MUSCLE (3.8) multiple sequence alignment

AER258C            MGQRASSHVTETTTSR--------WTFTDR--DALIAFFNARALRQLSAVEQWAFHQNIG
TBLA0A06530        MGQKYSSTETL-------------PLPKNP--NTLIK-------EIFTVSELITFQKRI-
KNAG0B04230        MGQSVSSQEPEPTQESD-------PQLGNGTTEEIEQEYNDRVLRQFNASELYTFKCRVG
CAGL0L11616g       MGQTASSPQDNKESKSH-------PQFKTR--DEILQYFNTRVVKLFTVTEIAAFKKRF-
TPHA0H01790        MGQGSSIPEASSGDSNESI-----KDLTSE--LEIVDYFNKRVISQFSNIELLCFKHLL-
Kpol_1016.7        MGQTPSVESQESKETKNEM-----PELKSR--EDILDFFNNRSLSILLPMEIECFKSRL-
Ecym_4764          MGQNASSRSAESVEGR--------LIFRDE--KEILEFFDNQAVRQLHGLELVAFQNNIG
ZYRO0F09966g       MGQRTSQATLQSS-----------THFTSN--SDILKSFNDRALKQFTVTELVSFKNKL-
TDEL0E01940        MGQNASVQQDHAEIGHEK------RQFTSN--SELMEFFDKRAVHMFTATELAAFKSKL-
NCAS0H02050        MGQTPSSNQNEPSHLKEEGKQYKGITFNSE--EELRESFKRRILCHFTPLELVAFKKKI-
NDAI0C01610        MGQHISSAEKPNTKTHNEKE----IQFGNA--LEVQKYFQKRTIGHFTPLELISYKNKL-
Suva_8.171         MGQSSSTPSSNEEKSSNL------RKFTNN--GDVLAYFNHKAQQQVTVPELVSLKGNL-
Skud_15.281        MGQSSSVSSRNEEGSSSS------KKFTNN--RDVLSYFNNKAQQQVTIPELVSFKGNL-
Smik_15.296        MGQSSSISSNNEEGSSHS------RKFAND--RDVLTYFNTKAQRQITVPELVSLKGNL-
YOR118W            MGQSSSISSSNEEGSSHS------KKFTNS--KDILAYFNNKAQQQVTIPELVSFKGNL-
KLLA0E21143g       MGQSTSKEHENARTN---------ESKLKG--ESLMDFFNDRCLKQLTTAELISFKNNIP
SAKL0G02464g       MGQTASSGTGTTGNV---------LQFESQ--HDLLGYFAARATKQFTTPELVAFKSNL-
KLTH0F16126g       MGQNSSNTVSSSQSS---------THFESE--NDLLSWYDKKALKLVSTPELVSYKGNI-
Kwal_55.21437      MGQSTSTVSSNTSAT---------PQFNSE--KDVIIWFDKKAIKSLTSPELVSFKANI-
                   ***  *                            :           .   *    :  . 

AER258C            KNIEPT-----EELDLQALATLYGVPADVPWFT--EVFYTFVCRLTSFPLMNDCS-PP--
TBLA0A06530        -NRSLD-----DIISDKEIIKFSYIPDSKPHLQ--HLYLRFIRNLNKYPSN-----DNII
KNAG0B04230        MTRQLN-----DVVLEQELLEWLCLPLEGHLQQPSKLLVGVIKVLGQFPFISNTG-GNL-
CAGL0L11616g       NAIDLN-----EPIDDTLIKEALYLDAQPNVW---SAVSETIRLLQNFPLFHQPIADSI-
TPHA0H01790        EIDDYS-----TIIDDAVVYKLLQIQDVSDRLR--NLILNFIKRLTNFPFISTVA-DNV-
Kpol_1016.7        GDKDLS-----DPLTKDEFNTLLRIADSNSQLQ--ILLWNFFLKISAFPFLSNRS-ESM-
Ecym_4764          LDADLK-----DYLSCEFLVQLCKLPRHKYGFV--KVFYQMIGNASKFPLMGGGAGEDVP
ZYRO0F09966g       -GKDLN-----ERLTNEELTKWLSVPQDEILLR--ELLYNFVQVLGNFPLMKNSY-ENV-
TDEL0E01940        EGKTLK-----DPVRSEELTRWLRIPCENVLLC--EAVYEFVRVLSNFPLMKDSF-DDV-
NCAS0H02050        GHEQTDSEAGVEYISKNELTNLLHLPRENVLLV--DLTYKLIAILSNFPLLREPQ-TEV-
NDAI0C01610        NHDHLD-----DMITKEEIIQLLHLPDDNVILS--NMIFNMVHSLCNFPFLGERI-WDI-
Suva_8.171         QIEDMN-----TPISHKSLCSVLHFPQKHTLLS--GIVTNMLRVLSNFPLMNSSY-EPI-
Skud_15.281        QIENLN-----TPISHKPLFNVLHFPPNHTIVV--GIVTNMLRVLSNFPLINSSY-EPI-
Smik_15.296        QIENLN-----TPISHKRLCNFLYFPQNHTIIV--GIVTNMLRVLSNFPLVNSSY-EPI-
YOR118W            QIEDLN-----TPISHKALCNSLYFPQNHAMIV--GIVTNMLRVLSNFPLMKSSY-EPI-
KLLA0E21143g       EGKELN-----DYVEVSDISRMYYIPKDSAVML--SVFMNMFHTLANFPLLQDSY-EKV-
SAKL0G02464g       KGKDQN-----DKVSVEEMLQLLKIPLGNELLA--DLLHNCIKTLSNFPLIRESY-DDI-
KLTH0F16126g       DGKPLD-----AALNRKELMRVLRLQNANEAVE--GLLFNCVQTLANFPLIKDCY-ENV-
Kwal_55.21437      NGKDLS-----DVVTSDELLKVLRLDGVNETVS--SLIFNCVQTLSNFPFIRDCY-ENI-
                                :    .     .                .     :*           

AER258C            TYMGLLKVCLLFNKKRAARYTAR--KSYDVASLVLALLAPPRDACDENVD----------
TBLA0A06530        TGYSYLKIITLLNKKRRNKMF----PKIEWIKIIFMCLS---------------------
KNAG0B04230        TAVSLLKAVILINRGKCLKYIGN--KSYNHLELIFMALYLAQDSHDSTKKESYDPKE---
CAGL0L11616g       TGFGLLKVIAIINVKRFEKLVNTTITRYD----ITVTLGLCGQAKESENKIK--------
TPHA0H01790        TAYGLLKTIVILQKQKFIKYTNN--NQLNMLKILFIALGDYDREEDNKKILDCH------
Kpol_1016.7        TGFGILKGIILLTRERIKKYLGW--SNAKLIKLIFIGLTSQEKVGVKTEAS---------
