK----------------KGFSHNIGQRISC-----------------------
----------------------------------------DKVAKGEPMPNPFLNEVNYK
VVISGGDR--RNLRENDRKIRRDNSSDSLFTE----HPYYGTENREAVRFSCPSSYTESS
GSST---EEMSSNASTITRPN-------------------------------IEQTNSFL
R-----EII--
>Smik_4.28
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------MLLNVTSSRYISMPQLKSQN----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-SISRTRFTSSPVAEPSTALP---------------------IATGSTITTKLLESLESL
SQVM--STTA--------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---YNTISLNNYTSSSQSLVK---------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------N
CSSSVKSNITIDRWLISSLKSFSSSLMPTMQPSTTELTTPLFTTFAP------------T
TTS----------EI------------------------------------YSVFTSDES
IYVV-YDQIYKITESSTTFNTHFPQTTVLK----EADTPLT--FTIPT-NTITGDAKLYQ
NLS--GAL----------NTQEGSNSYRKTGVIVGSTVGVVIGVVVVIFIGLIIIR--NK
RNMKKRSK----------------KGFSHDIGKRVSC-----------------------
----------------------------------------DEVAKGQSLSNPFLNELCYK
VITNGEGL--RDSFDNRRDIRRGNSSDSLFIA----HPYYGTEDNETESISYLSSFNESN
GSSI---EETSSNASTITRPN-------------------------------IEQTNSFL
R-----EVI--
>YDL211C
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------MLLNVTSSQYISTPQSR-------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------S
LSEIDTSETASLSSATDHIFA-------------------LSTEVVSSITTNLIEGLESS
IQVP--ISTA--------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---YGTTSFRNNTSSPQYLVS---------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------N
CTSSVQSNITIDRGLLSTLKTFTTSQVPTIEPSTTKLTTPLSTTFTS------------T
STS----------EI------------------------------------YSVFTSENS
VYII-YDQEYKFTERSTTFNTHFPQTTVLQ----ESNPPLT--FTIPS-NTITGDAKLYQ
-YLS-GALN---------TQDTSDANNRRTGVIVGSTVGVVIGVVIVIFIGFIIIR--NR
RNVKNHSK----------------KGFSHDIGKRVSC-----------------------
----------------------------------------DEVTETEAPSNPFLNVLNYK
VTTNGEGK--RDSFENGRDLHRASSSDGIYIA----HPYYGMADHESGRFSYVSSYNESA
ESSI---EETSSSASTITRPN-------------------------------IQQTNSFL
R-----EII--
>CAGL0G05808g
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------MADSNITMSSSDVYVDGPPTV----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------------LNANT
SVPMESDPLSISIPSNSVTIH----------TSQNVTDVEPVTANAASSNNTTSMPVSSL
SSQQ--NTTT--------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---TPVPITPYYSQSYSSISKNSSISTSSLPSITSAISITPASSKNSTSSSTSITSSLFS
SSYLTSVTSSYNTTSNIIPFSTSK------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------S
TETYISSQSTSFSISSESSVQISSSSSSSSSPSSSSSPNSSSALSSS------------S
SSS----------SNTESSSSSTPI--------------------------ISSTISKNY
IIYI-YDQKFEFTDASTTFDTDIPVETRIK---VTPNKMVS--FTPPT-GILTTDAALYQ
KYLA-GTLD---------WNSHDTDARIRNSKIIGGVVGSVCGLLVCSVVIFLLFF--RR
KRNTHNYM----------PD----DDLTSIKDEKGSY-YGFSTENTPYKPAISTRDLTAS
NQRLKKLFSKKENSTPTKN-----------------WKKATTEYMSTPSTNPFQDEFDFD
KRLPS-----PPNLDNKDMTPSDKIINPRNGENDVSIPHLLLPDNESISLISEPEIEQST
NTDTNEQFSYVS-SMNSYGPG--------------------SSFVPSSVGDYSTLSPTSI
HIDEDGSIL--
>TBLA0B09680
MTVKADTIPSGLQQPWANSLQTPTTTFLISSPAMTMPIENSPVNGLNQNPSTPNMKLDGN
PSSIPENSFAVDQQDATNSIQVQQTEATSIQNLNSLETTPANNQPALNTFPTNNQPTTSI
NNVANSPIVTTEPFNNEIITTLNTIANQPLAITASINDQPITFSNMPINQPLVSTGPVNI