Ecym_4764          TFVGLVKACLLFDYKKLLKYAQC--KTYDQVSLIFILLALEPHAKVSKKELGRPPS----
ZYRO0F09966g       TGIGVLKAIILTNPERCKKYVKS--RNYDQLKLWFIALSIRKTVKEDPNLSSSSSSEE--
TDEL0E01940        TGVGLLKSVLLTNPSKCHKYVGV--KNYDHMKLLFIALSMRKSVKEEPSCSSSTSLED--
NCAS0H02050        TEIGLLMCIILLSKERCHRFIGS--NTYDQLGLIFIAMSLDYADKLLPYARTPK------
NDAI0C01610        TAGNLLTCIILLDNDRCQRFIGS--KSYDQIKLLFILLCLSTNNSSGKPLSASNSKLREK
Suva_8.171         TGYGLLKCILLLNKGRCGKYLKF--KSYDQLKLLFISLSLQKTDKEELSEENENNVKK--
Skud_15.281        TGFGLLKCILLLNRTRCEKFLKI--KSYDQLKLLFISLSLQKTDKEELSEENEENINR--
Smik_15.296        TGYGLLKCIVLLNKSRCEKFLKI--KSYDQLKLLFISLSLQKTDKEELSEDNENNGVK--
YOR118W            TGYGLLKCILLLNRARCAKFLKT--KSYDQLKLLFISLSLQKTDKEELSEESENDGNK--
KLLA0E21143g       TFKTLLKATLLLVKERAIKYTDW--KKYNDLKMLFITLSLEKNIKAEPLMDSSALSD---
SAKL0G02464g       TVAGLLKSCILLSHDRCIKYVGF--KNYDQLKLIYIALALRKTVKELPSSPDPAK-----
KLTH0F16126g       TYMGVLKSCVLLNKNRCLEYVQD--KRYNHTKLVYISLALNKAVKEMSSLPNSND-----
Kwal_55.21437      TYSGLLKSCVLLNKARCLSYVKN--KRYDHTKLVYISLALNKTVKEVSSSSNSQE-----
                   *    :    :    .            .        :                      

AER258C            --------------QFDGDKLIDTLDGT--FIAELEVRPNKLVRYSPFIAQISQVCNGSN
TBLA0A06530        ----------------DEEVQFPCWE----TTHDIHVLENDLIEFISLLLTLNMNCCTDY
KNAG0B04230        --------------PHNIEKVISSYDGNSDCVSEITVQADNLLQFTTMLLLLSARIPRPN
CAGL0L11616g       --------------STNLGDILKTYDHI--EIESIHIPYDKLILLVAWLLTLVTGVATTN
TPHA0H01790        --------------NISISTILTTYDGI--PIHDISVSSSNMISFLTWILALSNVCPTNN
Kpol_1016.7        --------------VFKIQHVLDTLDGI--DLASSTVKDTDMLSFITWLLLLSVHCPTSN
Ecym_4764          --------------SYDARKIMESFNDI--NLETIEVSADDLLQFMTFLLVITKYCIFEN
ZYRO0F09966g       --------------SFDVTRILKTFDGL--HVNELSVPFAYMVPFISWLLILTTYCPINN
TDEL0E01940        --------------GGGSINLLRTYNNI--VVDDLAIPATSLVQLLAWLLILTSYCPTSN
NCAS0H02050        --------------KLNVEELLRTFDNI--PIDELEIPAPVLLQFLSWGLLLLIKCPTSN
NDAI0C01610        SENISTTSIYSQEIGYNLTDILQSYNGI--SIDDLSVPALSLSECFTWTLIMSIKCPTAN
Suva_8.171         --------------ERNIKQIIANFDDV--DSEVLYVPADFMLQFLSWLLILSVECPTSN
Skud_15.281        --------------ERHVKQIITDFDDV--DTEMLCLPADFMLQFLSWLLILSVKFPTTN
Smik_15.296        --------------EKNIKQIITGFDDV--DTEVLYLPADFMLQFLTWLLILSVECPTTN
YOR118W            --------------ELTIKQIITGFDDV--DTEMLCIPADFMLQFLTWLLILTVDCPTTN
KLLA0E21143g       --------------CKDWKGVIRSYNGT--DFDELKVNANNLLHFLALILALSRCCILNN
SAKL0G02464g       --------------PWDAKSIIRNYNSV--DIDDLYVPADSMLQLLTLSLVLSRHCTVNN
KLTH0F16126g       --------------SLDAPKVIATFNNV--AEEELVVPAETMLEFLTLMLTMSKATVIKN
Kwal_55.21437      --------------SLDAPRIIATFNSV--CVEELTVPSEVMLEFITLMLKMSKSTIIKN
                                        :   :          :    :    .    :        

AER258C            EPLSR--SMFP--AWNRN-NQIPLALLRSLDSTIVSRSDARSRSITYQQFAGGLRSVFPN
TBLA0A06530        CLINQ-DLTFNDHDWDTYWRKSASCIVRDMKEC------------NVEEFENVL-LIVPN
KNAG0B04230        SQIDL-KTADN--DWAKY-EKSAYNVIRTMNSSIISSCQT--HTISFHQFYDVISILLPT
CAGL0L11616g       CKVEL-SDTIA--NWNNF-KSSAISIANTISTSALGNAND--IGIPATDILNAFNTIMIS
TPHA0H01790        SIVDT-KHMFK--YWEKY-ETSAISLVRSMNPDIIKPDDN--QNILFIQFKTALETIMPH
Kpol_1016.7        CKLNE-KSLYD--KWKDY-EIVASSMVRSMNKKITTTGKG--IGISYSDFSHTIVAVSKN
Ecym_4764          VEVNP--SIYE--NWKDY-ESQALNILRTMNPCIVSYSDAAKNVVTLAQFKDCITAVCPN
ZYRO0F09966g       CKLEN-VAMFD--NWNSY-IKSAHTILRSMRP----MDES--SWIEYEPFAHTMRSIAPH
TDEL0E01940        CQFPE-DVVYA--EWGSF-KLAATNLLRTMNNNIVTNLES--YSVKFEQFSKAISTVMPN
NCAS0H02050        CQLKPINEFYQ--NWSSY-EKAAKNIIRSMDQSIIRNLTD--VRINYTQFSDVFKAVLPN
NDAI0C01610        CKILPNETIYN--SWNEY-QKASLNILRSMDSSIVSNLDD--YRISFTQFENVFTSVVPN
Suva_8.171         SKMGN-SKIYD--QWDSF-KISAMNLLRTMNPDVVSNTES--HLITFDQFSTSIRTVMPN
Skud_15.281        SKTDN-DKTYE--QWDTF-KISAMNLLRTMNPDVVSNVES--HFITFEQFSTAIRTVMPN
Smik_15.296        STINN--ETNV--QWDKF-KIPAMNLLRTMNPDVVNNIES--HFITYQQFSTAIRTVMPN
YOR118W            SKLDN-TETHD--QWGNF-KVSALNLLRTMNPDVVGDIES--HSITFQQFSTAIRTVMPN
KLLA0E21143g       CKIDN-DVLAK--SLEDF-KHQALNIVRTMNPEIISMSDCLDSSITYTQFSMAVNDVAPN
SAKL0G02464g       AKIRE--SVFQ--HWDDY-KANAMNLLRTMNPDIVNTQDTVQCVISFEQFSNAIAAVFPQ
KLTH0F16126g       SRLDV--NISE--KWDSF-KTCALSILRTMNTDILTSQDALKNVISYTQFQNVISSVCPN
Kwal_55.21437      SKLDP--NVSE--GWESF-RPFALSILRTMNTNIATQNDLLKYGITFSQFQSTISTVCPN
                                         .  : . :                   :   .  :   

AER258C            VFDALGLFLERLFYVKRDTTNKLL-YTPTKETSTIVTNLLLTQLSTLYP-RINLFTSMQR
TBLA0A06530        IFDCLKNLIEHSLYTKDQLKECP--LGPSQFTKTKMNQAILCQILLSMRKRSM---DISK
KNAG0B04230        ILTTLDNLLQHLLYTPDQLVDHTA-LGPTFTETKVMNHGSFALLQFALADKGYPISKLQK
CAGL0L11616g       LVPYMSNLFEHLLFGVDDLIDHVN-DLANLSHQDVLTPSLYAQVIIGLP-NSITITKLQK
TPHA0H01790        VYLPLEHLLNHLLFMESSLIKSQE-IEISFQESKLMTFAVASQLSTLLR-NDVVISKLHK
Kpol_1016.7        VMSPLENIVEHMLYKQDDLLEFPC-LDTFLKETKLMTYPLVAQLCTVLP-NEIVMSQLQK
Ecym_4764          LLTPLGVFMKHVLYKSEHLVSDSG-ATINDRSSTVMTDPLLAQLCTLWP-KHIIYQNLKK
ZYRO0F09966g       IFDPLTRVMEHLLFKDDELVDPLSENRGEIASSKLLNSALLAQISSALS-KQLPIYHLQR
TDEL0E01940        IFRALQNVMEHLLYQDSDLVSFPSNSAGPILTSKPTTQAVLAQLITALS-NEMTFAKFQN
NCAS0H02050        FTTPLESLMGHLLYMDSDLIDHET---MPMNNSKLMSEPLLAQLATVLP-KELFLSKLQK
NDAI0C01610        FTHPLENIMNHLLYMDKDLINHPV---MEIPKSKLMSESLLAQLSTTLP-KELFISKLQK
Suva_8.171         LLKPLENLMEHFFYLENDLVNYDT-SLSSVRDSRIMTPALLTQLSTVLP-RELFIQKLQS
Skud_15.281        LFKPLENLMEHFFYLDNDLVSRDA-NLSSIQDSRIMTPALLAQLSTGLP-KELFIQKLQS
Smik_15.296        LLKPLENLMEHFLYLQHDLVDYDT-NLSSIQDSKIMTPALLAQLSTGLP-KELFIQKLQS
YOR118W            LLKPLENLMEHFFYLQHDLVDHDT-NLSSIQDSKVMTPALLAQLSTGLP-KELFIHKLQS
KLLA0E21143g       LLNPLKMLMEHVLYMDRDLVDADV-LQPISNPTKIVNESELSQLATFLP-KEIVFSRFQK
SAKL0G02464g       VLKPLEILVEHMLYLDRDLTDELN-STSMPSTSKLVTEPLLAQLSTMLP-KELVYSKLRK
KLTH0F16126g       LLVPLECLMEHVLFLNRDLVDLEA-SKPLIPQSKLVTEPLLAQLATVWP-RELVFSRLQK
Kwal_55.21437      LLLPFESLMEHVLFLGRDLVDIDA-SQPPLLESKLVSEPLLAQLATVWP-RELVFSRLQK
                   .   :  .. . ::      .               .      :      .      :  

AER258C            LFVAGDAGFSMSVFQAKVFKWMAPTILFVSGTRIQDDE------IVCTKNKRYKAFLQDY
TBLA0A06530        LYIGRENGYSMRSFQSKVFKWKAPTILLITGKKIINDQE-----YS-EKNNRYKSFLNSY
KNAG0B04230        LYVGRDSGFSMRSFQGKVFHWHAPTLLFVSGSRIQDDDD-----YSKNKNPRYSKFLEDF
CAGL0L11616g       LYVGKESGFSMRSLQSKVFRWKAPTLMIVSGTRISDDES-----YADSKNPRYRSFLYSF
TPHA0H01790        LYSGRESGFSMRSFQSKAFKWNAPTILLISGMRVTDDVE-----YATKKNPRYKKFIDQY
Kpol_1016.7        LYVGRESGYSMRSLQSKVFNWKAATILLVSGTRIVDDIE-----YSENKNPRYKRFLEEY
Ecym_4764          LFIAKQSGFSIRSFQAKVVNWMAPSILLVSGMKIMDDSK------LLAKNQRYKSFLQEY
ZYRO0F09966g       LYLGRDHGFSMRSFQAKVFKWSAPTIMLLRGKRILDDEE-----YS-VKNTRFRKFLHEY
TDEL0E01940        LYVGRESGFSMRSLQAKVFKWMAPTVMLLSGKCVLDDED-----FS-KKNSRYRDFLSKY
NCAS0H02050        LYVGRESGFSMRSLQSKCFNWEAPSILLVSGMLISDDLQ-----YAKEKNPRYGKFLEQY
NDAI0C01610        LYIGRQSGFSMRSLQSKCFKWLAPTILLVSGLIIPNDEE-----Y---NNPRFKRFLQEF
Suva_8.171         LYIGRKSGFSMRSLQAKVFKWMAPSILIVSGTRITNSDE-----YAAQKNPRYRHFLEEF
Skud_15.281        LYIGRKSGFSMRSLQAKVFKWMAPSILVVSGMRITNSDE-----YAAEKNPRYRHFLDEF
Smik_15.296        LYIGRKSGFSMRSLQAKVFKWMAPSILVVSGVRITNSEE-----YAANKNPRYRHFLEEF
YOR118W            LYIGRKSGFSMRSLQAKVFKWMAPSILVVSGMRITNSEE-----YAAEKNPRYRHFLEEF
KLLA0E21143g       LYVGRESGFSMRSFQSKVFKWMAPTILFVEGMRIRDEDDEDGDAYA-VKNPRYRNFLQEY
SAKL0G02464g       LYVGRESGFSMRSFQSKAFKWMAPSILLIGGMRITDDQE-----YATTKNPRYKKFLEEY
KLTH0F16126g       LYVGRDSGFSMRSFQAKAFKWMAPSILLVQGSRIPDDQD-----YAKNKNQRYKKFLDEY