KPFSTSTTIVNQPLVAIESTTNQRIIPSTTLASMPLAIVDSTNSQLVTTSNELVNSRSVN
NLPIIDSNTITSQPLVSVGSLNSQLITNSNDVISQLFTTTWSFDIPRKSRFSGISNSPLA
AVWSVNNQSIATTNSISNLLLANSDSIKNQQLIDANFVNTQQTSSYDTLSNQILTAYYSI
NQQPVTTSNVIYNQPLITAGSINNGFVTISDGLENQQLAVVGLASPQPTYTYSTIDNQPL
AVVGTVNNQPLYDPNTVNNQPIAVTGSANYQPITTADILAAQPLVAMEPSNIQSIDTTDA
LVMQPLDAKSPVNTEPIATEPIATEPVNTEPVNTEPVNTEPVNTEPVNTEPVNTEPVNTE
PVNTEPVNTEPVNTEPVNTEPVNTEPVNTEPVNTEPVNTEPVNTEPIVTVDVLATQQLVA
LAPSNIQPIIISNTLADQPVVVTGQIDNQHFETENSQSHPSSVLPINYNTNYGVDINPPN
SHFLAYSDTADNQLLNEQVISSTQPPNAIASNNASPIENISTTSSGNLLENLNSFPSQVL
GTDLSTTQDKLYTLSGTILSTFSATTQGSQDLFMVSTEPTQVYDTILSQAILSVTMPSGT
IPTASVLFSSKSSKRSMNTLLDFSSIIESENLSSALLSSESEYVASFTTANLSPSSSEPP
SLITMIPDISVSSNFKPSVQYSTNLNSNSGNQFSATNELSIIPTLPLPETPITQIDSQEL
NYLTSTTSFDISNIESSNLNAIDSLQSILLGTSNYVFTDYENAPSTPSLGSIEITSLTPT
SFNSYKASSSATLIGNLIPSFSISDNIIFPDVTTLSDQSLASTNLSQSSTLGEQGVNEPQ
SFKYTATNTISSFQGSSLDNSLILSTVNSSLEYVDVIYTTVIISNSAQLYSILDNSQNRI
NSFGPILSTSSRHLHINSIESETSIGDSFYTIRNNSTSDLQLLSTQSEEVLSTINANSSF
TVSFSTLTSYDSSSFLPVFSATSTIDAYNTSSSQEHFELQYTTSMPTTDLYNSRVNFLSS
LDTSRIVDTSKDNWSSYVTSGSDEKTLYSRSRPSYTKTTIDNSTISSSSSVIQPIEINLK
STSHLVSFNSSHKSTQKDTSTISIQGSVSRPETTPFISSTASSRDVHSKKYVESYISSGF
IYFV-FNETFNFTDSTTNLITDLPTTTRVL----ANCT-TS--INFPS-QTLTENIQVYE
NWIHNGGT----------KPYTTHHGSSSTGAIVGGVVGGVGGTLLVVIVLGYLYW--HK
GTFRKERR-----------RNGKPRTKPQIPANRANK-----------------------
----------------------------------------NLNMSRKISSNPFDDSFQDE
----------KAALPDQDS---SSSLDSHL------TPPATNPHN---------SIANTS
ISNY---ESLVSSGETSISLN-----------------------SPSSASFIEPNSHAFL
S-----ELI--
>NDAI0H03700
------------------------------------------------------------
--------------------------------MNQNTTSLTTQPLGSYIDHQITSSSEPT
VTEPGLSSVLTSHSFSSQISVVQPSISQLDSNIPLSSSDST-------------------
-------------INSNPTTKLEAKQASLSALNSQTSVFDTDSMEYVDLSPLSLSS----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------SLSPSTPISSILPSPSSASVMLTSTST
SALLDISSSISSTLTTPLAQP------------SSSTTITNAYTTSSSSIDSQYNSLSSN
LLNSMGGNSD--------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---QNIIPTSVTFTN-LDLSPLLASYYALLTTSSSISSAVTTTSTSRSTLQSSSTATLKN
LPLLPSTTNSSSSMPK--------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------E
ASKVVHSSSTASIYLSTRIIDVSSSCSSSALSHMTRLSSSLSSSSIESDNSQQSSTSSFT
SSS----------SSSSSSSSSSQTQMYS----------------------ISEDLTNSQ
LYYIYYTQDYYFTNSITTIETGLPMRTTIS----AQTPPVV--SNIPTISVITTDVSFYQ
HWLDSGSIDDDDNGSDDSNSKSGGGNNKNKGTIIGSIVGSIGGFLLCCLIIWFMFF--RR
GRRRGNNG----------NLMRDSINNERKLGGRHYDSF---------------------
----------------------------------------DNTKSPSNITDPFQNEFGFH
DRSIN-----VNIVNNNDN-----------------TLQGNDGMNPMGRFSYGSSMVDSS
G----IDDGYSSMSSTSLYLGQNYDRDGMDGTSDPFGQSSNNNSTRQQQQQQQINTHGFL
R-----EII--
>ABL135C
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------MGYNNTSSPIGSGHGSS-------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----GVEKASRPSSVQSTTQM---------------------GARHSESMNLSVSWLSTD
AWSA--AEFA--------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---TLEGQRNRTESS---------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------G
FTSTSSTSARSDRWAQT-------------------------------------------
---------------------------------------------------EEAVGTPQM