Kwal_55.21437      LYVGRDSGFSMRSFQAKAFKWMAPSILLIHGVRIPNDEE-----YAKSKNHRYKNFLEEY
                   *: . . *:*:  :*.* ..* *.:::.: *  : :.           :* *:  *: .:

AER258C            PALK--DAEQQ-LALCDRKKRNLIYAIFVRDPWKITNKDLFGDMDTTIIQLAPRQKIFKA
TBLA0A06530        PRLK--DGKTTFQTPLH-----YTFAIYIEEPWKMT-KGYFGGLHTKIIQLSPRQDVFTC
KNAG0B04230        RKLR--DTDQQ-LSPCLLKKRKVMFVIYIESPWRVTNKDYFSAGRTTIFQLSPELDIFKA
CAGL0L11616g       PKLR--ENDQN-LDAIHLTKKKVTYAVYIDEPWKVSNKEKFGATNMTIMELTPQQKTYQS
TPHA0H01790        PRLR--DLDQN-LEPCHSKLRKVTFAVYVDEPWKVSNKLQFGGLKTLIVELSPRQDCFRA
Kpol_1016.7        PKLK--DEDQE-MDDCHNLKKKVTFAVYIDEPWRVTNKNYFGEKRTSIIELSPRQDKFNS
Ecym_4764          PKLK--DEDQK-ADSIVGGKRKVTFAVFVHEAWKVTNKEQFGNLKTLILQLSPRQEVFQA
ZYRO0F09966g       PKLKPSDMDTE-VEEMYPAKSKIILAVYVSDPWKITNKEFFGGPHTTIVQLSPFQEVFGS
TDEL0E01940        PKLK--DRDQH-LSDLQKNKTKVVFAVYIPEPWKTTNKDYFGGSGTTIVQLSPTQDVFKA
NCAS0H02050        PKLK--EEQQH-LDACHSQRKKATFAVYIDDPWRVTNKEFFGSMNSMIIQLAPRQDVFHA
NDAI0C01610        PKLN--DNEQS-LEPCHSYKKKISFAVYIDEPWRVTNKEFFGDLNSRIIELSPRQDIFKS
Suva_8.171         PKLK--DSDQK-MDASYTNKKKTTFAVYIDDPWKVTNKDYFGDMNTRIIQISPRQDIYKV
Skud_15.281        PKLK--DSDQK-MDASHLSKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPRQDIYKV
Smik_15.296        PILK--DSDQK-MDASLMNKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPRQDIYKV
YOR118W            PKLK--ESDQM-MDASHLNKRKTTFAVYIDDPWKVTNKDYFGDLNTRIIEISPRQDIYKV
KLLA0E21143g       GKLK--SEDQH-LDTLSKKKRKLLFAVCIRDPWKVSNKDLFGDSSTKIIQLHPRQEIFDA
SAKL0G02464g       PRLK--DKDQHIIDPCSLNRRKLLFAVYVNEPWKVTNKELFGDLKTTVVQLSPKQELFKA
KLTH0F16126g       PRLK--DEDQH-ILPALSGKRKLLFAILINEPWKVTNSELFGDIKTTIVQLSPIQEVYKA
Kwal_55.21437      PRLK--EEDQV-LLPPFSGKKKLLFAVYVNVPWKVTNSELFGDLKTTIIQLSPIQEVYKA
                     *.  . .                .: :  .*. : .  *.     :.:: *  . :  

AER258C            Q--EAPNI-YFNAVGGGIGFGSSQPSVKP--AGKRYFPGNVSFTVDPSMEFAVFRNVGDG
TBLA0A06530        T--DPNAV-YFHT-QNGIGIGNEH---MS--SDNKYKPGNVSITIDSTLEFAVFRHSGP-
KNAG0B04230        N--RDDVV-YFNTMGGGIGIGDTQPYTKV--NYREYRPGNISLTLDSSLEFGAFRNVGPG
CAGL0L11616g       C--MERTM-YFNTIGGGIGVGSEQPIVKQ--NDIKFIPGNISLTMDSSLEFGVFRHVGAG
TPHA0H01790        A--KPGVI-YFNTVGGGIGIGSSQPVQKK--NSLSYTPGNVSLTIDNSLEFGAFRHTGYG
Kpol_1016.7        L--KVGSV-YFNTIGGGIGIGNNQPVTKL--NSVRYAPGNVSLTLDNTLEFGVFRHTGYG
Ecym_4764          S--KNGNI-YFNTVGGGIGIGNSQPVIKS--SGKKYFPGNVSLTIDPSFEFGVFRNVGHG
ZYRO0F09966g       S--RENAL-YFNTIGGGIGIGNKQPVIKS--TAKSYSPGNVSLTMDSALEFAVLRHAGQG
TDEL0E01940        A--SNEVM-YFNTLGGGIGIGNNQPHIKN--GVKSYSPGNVSLTIDSTLEFAAFRHVGYG
NCAS0H02050        S--KPNMI-YFNTVGGGIGFGNKQPLISN--AHKKYIPGNVSLTIDSTLEFAVFRHIGYG
NDAI0C01610        L--KSHELIYFNTIGCGIGIGDKQPHVSNGANSRKYQPGNVSLTLESTLEFAVFRHVGHG
Suva_8.171         N--RKGTI-YFNTIGGGIGIGDKQPLIKP--ASKRFIPGNVSLTFDSTLEFAVFRHTGYG
Skud_15.281        N--QKGTI-YFNTIGGGIGIGDKQPFIKA--ASKRYIPGNVSLTFDSTLEFAVFRHTGYG
Smik_15.296        N--KKGTV-YFNTIGGGIGIGNKQPLIKS--ASKRYVPGNVSLTFDSTLEFAVFRNTGYG
YOR118W            N--QKGTI-YFNTIGGGIGIGDKQPLIKP--ASKRYIPGNVSLTFDSTLEFAVFRNTGYG
KLLA0E21143g       DPFKTGNV-YFNTVGGGIGIGSSQPIIKA--NGKKYFPGNVSLTIDSSLEFGIFRHLGAG
SAKL0G02464g       V--RTGNV-YFNTLGGGIGVGCAQPVIKP--NGKKYFPGNVSLTIDSSLEFASFRHVGYG
KLTH0F16126g       S--KPGNV-YFNTLGGGIGIGSPQPIIKS--SGVKFVPGNVSLTIDPNLEFAAFRNVGFG
Kwal_55.21437      S--RPGNI-YFNTLGGGIGVGSPQPIVKP--TSRKYLPGNVSLTIDPNLEFAVFRSAGFG
                          : **::   ***.*  :           : ***:*:*.:  :**. :*  *  

AER258C            GMFSHGSAVPAPAEQ----PLSYEHRLMIKDLEVWGYGGEEELQKQIQRWQWEEAEATKR
TBLA0A06530        GVFKTGIIAN---------QEIFEIRLHIQSVEVWGCGGAKELAEQKHEWEWEEREAQRR
KNAG0B04230        GMFEPGALFTRRNGDGVVTSNSYELRFLIQDVEVWGCGGEKELSEQMKQLQWEETEAKRR
CAGL0L11616g       GGFKTSLL---DNDD----SKSFEIRFIIQNVEVWGCGGEKELAEQLKQLEWEEAEAKRR
TPHA0H01790        GSIEPSSILQKKEDA----TRTFEIRFLIQDIEVWGCGGEKEIDEQLKQWAWEEEEAKKR
Kpol_1016.7        GTIGPSELLKKNNEE----NKAFEIRFLIRDVEVWGCGGEKELEEQLREWKWEEAEAKRR
Ecym_4764          GSISPGKLFLERPDV----EQSLECRFIIQDVEVWGCGGDKEFEAQLKQWEWEEAESERR
ZYRO0F09966g       GVLKPGLVVG---------DKDFEVKMLLQDVEVWGCGGEKELEEQLKQWEWEESEAKRR
TDEL0E01940        GTFNPGLLLTQFNRE----DDPFEIKFLIQDVEVWGCGGKEELEEQYKKWQWEEAEAKRR
NCAS0H02050        GAFKPSALLTKRGKE----DESFEIKFIIQDVEVWGCGGEKELQEQIKKLEWEEAEAKRR
NDAI0C01610        GAFSPSELLTKRGTE----EESFEIKFIIQDVEVWGCGGEKELEEQMKQLAWEEAEAKRR
Suva_8.171         GSLEPGSLSVERKEE----DSFFELHFLIQDVEVWGCGGEKELEEQMKQMAWEEAESKRR
Skud_15.281        GLLDPGLLSMERKEE----NSFFELHFLIQDVEVWGCGGEKELEEQIKQMAWEEAESKRR
Smik_15.296        GSLDPGLLSMERKEE----NSSFELHILIQDVEVWGCGGEKELEEQIKQLAWEEAESKRR
YOR118W            GSLDPGLLSMERKEE----NSPYELHFLIQDVEVWGCGGEKELEEQIKQLEWEEAESKRR
KLLA0E21143g       GSFKPGRLISGRGEE----RNSFEYRFIIQDVEVWGCGGEKELEEQVKQWQWEEAEAKRR
SAKL0G02464g       GAISPGTLMTKLEEE----KTTFEYKFIVQDVEVWGCGGEKELQEQIKQWEWEEAEAKRR
KLTH0F16126g       GSIAPSN------------TPTSEHKFLIQDIETWGCGGEKELEEQMKNWEWEEAEAQRR
Kwal_55.21437      GSIKPSS------------TIVNEHKFLIQDIEAWGCGGEKELEEQMKNWEWEEAEAQRR
                   * :  .                 * .: :..:*.** ** :*:  * .   *** *: .*

AER258C            KYIKTNGGNEDRALLEMAGIVGHY-QSGGSV
TBLA0A06530        QHVSMH-VTEDRALLELAGIIGER-----PV
KNAG0B04230        QHVNLKSLSEDRALLEMAGLVGQH-QSGGSI
CAGL0L11616g       QTINLQSLSEDKALLEMVGLVGQH-QSGGSV
TPHA0H01790        QRVNLKSMGEDRALLEMAGIIGNHAHSGGSL
Kpol_1016.7        QEINLKTMGEDRALLEMAGIIGQHGQSGGSI
Ecym_4764          QYINLSSIGEDKALLEMVGLVGHH-QSGGSL
ZYRO0F09966g       QQINLRSIGEDRALLEMAGLVGQA-QSGGSV
TDEL0E01940        QNINLRSFGEDRALLEMAGLVGHS-QNGGSM
NCAS0H02050        QHINLKSLGEDRALLEMAGLVGQS-QSGGSM
NDAI0C01610        QQVNLKSISEDRALLEMVGLVGQH-QSGGSM
Suva_8.171         QQINLRSLGEDRALLEMAGLVGQN-RGGGSM
Skud_15.281        QQINFRSLGEDRALLEMAGIIGQH-QGGGSM
Smik_15.296        QQINLRSLGEDRALLEMAGLVGQH-QGGGSM
YOR118W            QQINLRSLGEDRALLEMAGLVGQH-QGGGSM
KLLA0E21143g       QKINLQSMGEDRALLEMAGLVGQH-QSGGSI
SAKL0G02464g       QRINLQSIGEDRALLEMAGLVGQH-QSGGSM
KLTH0F16126g       QRINLKSVNDDRALLELAGLVGQN-QSGGSV
Kwal_55.21437      QRINLKSINDDRALLEMAGLVGQN-QSGGSI
                   : :.     :*.****:.*::*       .:

FASTA FORMAT for MUSCLE Version 3.6

>AER258C
MGQRASSHVTETTTSR--------WTFTDR--DALIAFFNARALRQLSAVEQWAFHQNIG
KNIEPT-----EELDLQALATLYGVPADVPWFT--EVFYTFVCRLTSFPLMNDCS-PP--
TYMGLLKVCLLFNKKRAARYTAR--KSYDVASLVLALLAPPRDACDENVD----------
--------------QFDGDKLIDTLDGT--FIAELEVRPNKLVRYSPFIAQISQVCNGSN
EPLSR--SMFP--AWNRN-NQIPLALLRSLDSTIVSRSDARSRSITYQQFAGGLRSVFPN
VFDALGLFLERLFYVKRDTTNKLL-YTPTKETSTIVTNLLLTQLSTLYP-RINLFTSMQR
LFVAGDAGFSMSVFQAKVFKWMAPTILFVSGTRIQDDE------IVCTKNKRYKAFLQDY
PALK--DAEQQ-LALCDRKKRNLIYAIFVRDPWKITNKDLFGDMDTTIIQLAPRQKIFKA
Q--EAPNI-YFNAVGGGIGFGSSQPSVKP--AGKRYFPGNVSFTVDPSMEFAVFRNVGDG
GMFSHGSAVPAPAEQ----PLSYEHRLMIKDLEVWGYGGEEELQKQIQRWQWEEAEATKR
KYIKTNGGNEDRALLEMAGIVGHY-QSGGSV
>TBLA0A06530
MGQKYSSTETL-------------PLPKNP--NTLIK-------EIFTVSELITFQKRI-
-NRSLD-----DIISDKEIIKFSYIPDSKPHLQ--HLYLRFIRNLNKYPSN-----DNII
TGYSYLKIITLLNKKRRNKMF----PKIEWIKIIFMCLS---------------------
----------------DEEVQFPCWE----TTHDIHVLENDLIEFISLLLTLNMNCCTDY
CLINQ-DLTFNDHDWDTYWRKSASCIVRDMKEC------------NVEEFENVL-LIVPN
IFDCLKNLIEHSLYTKDQLKECP--LGPSQFTKTKMNQAILCQILLSMRKRSM---DISK
LYIGRENGYSMRSFQSKVFKWKAPTILLITGKKIINDQE-----YS-EKNNRYKSFLNSY
PRLK--DGKTTFQTPLH-----YTFAIYIEEPWKMT-KGYFGGLHTKIIQLSPRQDVFTC
T--DPNAV-YFHT-QNGIGIGNEH---MS--SDNKYKPGNVSITIDSTLEFAVFRHSGP-
GVFKTGIIAN---------QEIFEIRLHIQSVEVWGCGGAKELAEQKHEWEWEEREAQRR
QHVSMH-VTEDRALLELAGIIGER-----PV
>KNAG0B04230
MGQSVSSQEPEPTQESD-------PQLGNGTTEEIEQEYNDRVLRQFNASELYTFKCRVG