TFVV-YSQRYKLTASYTTLCTLIPTTTTLP----YSET-AT--YSAPT-TVITTDIAFYK
GLVP-G--DD--------DKSAARVNGAQKRTIIGSVVGSVCGLLMCAMAAYYLLH--LR
RQRRKQYS----------VA----REFTHELGRRL-E-YTTDPD-----EPAERAPPG--
----------RGAQRPTTR-----------------GGNARGDRQLEKTADPFGDEYAGL
GHG-------PEAAALPVS----------------------GDAYFTSRYSYVSSMDETT
TDQQSDNSYSSELDSIPIHLA------------------PNERTDRQHMGAANTGSQSFL
K-----EVI--
>NCAS0D00440
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------MEFNNTITTDGLSQIASADL----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--ISTATTTLVSSFSASIVQP---------SSTRLDNLGEIANSTLVSTDTSLSQSILAN
QITT--DYQV--------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---TGIPTFARNATQSVTSSTGSSLLANSLSSETSITSLSDQFELPSSTSTSSKRILPSL
HLSSLPKLSTT-------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------R
SKYSSYAQVSSSSDITSSLVSPEYTSSSSTTIPVTTLTSTVHDTITS------------S
TSS----------SSSSSSTSEYYS--------------------------ISHDSKSTS
VYYMYYSQAYYFTDSSETFTTELPQKTRIT----TTGLNPTLSFVVPQ-NTITTDAAFYQ
RWLN-GGMDDI-------SSDGGSQSSSNKNTIIGSVVGSVVGVFLCGIIIWAILF--RK
ARNKKRIDKTILNSINDHDDAEMKYGFSHDIGSRTTY-----------------------
----------------------------------------SSTQQQDRNRDPFGNEFEFD
NREA--------------------------------GGAGTIPVGAANRSSYPSYYSSSS
GSGMITDSSFGGSSMGSLNID-------------------THDGMAHGDQTRSNDYQSFL
R-----EII--
>Ecym_6417
------------------------------------------------------------
-------------------------------------------------MMPYNNTSSPA
INIESPKVYPPSSFSSDSKTGLMLYPEVISAISKE-------------------------
---------------------SLSLGGIPSSSSLESLLYSATSESTETPKHTGDLT----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------LVGSSSSAISSRLTESNTSG
QLLDSNSGGDTSRSATSYVQP----------------SVSPTPLPTSEAPNTSGHTSVAA
VRDTMPSRKA--------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---TESGQSTLYQSSSLSLVYSTAIVAPSDTPSSVQQLHSHNTLFEVTTLESQTHATSVT
SSSGDSD-----------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------A
ESSSSSENDGRESTEDTSDLSVTFVTLTVSLNPTVVIHSTVLSTVYP------------T
PSQ----------TTQDRSSIPPISSI------------------------NLDAIPTDK
TYVI-YTQNYQFTASYTTFNTGLPVTSVMP----TEVY-ST--FSTPT-SVITTDVGLYK
AWSN-NLFGNP-------TPSANPYKGSKKNMIIGTVLGSVCGFFFCLSVFCFMLF--RK
KKALRKSK----------AE----RGFTHEIGCRL-D-YPVTEQ-----HDRSRGNVGVG
LSADLPPLLKSKYRLGVHKKKRSESALKEFYKRRDLSNGRRASIDSTNSSNPFRDEFDFQ
QRT-------QPPPVPPRVLRPAVHMQT--------SRATLKLNGLFNRYSYVSSVNDET
TDNLSSDIYSSESGSIPILLA-----------------PRSRSDAANPSQVTHVGSQSFL
K-----EVL--
>CAGL0J11176g
------------------------------------------------------------
-----------------------MIHNSSYTEAADIKSLSSFIEESSRVPDYISESNNIG
WSSNINNPPLFESSSFDITTQNDNWILTETMQNITTESSSTFSRSVASSVFPSSSQAFVS
PPSIIDIPISSIPESSSISISSDVLSSAITVSQTSSSSYSSLISSYSTIQSTSSSS----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------ISENEISSSSRISPGL
LSSVPSITTSFSSGISSSVSP--TSSLQQIAEQSSNSSLAENDLLSSSLTILSSVLSSSV
LLHNSGVSSS--------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---SFTDNFSSTLTNSSNSLAILSSISESSLINTITDLPSSSVLLSPNNSESSIKVSSAS
SSSSRRKASTYTTPSRIPFSNSSEWYTPLP------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------T
PSISSSTNDTSSLLSELALIGISSSSSSSSSSQFYTSSTSSSSLVSSSENYSSSQPTTIE
PIT----------STISSSYSDLSNDGE-----------------------ILSSTLGKS
VYYS-YIQTFDITASTTTFETALPIVTAFN----LKDS-YT--FSKPS-SIITTDLHFYK
DWLS-GALD---------SNEENGNKSKNAGTIAGSVVGSVVGLLVCTLIVWYFYI--RK
RRRNQKWK-------------------SFEVPSR--------------------------
----------------------------------------SKDVEYNNNDNPFNNEFDFQ
HRV-------PPPLPPQRK---NHNSIG--------VPPSSMGLSNTRSADYHMRFSYIS
SSTD-SSDDYSDSMQSALHIG----------------------SDSGRERSNDVPEMGYL
R-----EII--
>NDAI0F03330
------------------------------------------------------------
-------------------------------MEVNFNNTIEDRSSSVVKSLKLTEGNSAS
AYSPNTYKQPQGTIATSISSTSIVEPSIVDLDTVLTSSSIETIKALA-------------
---------------------ESTFVSSLGPLSNEHSFSPLSSLYAQTWESPVHKT----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------SIAPISTSFATYTSNERASISEQTSSRERPSLSSKTLSFE
LDPYQNTKFSETQLHELSTEP---DSISTHSISTLMSSFQFISSQTMQSFPPSAKSETFQ
DSNV--ISVT--------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---TEVQYDNAKESSSHRTIMVDSINTTSLLPSSNSFIKEELKLSTSASPIATRYNLLTS
SRKKEMTRNTSVDSFVHTTSMTKI------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------V
DYSMYTPQLFGQKQGSSEYSYQNFSPSASKMPTLRSSIRTLPALKLNATTSITRGYIENL
KPS----------SSSKSESSSFHSKISNVENSLIKSSTSTNEELLLTAILYSVYPSSNI
YFYV-YTQMYDFTDSSTTFITGLPTTVSLQ----GSPT-TL--LTIPT-STITKGTAFYK
EWLN-GNLDSQQLT----SNSHDQTRTNKKGAIIGGVVSGICVASLCAAIIWVFIIRVRR
RRSRKNG-----------------VLFQQDQNRRYSN-YC---------GNIVQVDTN--
----------KKSRWLNSK----------------------KYNNSNTWTDTGSVKVNSS
KRVQ------PPPVPPPRKTTINRIPST--------FTLANSLLPSDIRLSYTSSTTGSS
IDLS-QLGSYSSMSTTPIRVV--------------------PELHDNTTGTHSSNKQGFL
R-----EII--
>KLLA0D08239g
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------MLFNTTTDGTDYSSVVSSSD----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------------TL
TESSESFSQSVASLRTDYINP-----------DSGNSTQQPHGMKTRTVLVYPNRSHSDS
DSPGIVSPST--------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---VWVPPSTDDSTSHTDVDTA--------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------M
VTVLEMSSGPSNIVMQTIYPENTATQEYTSVEGTEATATVPTPTWLT-------------
---------------------------------------------------LTTEVPSSE
TVVY-YTRDFIFTDTSTTFTKGLPTLTVIP----TE---AT--FTTPT-GPVVTDTSFYE
RWLS-GALD-----------SNSTSSGSNKDTIIGGVIGSVGGLALMILVIYLLF---RK
RRRRNLIE----------HE----KSFSHDIGRKM-G-YD--------------------
----------DIGTFIAQS---------------------QQTTKTTTRVSTTAHNNNKV
SKS-------LPSVPPYVA---DSVR----------RPQTTNPFDD----EYVVSIADPE
SQTPSTTSLHSSFVSSSTDEG------------------THDTEMSVTYDENPQNAHGYL
T-----ELIEH
>ZYRO0C09570g
------------------------------------------------------------
-----------------MEVSLNTAWQASFPSEQLSSASSTWGDSSSTTSVLNNYPKTSG
LSSTTNSDYEQPYSYMSTTNLSPSGSIDASNPTSTISSSSVTSSTTLAPWWSTVSSDPKP
LKSTADTKSSYLSFSSSSPWWESTSNDIYASPTTSSSNLNTQTSSNSIWSENSDSIWGLN
PILISGSSSGSITVDTSSNTFINSDTNSNFNWWSSTTSSSYEFMSSTGSMWASTFSSPST
WTTSDDFQNSLSSTSLPWSSSSLVTTSSDEIPGNMEPITSLSDSYSWWNPSTTEFYSPSG
YTTSKSASPTPSTSPVTSQMDTSPVALPSQSSYNWGSELSIAAISSTITLPSQSSYNWNS
ELSTTSTTSTSPTFAWLSGWYSSWFLSSSPTMLPSASEAPAIMATMSASSNVLSSYIPQT
STSYDPFTTATPTPTSSISQPLISSSTFSSRVFTILSSGSPSSSTIPTYLISSASSASSL
INTI--DPSS--------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---STSDLWIYSSSEPQPITSSVPATEDLRSTDTAVPAGWSDTILSGSTPPSPITALWSY
VGPSNSIIPTTTSDFPSATSLATNDSSDIIPTSNDEPVSSADDLSNYLPTISGVEPTTSV