MTRQLN-----DVVLEQELLEWLCLPLEGHLQQPSKLLVGVIKVLGQFPFISNTG-GNL-
TAVSLLKAVILINRGKCLKYIGN--KSYNHLELIFMALYLAQDSHDSTKKESYDPKE---
--------------PHNIEKVISSYDGNSDCVSEITVQADNLLQFTTMLLLLSARIPRPN
SQIDL-KTADN--DWAKY-EKSAYNVIRTMNSSIISSCQT--HTISFHQFYDVISILLPT
ILTTLDNLLQHLLYTPDQLVDHTA-LGPTFTETKVMNHGSFALLQFALADKGYPISKLQK
LYVGRDSGFSMRSFQGKVFHWHAPTLLFVSGSRIQDDDD-----YSKNKNPRYSKFLEDF
RKLR--DTDQQ-LSPCLLKKRKVMFVIYIESPWRVTNKDYFSAGRTTIFQLSPELDIFKA
N--RDDVV-YFNTMGGGIGIGDTQPYTKV--NYREYRPGNISLTLDSSLEFGAFRNVGPG
GMFEPGALFTRRNGDGVVTSNSYELRFLIQDVEVWGCGGEKELSEQMKQLQWEETEAKRR
QHVNLKSLSEDRALLEMAGLVGQH-QSGGSI
>CAGL0L11616g
MGQTASSPQDNKESKSH-------PQFKTR--DEILQYFNTRVVKLFTVTEIAAFKKRF-
NAIDLN-----EPIDDTLIKEALYLDAQPNVW---SAVSETIRLLQNFPLFHQPIADSI-
TGFGLLKVIAIINVKRFEKLVNTTITRYD----ITVTLGLCGQAKESENKIK--------
--------------STNLGDILKTYDHI--EIESIHIPYDKLILLVAWLLTLVTGVATTN
CKVEL-SDTIA--NWNNF-KSSAISIANTISTSALGNAND--IGIPATDILNAFNTIMIS
LVPYMSNLFEHLLFGVDDLIDHVN-DLANLSHQDVLTPSLYAQVIIGLP-NSITITKLQK
LYVGKESGFSMRSLQSKVFRWKAPTLMIVSGTRISDDES-----YADSKNPRYRSFLYSF
PKLR--ENDQN-LDAIHLTKKKVTYAVYIDEPWKVSNKEKFGATNMTIMELTPQQKTYQS
C--MERTM-YFNTIGGGIGVGSEQPIVKQ--NDIKFIPGNISLTMDSSLEFGVFRHVGAG
GGFKTSLL---DNDD----SKSFEIRFIIQNVEVWGCGGEKELAEQLKQLEWEEAEAKRR
QTINLQSLSEDKALLEMVGLVGQH-QSGGSV
>TPHA0H01790
MGQGSSIPEASSGDSNESI-----KDLTSE--LEIVDYFNKRVISQFSNIELLCFKHLL-
EIDDYS-----TIIDDAVVYKLLQIQDVSDRLR--NLILNFIKRLTNFPFISTVA-DNV-
TAYGLLKTIVILQKQKFIKYTNN--NQLNMLKILFIALGDYDREEDNKKILDCH------
--------------NISISTILTTYDGI--PIHDISVSSSNMISFLTWILALSNVCPTNN
SIVDT-KHMFK--YWEKY-ETSAISLVRSMNPDIIKPDDN--QNILFIQFKTALETIMPH
VYLPLEHLLNHLLFMESSLIKSQE-IEISFQESKLMTFAVASQLSTLLR-NDVVISKLHK
LYSGRESGFSMRSFQSKAFKWNAPTILLISGMRVTDDVE-----YATKKNPRYKKFIDQY
PRLR--DLDQN-LEPCHSKLRKVTFAVYVDEPWKVSNKLQFGGLKTLIVELSPRQDCFRA
A--KPGVI-YFNTVGGGIGIGSSQPVQKK--NSLSYTPGNVSLTIDNSLEFGAFRHTGYG
GSIEPSSILQKKEDA----TRTFEIRFLIQDIEVWGCGGEKEIDEQLKQWAWEEEEAKKR
QRVNLKSMGEDRALLEMAGIIGNHAHSGGSL
>Kpol_1016.7
MGQTPSVESQESKETKNEM-----PELKSR--EDILDFFNNRSLSILLPMEIECFKSRL-
GDKDLS-----DPLTKDEFNTLLRIADSNSQLQ--ILLWNFFLKISAFPFLSNRS-ESM-
TGFGILKGIILLTRERIKKYLGW--SNAKLIKLIFIGLTSQEKVGVKTEAS---------
--------------VFKIQHVLDTLDGI--DLASSTVKDTDMLSFITWLLLLSVHCPTSN
CKLNE-KSLYD--KWKDY-EIVASSMVRSMNKKITTTGKG--IGISYSDFSHTIVAVSKN
VMSPLENIVEHMLYKQDDLLEFPC-LDTFLKETKLMTYPLVAQLCTVLP-NEIVMSQLQK
LYVGRESGYSMRSLQSKVFNWKAATILLVSGTRIVDDIE-----YSENKNPRYKRFLEEY
PKLK--DEDQE-MDDCHNLKKKVTFAVYIDEPWRVTNKNYFGEKRTSIIELSPRQDKFNS
L--KVGSV-YFNTIGGGIGIGNNQPVTKL--NSVRYAPGNVSLTLDNTLEFGVFRHTGYG
GTIGPSELLKKNNEE----NKAFEIRFLIRDVEVWGCGGEKELEEQLREWKWEEAEAKRR
QEINLKTMGEDRALLEMAGIIGQHGQSGGSI
>Ecym_4764
MGQNASSRSAESVEGR--------LIFRDE--KEILEFFDNQAVRQLHGLELVAFQNNIG
LDADLK-----DYLSCEFLVQLCKLPRHKYGFV--KVFYQMIGNASKFPLMGGGAGEDVP
TFVGLVKACLLFDYKKLLKYAQC--KTYDQVSLIFILLALEPHAKVSKKELGRPPS----
--------------SYDARKIMESFNDI--NLETIEVSADDLLQFMTFLLVITKYCIFEN
VEVNP--SIYE--NWKDY-ESQALNILRTMNPCIVSYSDAAKNVVTLAQFKDCITAVCPN
LLTPLGVFMKHVLYKSEHLVSDSG-ATINDRSSTVMTDPLLAQLCTLWP-KHIIYQNLKK
LFIAKQSGFSIRSFQAKVVNWMAPSILLVSGMKIMDDSK------LLAKNQRYKSFLQEY
PKLK--DEDQK-ADSIVGGKRKVTFAVFVHEAWKVTNKEQFGNLKTLILQLSPRQEVFQA
S--KNGNI-YFNTVGGGIGIGNSQPVIKS--SGKKYFPGNVSLTIDPSFEFGVFRNVGHG
GSISPGKLFLERPDV----EQSLECRFIIQDVEVWGCGGDKEFEAQLKQWEWEEAESERR
QYINLSSIGEDKALLEMVGLVGHH-QSGGSL
>ZYRO0F09966g
MGQRTSQATLQSS-----------THFTSN--SDILKSFNDRALKQFTVTELVSFKNKL-
-GKDLN-----ERLTNEELTKWLSVPQDEILLR--ELLYNFVQVLGNFPLMKNSY-ENV-
TGIGVLKAIILTNPERCKKYVKS--RNYDQLKLWFIALSIRKTVKEDPNLSSSSSSEE--
--------------SFDVTRILKTFDGL--HVNELSVPFAYMVPFISWLLILTTYCPINN
CKLEN-VAMFD--NWNSY-IKSAHTILRSMRP----MDES--SWIEYEPFAHTMRSIAPH
IFDPLTRVMEHLLFKDDELVDPLSENRGEIASSKLLNSALLAQISSALS-KQLPIYHLQR
LYLGRDHGFSMRSFQAKVFKWSAPTIMLLRGKRILDDEE-----YS-VKNTRFRKFLHEY
PKLKPSDMDTE-VEEMYPAKSKIILAVYVSDPWKITNKEFFGGPHTTIVQLSPFQEVFGS