ISSPVAAPTSLSSDPVATIPTMLFSTTSS-------------------------------
------------------------------------------------------------
-------------------SSSDWYESTPMTSGIESSQVVAFSSVPSDSSATSSIWFELT
PPTSSDSSFFVPSSSSLFPISMTYSWTSPVVESSSQSPISSSSSTTSAEGNTFSKTSSGS
SSN----------HSSKSGISSPSYLHFSSQSNSTSSTNAD----------YSVSYGTRS
AYYI-YTQTYVITASTTTFETGIPTTVGMP----RSGS-ST--FSTPQ-PAVTQDIGFYN
YHLNKD------------NHHNSRRGGNDTGAIVGGVVGGVCGVVGCCLATWILLR--RR
RNHKRSAE----------SP----QGFSEEIGNRVENTSPSETPRTYFQEKPEEYIASNT
GNNENQLFSIFRTQRISRT------PGVDLARNQFFDPNFPCSSETKGIEDPFRDKYNSR
GRSHGQVQVTPPRVPPPRK---MHSNTQHP------IPSKNINSSRDNRSSLVSSLNDSS
FASS-LQGDYSTLSSGPIRLD----------------------PSVNGSNIPENPDGGFF
L-----EVI--
>Kpol_1041.6
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----MLTSDEIPSTDEELTTP---------------------------------------
---------E--------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------YLVSSRSGE
LYYI-FTQTYEFVNSETDFTEGFVTTKSIN----RKEA-AT--YKFSA-TTITTDASYYK
HLTN--------------EKNYHHKSNSDPGTIAGSVVGSIAGFMICIFLVWFLVL--RK
RNKKSDSS----------VK----GQFTHAVGRKITN-FDSFN------SNSEYDINDNP
ISEGTIFQPHDNWTILNRQ---------------------RSDYFNDNGNRKNSKDVNNK
SAGKE-----APKLPPPRK---NLAVR---------NEEAGNTKGSHNSLNSSSTMSSSN
FELG---FDFSTISSTSLRYE--------------------YPIDNIFEDEEDSNVPGFF
R-----EVF--
>KAFR0A07500
------------------------------------------------------------
---------------------------------------------MALNTSYFGDPSLHP
SSFINTYTIMANYYSSNGPTSRSTLSRESDSNSIEKSSEDL-------------------
---------------------WGTLYPAGSSSQYSSFLFSSSMDYYGFKSESALQT----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----TSSSTDASSTTASVIYTVQETTSGIHSSSALPSNTFSDEISGYTSSLSALYSSPT
STKIQSSAFDFPSFNSEATIT-----------TSYNSLIQPNSLHVSISSEIPSSTLSDS
LNLA--SSSE--------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---NSISSLPRSSTEVSSLSSETASSDAHTIVQSSTHEPFTSPNQVSVSESMSESSTNSS
VSIPYTKINSFTKGSSALRQSSTT------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------S
IYSSFNKNVTSTGIQTAIKPSFLPTSLTLVSKSSSESHPTSSATSTK------------L
SDT----------SSAASLISRSTVE-------------------------IISYTNSGT
VYYV-YTQNYDFTDATTTFATGLPTTITVA----ETAASSI--TALPV-STITTDVSVYN
NWEK--------------STKVSSSSQKSTTSIIGGVVGGVGGLLLCSLVLYLILIWRRR
RKHKKDIE----------EE-----RFRRYVNSGT-D-YD--------------------
----------STYQ--------------------------KEEGSTYFNKNPFRNEFDFQ
SRI-------PPLLPLPRK---NDNARQET------TPPLFLQTTNLDRSSFISHSSEDM
TDTP---GDYSTVSTTSMRLW-------------------GRYDSPTTNNASNSDSQGFL
R-----EIF--
>NCAS0G01940
------------------------------------------------------------
--------------------------------MITNMNLNGTFGYSSAEFDQFSHFSDIS
STYPTTPQYYSTVLSSGKSVENHSSIFSVVQPTTTSLPS---------------------
---------------------LSSFTNAVSSGSAAHSFNDVSSSQQYQETSSLSNL----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------NGDMGSSLLSTVNNSPLSSHFSQQT
LSSTQLQTSSTTALVESLNLP-----------REESSMVGVVSSTRMANSLFDTSSTNFE
MLST--LNNT--------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---FITSQMTIPVLQTPSLTYLSPSPSLSSTVKATVHNYTFSSEVTTSSTKLSSYRSTTA
ASTVPLNVTTIDSTVE--------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------R
PTMSPHSVTKITNTTSSLSTGGSISSSSVEEKKSSRASTSFVSTTYS------------T
STI----------FPSSTESQIYNTSLTT----------------------SRVLRTRDP
VAVV-YTQTYEFTDSRTSFLTGIVTTATIT----GDAT-ST--FDIST-PTITKDTKLYQ
NWLNGGSLDNTG------EPSASHSRITNKGAIIGGVIGGVCGILICSLLVWFVFK--RR
RRGRGERE----------SC-----LKGSDVEGRF-------------------------
----------NTGSFSGGH------------------RYYTGKNDSSMDSNPFRQEFNFN
----------KPVVPPPRN-----------------GGVRASTLPHDNRFSLNSSLTGSS
IGSTINSGSYSSMSSNSIRLG----------------------SDFEDNRNSAQLANGFL
R-----EII--
>KNAG0F01310
------------------------------------------------------------
--------------------------------MAYNGTGPGIPPPSTDIVSELQQSITSG
AVDPAVYTLLPTSLTAQSSFELQNLPYSSSVAVPTPSSTPV-------------------
---------------------DVSEVSQVTGGDLFTSSSNSINQYSQYVPSPTDST----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------NHQPTTSSITSSEA
YVIPDITSSSYVTASSSSVED---TTWSQILSAFENDTAQWSLADLLTSTEPTTSSYEPP
LTSS--FLSS--------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---GMPVIHKSSLPGRSELDESLAARSTSIIYSSSIPTATSSSLAQLVVSSSSWYSTPVS
STPVFSSATLSSSLSRSAPSSSIK------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------R
ITSILSLPPLTSQYLNSSLTTTTISSLSPSSSSSAPPFSSSSAVFYNSTSELPFAATEPT
STS----------DDFTSSATAVSSSTSL----------------------YSVSDASKA
FYYI-YQQPYVFTDTTTTFTTDLPKTTSIM----KGRS-QS--FVVPS-STVTAPVKAYK
KWLDGGGLDD--------SSSSGPTAHSKTGTIVGSVVGSVGGVLLCAVLIWFVMF--RR
RKHLRLRK----------ESSPSLEGFHHGLGRRTYN-YN---------ATALSRD----
----------------------------------------TQNKETSPQRDPFKREFDFN
HRGEMSQRPAAPPIPPPRK---TVPTGTTPSNGQPLRHPLPMADETHARFSYMSSEYGSS
MDSS-EINDSLSTASSSLRLG-----------------------TRHDSGVPRNGNQGFL
R-----EII--
>TDEL0A01230
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------MVFNSSSVRQSSETGGWSLT----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------DIAFSSVSTSAEES--------------------TSTWGPAIVTPSSSSLASS
QSSS--KSSS--------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---QWSSAIYVSSSV---------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------Y
DVSSSSPTVFSSDQTSVSTLVPSYPWSSVSSSSSKQSFSSDFATTST-------------
SAS----------SPG-----------------------------------YTVSSDSKS
AFII-YTQQYYITGSSTTFETGLPTTTVRA----KTAT-SS--FSVPS-ATQTRDFEFYQ
NWLN-GSLG-----------ESGSPTTPAKNKIIGGVVGGVGGLLLCSIVIWLMFF--RR
RKNKAE------------PT----VGFTYEIGRRA-G-YP---------SQSQSVDID--
----------QEKTQPTRQ---APFLARIKNKAIAQISKNRNSVPQNEESDPFQEEFDFR
KRP-------QPPIPPARSRHDTNQEAST-------RPAYDVPIDH--RFSYVSSLTDSS
YISS-AEGDYSSLSSTSVRLP-------------------------SDVPNHSESSHGFL
R-----EVI--
>Suva_14.165
------------------------------------------------------------
-------------------------------MSSNSTLGKDSLEQVSTSSLSISGQSHSL
ISSSTYVSPTPSSTLIAQQGSLTSLPPASSTSVPTYRSSKTISDGSV-------------
--------HSSFSVSSTYTLISSSIDGQSSGQQTDSSQSDSATTSFSVITPSLSIL----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------SSSSSPSSSLYSDFG
KSSLDSASTSFSSSTPSAISP----------SFTSLSSTDIASSQVTSALQATSTESSTI
FESSSTSNED--------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---ITSSYSDRITSTLIYTSLFSSATNSSTKSDSSKPASTTPSSTVSDTFQSTTSGTHMP
KLVSSQTTSTTSS-----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------S
SRPSSSSDASTSSYTSSFSSDSRYSSEQTTYTSSSSVPMTTPTPYTT------------T
TST----------TPLTSSSQTYSIGV------------------------VSSSEDSQT
IYYF-YTQAYDITGSSTTFTTGLPTTVALA----KSAVRSS--FSVPS-STVTADMSFYQ