S--RENAL-YFNTIGGGIGIGNKQPVIKS--TAKSYSPGNVSLTMDSALEFAVLRHAGQG
GVLKPGLVVG---------DKDFEVKMLLQDVEVWGCGGEKELEEQLKQWEWEESEAKRR
QQINLRSIGEDRALLEMAGLVGQA-QSGGSV
>TDEL0E01940
MGQNASVQQDHAEIGHEK------RQFTSN--SELMEFFDKRAVHMFTATELAAFKSKL-
EGKTLK-----DPVRSEELTRWLRIPCENVLLC--EAVYEFVRVLSNFPLMKDSF-DDV-
TGVGLLKSVLLTNPSKCHKYVGV--KNYDHMKLLFIALSMRKSVKEEPSCSSSTSLED--
--------------GGGSINLLRTYNNI--VVDDLAIPATSLVQLLAWLLILTSYCPTSN
CQFPE-DVVYA--EWGSF-KLAATNLLRTMNNNIVTNLES--YSVKFEQFSKAISTVMPN
IFRALQNVMEHLLYQDSDLVSFPSNSAGPILTSKPTTQAVLAQLITALS-NEMTFAKFQN
LYVGRESGFSMRSLQAKVFKWMAPTVMLLSGKCVLDDED-----FS-KKNSRYRDFLSKY
PKLK--DRDQH-LSDLQKNKTKVVFAVYIPEPWKTTNKDYFGGSGTTIVQLSPTQDVFKA
A--SNEVM-YFNTLGGGIGIGNNQPHIKN--GVKSYSPGNVSLTIDSTLEFAAFRHVGYG
GTFNPGLLLTQFNRE----DDPFEIKFLIQDVEVWGCGGKEELEEQYKKWQWEEAEAKRR
QNINLRSFGEDRALLEMAGLVGHS-QNGGSM
>NCAS0H02050
MGQTPSSNQNEPSHLKEEGKQYKGITFNSE--EELRESFKRRILCHFTPLELVAFKKKI-
GHEQTDSEAGVEYISKNELTNLLHLPRENVLLV--DLTYKLIAILSNFPLLREPQ-TEV-
TEIGLLMCIILLSKERCHRFIGS--NTYDQLGLIFIAMSLDYADKLLPYARTPK------
--------------KLNVEELLRTFDNI--PIDELEIPAPVLLQFLSWGLLLLIKCPTSN
CQLKPINEFYQ--NWSSY-EKAAKNIIRSMDQSIIRNLTD--VRINYTQFSDVFKAVLPN
FTTPLESLMGHLLYMDSDLIDHET---MPMNNSKLMSEPLLAQLATVLP-KELFLSKLQK
LYVGRESGFSMRSLQSKCFNWEAPSILLVSGMLISDDLQ-----YAKEKNPRYGKFLEQY
PKLK--EEQQH-LDACHSQRKKATFAVYIDDPWRVTNKEFFGSMNSMIIQLAPRQDVFHA
S--KPNMI-YFNTVGGGIGFGNKQPLISN--AHKKYIPGNVSLTIDSTLEFAVFRHIGYG
GAFKPSALLTKRGKE----DESFEIKFIIQDVEVWGCGGEKELQEQIKKLEWEEAEAKRR
QHINLKSLGEDRALLEMAGLVGQS-QSGGSM
>NDAI0C01610
MGQHISSAEKPNTKTHNEKE----IQFGNA--LEVQKYFQKRTIGHFTPLELISYKNKL-
NHDHLD-----DMITKEEIIQLLHLPDDNVILS--NMIFNMVHSLCNFPFLGERI-WDI-
TAGNLLTCIILLDNDRCQRFIGS--KSYDQIKLLFILLCLSTNNSSGKPLSASNSKLREK
SENISTTSIYSQEIGYNLTDILQSYNGI--SIDDLSVPALSLSECFTWTLIMSIKCPTAN
CKILPNETIYN--SWNEY-QKASLNILRSMDSSIVSNLDD--YRISFTQFENVFTSVVPN
FTHPLENIMNHLLYMDKDLINHPV---MEIPKSKLMSESLLAQLSTTLP-KELFISKLQK
LYIGRQSGFSMRSLQSKCFKWLAPTILLVSGLIIPNDEE-----Y---NNPRFKRFLQEF
PKLN--DNEQS-LEPCHSYKKKISFAVYIDEPWRVTNKEFFGDLNSRIIELSPRQDIFKS
L--KSHELIYFNTIGCGIGIGDKQPHVSNGANSRKYQPGNVSLTLESTLEFAVFRHVGHG
GAFSPSELLTKRGTE----EESFEIKFIIQDVEVWGCGGEKELEEQMKQLAWEEAEAKRR
QQVNLKSISEDRALLEMVGLVGQH-QSGGSM
>Suva_8.171
MGQSSSTPSSNEEKSSNL------RKFTNN--GDVLAYFNHKAQQQVTVPELVSLKGNL-
QIEDMN-----TPISHKSLCSVLHFPQKHTLLS--GIVTNMLRVLSNFPLMNSSY-EPI-
TGYGLLKCILLLNKGRCGKYLKF--KSYDQLKLLFISLSLQKTDKEELSEENENNVKK--
--------------ERNIKQIIANFDDV--DSEVLYVPADFMLQFLSWLLILSVECPTSN
SKMGN-SKIYD--QWDSF-KISAMNLLRTMNPDVVSNTES--HLITFDQFSTSIRTVMPN
LLKPLENLMEHFFYLENDLVNYDT-SLSSVRDSRIMTPALLTQLSTVLP-RELFIQKLQS
LYIGRKSGFSMRSLQAKVFKWMAPSILIVSGTRITNSDE-----YAAQKNPRYRHFLEEF
PKLK--DSDQK-MDASYTNKKKTTFAVYIDDPWKVTNKDYFGDMNTRIIQISPRQDIYKV
N--RKGTI-YFNTIGGGIGIGDKQPLIKP--ASKRFIPGNVSLTFDSTLEFAVFRHTGYG
GSLEPGSLSVERKEE----DSFFELHFLIQDVEVWGCGGEKELEEQMKQMAWEEAESKRR
QQINLRSLGEDRALLEMAGLVGQN-RGGGSM
>Skud_15.281
MGQSSSVSSRNEEGSSSS------KKFTNN--RDVLSYFNNKAQQQVTIPELVSFKGNL-
QIENLN-----TPISHKPLFNVLHFPPNHTIVV--GIVTNMLRVLSNFPLINSSY-EPI-
TGFGLLKCILLLNRTRCEKFLKI--KSYDQLKLLFISLSLQKTDKEELSEENEENINR--
--------------ERHVKQIITDFDDV--DTEMLCLPADFMLQFLSWLLILSVKFPTTN
SKTDN-DKTYE--QWDTF-KISAMNLLRTMNPDVVSNVES--HFITFEQFSTAIRTVMPN
LFKPLENLMEHFFYLDNDLVSRDA-NLSSIQDSRIMTPALLAQLSTGLP-KELFIQKLQS
LYIGRKSGFSMRSLQAKVFKWMAPSILVVSGMRITNSDE-----YAAEKNPRYRHFLDEF
PKLK--DSDQK-MDASHLSKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPRQDIYKV
N--QKGTI-YFNTIGGGIGIGDKQPFIKA--ASKRYIPGNVSLTFDSTLEFAVFRHTGYG
GLLDPGLLSMERKEE----NSFFELHFLIQDVEVWGCGGEKELEEQIKQMAWEEAESKRR
QQINFRSLGEDRALLEMAGIIGQH-QGGGSM
>Smik_15.296
MGQSSSISSNNEEGSSHS------RKFAND--RDVLTYFNTKAQRQITVPELVSLKGNL-
QIENLN-----TPISHKRLCNFLYFPQNHTIIV--GIVTNMLRVLSNFPLVNSSY-EPI-
TGYGLLKCIVLLNKSRCEKFLKI--KSYDQLKLLFISLSLQKTDKEELSEDNENNGVK--
--------------EKNIKQIITGFDDV--DTEVLYLPADFMLQFLTWLLILSVECPTTN