HWLN-GGLD---------SNQNQDTSKSNTGTIVGSIVGSIGGILVCAVIVWFLLF--KR
RKNKRELK----------EN----SSFRHEIGRRT-G-FP---------TTAQARETS--
----------VHAQDPAAQ---------------------QTNTESSSTNNPFSNEFNFR
ARGTA-----PPPPPPPRN---GIILDNSS------QNISNDSMNPDNRFSYVSSFTYSS
LGSS-TQGGFSALSSNSINLG----------------HGLNNSVPNDERGSAQDKTHGFL
R-----EII--
>Skud_14.158
------------------------------------------------------------
-------------------------------MSSNSTIGWDTSSQSGTELLSFSEPNSSP
VSSSTDVLLTSSSTLIPEQGSLTSLPTGSDTYTHTYHSSSSTFDDNM-------------
--------YSSFSGSSTYTLVSSSIDSLSSGQNTESSQYDSTTTSYSIITPSLSML----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------SSAPSTLSTLPMSISSPSTLSPPSTLSSTSS
LTISLSLSSSLLSSSSPSSSPASTYSNSEELSLDSASATFSSSITTAISPSYTALFSIFT
TSSQISMTSQ--------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---TTSISFTPSTTSSDDIRFSNFDQGTSILTDTYSSLPLSATDSSLTDKPSKLNSSDSS
TFSVASKTTTSIPTLISIISSSSA------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------P
SSNRIPSGGTKSTYLSSSASNVTYSSQLMISTSSSDVPLTTSALTTT------------T
VAT----------PSTSTSNPAYNMGP------------------------ISSSGDSKT
IYYF-YTQAYDITGSSTTFATGLPTTIALA----KSAA-TS--FLAPS-STITADMSFYQ
HWLD-GSLD---------NNQNQGTSKSNTGTIVGSVVGGVGGILVCALVVWFILF--KK
RKAKRAFK----------ES----DSFSHEIGRRT-G-FP---------TTAQAKETS--
----------LHAQESGAQ---------------------QGSIENASTSNPFSNEFNFK
ARG-------APPVPLPRN---GMTINNFS------QTMRNDAMNAENRFSYGSSFTYSS
LGSS-TQGGFSTLSSNSIRLG----------------HGLDNNASNDGRSPSQNNPEGFL
R-----EII--
>YNL176C
------------------------------------------------------------
-------------------------------MNSNSTIGRTTLGESDTISLSFSEPSSSL
NSRSTDVVFASTSTLVPQQGSLTSLPPVSSTATPTYYSTSLTYDETL-------------
--------HTSIDVSSTSTLVSSTDSSSSSEQDTYSSQYDPATSSYSIITPSMSIF----
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------------SSTS
PMSSSSSITSEWSSLTSTTPTLSSSATSLSSSWSSLSSPSSLLVSSSLSLSLSSSYSDTK
LFSFDSRSSIFSPSTPTVISP----------SYTYLSSISATSFQISTTSELSSSWFSTI
SSPSTISNKD--------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---TTFPSSSRNTSTSFYSSSLSSTNDFSTISKSSKLSPSASSSTVSISTISVPTSSSVS
SSSSKVPSN---------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------R
PSSSSSSDDTTSAYSSTYTFQSLQSTTSSSIPPTTQTPSTSTISTSP------------I
PTS----------SQVFNTVA------------------------------ISSSEDSKT
IYYF-YTQTYDITDSSTTFVTGLPTTIAVA----KSEV-TS--FSAPS-STITADMSFYQ
HWLD-GSLD---------NNKNQGTSKTNTGTIVGSVVGSVGGILICVLVVWFMLV--RK
RKAKRHFK----------EN----DSFCHEIGRRT-G-FP---------TTAQAKEAS--
----------LQAQDSGSQ---------------------QRNTETASANNPFSNEFNFK
ARGN------PPPVPPPRN---VTAMNGSF------QNMRSNFMDQENRFSYGSSFTYSS
LGSS-TQGGFSTLSSNSIRLG----------------RGLDNDISHDERNTVQNNSQGFL
R-----EII--
>Smik_14.154
------------------------------------------------------------
-------------------------------MSSNSTIGKTISAESDKTSLPFSEPSSSL
ILLSTNVPLTATSTLIPQQGSLSSFAPVSSSFTSIYYSQSLTTDESA-------------
--------YSSSAVSSSDIIASTIISSSSSEQHIETSQYDSTTTSYSIITPSLSIL----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------LSKSSILSTKSTSPSTTSVPISLSSSYSSSSSNSNFE
KFSLDSSSSTSSSLTPTAVSP----------SYTSLSSILTTSSEISVTSKVPSSWSTTF
LSPSTISNED--------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---ATSSSPDRYTSSPIDTSLITSTVDSSITGQPSMLNRSDSSSTVSADSESTISMPKLT
STKTSTSLLSSS------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------S
LSSSPLLDSTKTSHSSPSLANNTYSLISMASTSGSSVPFTTQEVSAT------------L
FST----------SSMPTSSPAYNTGA------------------------LSSSEGSST
IYYF-YTQAYDITGSTTTFVTGLPTTIALA----KSAV-SS--FSVPS-STITADMSFYQ
HWLD-GSLD---------SNQSQGTSKSNTGTIVGSVVGSVGGVLISALVLWFILI--RK
RKAKKTFK----------DA----DLFYHEIGRRT-G-FP---------TTDQAKEAS--
----------IQAQDSGSQ---------------------QANGEIASTNNPFSNEFNFK
ARG-------VPPVPPLRD---TVATNNPS------YNIQNSFMNSENRFSYGSSFTYSS
SGSS-TQNGFSTLSSNSIRLG----------------HGLDNNASMDGGCSVENNSQGFL
R-----EII--
>SAKL0E12760g
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------MIFNTTNLPSSSFLSP--------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------S
LLSLETEPATLSSGDNATTTN--------------------PSYTSTKVIEPSTLWFSSD
EVGT--PTTD--------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---VTQTTDDIATED---------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-TTSPLGFVTLTETLDTTYVEVTTIATTVYTEETYLAISQQETSQVT------------L
GES----------TTQRATHTS-----------------------------ESLLLASSE
TYYV-YTQNYEITASTTTFTTGLPTTLIIP----TSAS-ST--FSIPT-SVITTDAAFYK
NWLS-GSLD----------SDKSYSSRSNKHTIIGATVGSVCGFLLCLLMLWLMFF--RK
RKNKIQAD----------ER-----GFSHEIGRRL-D-SPPEAPEAAEFSPSELTNPKNA
RSVDDEAFLKGKYKMLGKRLPPLPLW--SKKNLNSDENFPVIPEKEEKDVNPFKDEFDFQ
QRL-------PPSPAPPAQ---------------------PHLSHYNNRFSFMSSMSEST
SSS----GEYTESDTSLIELW----------------QQGPQSSAQDQNTRLPHTSQSLL
R-----EVI--
>KLTH0B06908g
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------MLFNATIVSFSSRS----------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----RVGTSSSSTQSSSEKEP----------------------------QTSSSVWSSLE
LSTL--ESTS--------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---TQTIVSTSASIT---------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------A
VEPSATMLTSSDDSITTTTSDTSLPAATSSLPSSS-------------------------
-------------------------------------------------------VPAGK
TAVV-YTRSYVFTASSTTFGTKLPMTTVMA----TKKA-AT--FSAPT-AAVTTDLSFYQ
NWLS-GTLGSTS------SSSSGSLSKTHRNTIIGSVVGSVCGFLLVLGFLWFVLC--RR
RKNR-ASQ----------SR-----SFSHEIGTRL-D-YPVAPP-----RPSQTQVPE--
---DDEAFLKSKYKSLGRK---LPLWHKSESHPTRGGTAEAESAQGEPKGNPFQDEFDFQ
RRLS------RPPAPPP-------------------VPPRDVPN--------LSHFADDS
DASSSSSENSVNDSSSSIQLT--------------------------RPARAARSTQSFL
H-----EVL--
>Kwal_33.14461
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------MQFNATRVTYRSQSRST-------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---IRTSKSSSSSSESASESP-----------------------DGSRTTEFSESTEEPS
VVER--STTD--------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---SIATNATLTQLEPLPTS----------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------T
MSSDSSDQNSSESSENAESEGSTATTSTTSHGATSETASSTSLT----------------
---------------------------------------------------SSASVPSGK
TAIV-YTRSYVFTASTTTFTTALPLTTTLA----TKKA-ST--FSAPT-AAVTTDVSFYQ
SWLS-GTLGST-------SSGQGSMTPGHRNTIIGSVVGGVCGFILAATFIWFLVF--RR
GKRR-ATK----------NQ-----NFSHEIGTRL-E-YPPISP-----STDQPRSPD--
---EDEMFLKSKYKSLGGK---LPLWQGNNTNLQTKEVARGAPQQQKPRGNPFQDEFDFQ
NRRL------PPPPPPPAR-----------------STETPLPRAD---------FYESD
ASSS--SGSSVDDSTSSIQLT--------------------------RPAGAARSTQSFL
Q-----EVL--