STINN--ETNV--QWDKF-KIPAMNLLRTMNPDVVNNIES--HFITYQQFSTAIRTVMPN
LLKPLENLMEHFLYLQHDLVDYDT-NLSSIQDSKIMTPALLAQLSTGLP-KELFIQKLQS
LYIGRKSGFSMRSLQAKVFKWMAPSILVVSGVRITNSEE-----YAANKNPRYRHFLEEF
PILK--DSDQK-MDASLMNKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPRQDIYKV
N--KKGTV-YFNTIGGGIGIGNKQPLIKS--ASKRYVPGNVSLTFDSTLEFAVFRNTGYG
GSLDPGLLSMERKEE----NSSFELHILIQDVEVWGCGGEKELEEQIKQLAWEEAESKRR
QQINLRSLGEDRALLEMAGLVGQH-QGGGSM
>YOR118W
MGQSSSISSSNEEGSSHS------KKFTNS--KDILAYFNNKAQQQVTIPELVSFKGNL-
QIEDLN-----TPISHKALCNSLYFPQNHAMIV--GIVTNMLRVLSNFPLMKSSY-EPI-
TGYGLLKCILLLNRARCAKFLKT--KSYDQLKLLFISLSLQKTDKEELSEESENDGNK--
--------------ELTIKQIITGFDDV--DTEMLCIPADFMLQFLTWLLILTVDCPTTN
SKLDN-TETHD--QWGNF-KVSALNLLRTMNPDVVGDIES--HSITFQQFSTAIRTVMPN
LLKPLENLMEHFFYLQHDLVDHDT-NLSSIQDSKVMTPALLAQLSTGLP-KELFIHKLQS
LYIGRKSGFSMRSLQAKVFKWMAPSILVVSGMRITNSEE-----YAAEKNPRYRHFLEEF
PKLK--ESDQM-MDASHLNKRKTTFAVYIDDPWKVTNKDYFGDLNTRIIEISPRQDIYKV
N--QKGTI-YFNTIGGGIGIGDKQPLIKP--ASKRYIPGNVSLTFDSTLEFAVFRNTGYG
GSLDPGLLSMERKEE----NSPYELHFLIQDVEVWGCGGEKELEEQIKQLEWEEAESKRR
QQINLRSLGEDRALLEMAGLVGQH-QGGGSM
>KLLA0E21143g
MGQSTSKEHENARTN---------ESKLKG--ESLMDFFNDRCLKQLTTAELISFKNNIP
EGKELN-----DYVEVSDISRMYYIPKDSAVML--SVFMNMFHTLANFPLLQDSY-EKV-
TFKTLLKATLLLVKERAIKYTDW--KKYNDLKMLFITLSLEKNIKAEPLMDSSALSD---
--------------CKDWKGVIRSYNGT--DFDELKVNANNLLHFLALILALSRCCILNN
CKIDN-DVLAK--SLEDF-KHQALNIVRTMNPEIISMSDCLDSSITYTQFSMAVNDVAPN
LLNPLKMLMEHVLYMDRDLVDADV-LQPISNPTKIVNESELSQLATFLP-KEIVFSRFQK
LYVGRESGFSMRSFQSKVFKWMAPTILFVEGMRIRDEDDEDGDAYA-VKNPRYRNFLQEY
GKLK--SEDQH-LDTLSKKKRKLLFAVCIRDPWKVSNKDLFGDSSTKIIQLHPRQEIFDA
DPFKTGNV-YFNTVGGGIGIGSSQPIIKA--NGKKYFPGNVSLTIDSSLEFGIFRHLGAG
GSFKPGRLISGRGEE----RNSFEYRFIIQDVEVWGCGGEKELEEQVKQWQWEEAEAKRR
QKINLQSMGEDRALLEMAGLVGQH-QSGGSI
>SAKL0G02464g
MGQTASSGTGTTGNV---------LQFESQ--HDLLGYFAARATKQFTTPELVAFKSNL-
KGKDQN-----DKVSVEEMLQLLKIPLGNELLA--DLLHNCIKTLSNFPLIRESY-DDI-
TVAGLLKSCILLSHDRCIKYVGF--KNYDQLKLIYIALALRKTVKELPSSPDPAK-----
--------------PWDAKSIIRNYNSV--DIDDLYVPADSMLQLLTLSLVLSRHCTVNN
AKIRE--SVFQ--HWDDY-KANAMNLLRTMNPDIVNTQDTVQCVISFEQFSNAIAAVFPQ
VLKPLEILVEHMLYLDRDLTDELN-STSMPSTSKLVTEPLLAQLSTMLP-KELVYSKLRK
LYVGRESGFSMRSFQSKAFKWMAPSILLIGGMRITDDQE-----YATTKNPRYKKFLEEY
PRLK--DKDQHIIDPCSLNRRKLLFAVYVNEPWKVTNKELFGDLKTTVVQLSPKQELFKA
V--RTGNV-YFNTLGGGIGVGCAQPVIKP--NGKKYFPGNVSLTIDSSLEFASFRHVGYG
GAISPGTLMTKLEEE----KTTFEYKFIVQDVEVWGCGGEKELQEQIKQWEWEEAEAKRR
QRINLQSIGEDRALLEMAGLVGQH-QSGGSM
>KLTH0F16126g
MGQNSSNTVSSSQSS---------THFESE--NDLLSWYDKKALKLVSTPELVSYKGNI-
DGKPLD-----AALNRKELMRVLRLQNANEAVE--GLLFNCVQTLANFPLIKDCY-ENV-
TYMGVLKSCVLLNKNRCLEYVQD--KRYNHTKLVYISLALNKAVKEMSSLPNSND-----
--------------SLDAPKVIATFNNV--AEEELVVPAETMLEFLTLMLTMSKATVIKN
SRLDV--NISE--KWDSF-KTCALSILRTMNTDILTSQDALKNVISYTQFQNVISSVCPN
LLVPLECLMEHVLFLNRDLVDLEA-SKPLIPQSKLVTEPLLAQLATVWP-RELVFSRLQK
LYVGRDSGFSMRSFQAKAFKWMAPSILLVQGSRIPDDQD-----YAKNKNQRYKKFLDEY
PRLK--DEDQH-ILPALSGKRKLLFAILINEPWKVTNSELFGDIKTTIVQLSPIQEVYKA
S--KPGNV-YFNTLGGGIGIGSPQPIIKS--SGVKFVPGNVSLTIDPNLEFAAFRNVGFG
GSIAPSN------------TPTSEHKFLIQDIETWGCGGEKELEEQMKNWEWEEAEAQRR
QRINLKSVNDDRALLELAGLVGQN-QSGGSV
>Kwal_55.21437
MGQSTSTVSSNTSAT---------PQFNSE--KDVIIWFDKKAIKSLTSPELVSFKANI-
NGKDLS-----DVVTSDELLKVLRLDGVNETVS--SLIFNCVQTLSNFPFIRDCY-ENI-
TYSGLLKSCVLLNKARCLSYVKN--KRYDHTKLVYISLALNKTVKEVSSSSNSQE-----
--------------SLDAPRIIATFNSV--CVEELTVPSEVMLEFITLMLKMSKSTIIKN
SKLDP--NVSE--GWESF-RPFALSILRTMNTNIATQNDLLKYGITFSQFQSTISTVCPN
LLLPFESLMEHVLFLGRDLVDIDA-SQPPLLESKLVSEPLLAQLATVWP-RELVFSRLQK
LYVGRDSGFSMRSFQAKAFKWMAPSILLIHGVRIPNDEE-----YAKSKNHRYKNFLEEY
PRLK--EEDQV-LLPPFSGKKKLLFAVYVNVPWKVTNSELFGDLKTTIIQLSPIQEVYKA
S--RPGNI-YFNTLGGGIGVGSPQPIVKP--TSRKYLPGNVSLTIDPNLEFAVFRSAGFG
GSIKPSS------------TIVNEHKFLIQDIEAWGCGGEKELEEQMKNWEWEEAEAQRR
QRINLKSINDDRALLEMAGLVGQN-QSGGSI