MUSCLE (3.8) multiple sequence alignment

TBLA0A07270        MSTTQINDKDVACLIVNFLENVISKKEISQDNIDSLNVAIDCIQQCYNLNEAYISSSL-I
NDAI0I02240        ---MSLTKEQTASLIISYLSYLTNNNVLDEDKKESLRVAITCIGESFSLDGDILPTS---
NCAS0D02670        ---MSLSNKEIASRIVSYLSSLIRTGQVTEDYAESISVAIECIRDSFDLQEEV-------
TPHA0M00270        ---MNTTDQEIASIIVDYFNKCITSGKLNQDNVDSLNVAIDCIADVFDVDKDLISNIL-K
Kpol_1032.8        ---MSLNNKDFGALIVNYLHKIIDGKEVSEDNAESLNVAIDCISDVFELDPTSEEKII-N
KNAG0M01170        ---MAYSNKEVSSLIIDYLNKVVSKAEVSADDIDSLNVAIDCLTEVFGVEKDTLSATI-E
NDAI0D00810        ---MSLNNKDIGALIVDFLSTIIEKNEVSEDNADSLNVAMDCISEALEFDREVVPETI-K
NCAS0H00830        ---MSLSNKEVGSLIVDFLSTVIKNKEISEDSADSLNVAIDCITESFEFERDTVAQTL-Q
TBLA0G01050        ---MSYSNKDIANLLVDFLSTAIEKKAVSSDNADSLNVAIDCITEAFEFEKDDVKSTL-A
ACR005W            ---MSPSNKDIAALIVDFLTT--SAKTVGEDYEDSLKVAIDCITEAFELGPGEADTLV-S
KAFR0L00410        ---MPLSNKEISTLIVDYLVKVTEKNDVSEDVKDSLNVAIDCITDSFEFERDSTSGLI-K
Ecym_3025          ---MPGSNKEIAALIVQFLST--STKDVQEEYVDSLNVAIDCIAEAFEIEREDSNEIV-S
CAGL0E02739g       ------MSKEVAAVIIKYLEGVVAEKAVGEDYLDSVNVAIDCIAESFEVERGDVDSVL-K
ZYRO0C07788g       ---MAPSNKDISSLIVDYLADVVDKKSVSEDSIDSLNVAIECITEAFGIEKGSSSAA---
TDEL0G04480        ---MSPSNKEVASLIVDYLSQLVEKKAVSEEAIDSLNVAIDCIGESFEVQKGDSKAV---
KLLA0D01155g       ---MSLSNKEIAALIVDFLSS--SSSSVNEDYVDSLNVAIDCITEAFQFERDETDSLI-S
Suva_15.182        ---MSASKEEIASLIVNYFSSIVEKKEVSEDSADSLNVAMDCISEAFGFERDAVSSILDK
Skud_15.168        ---MSASKGEIASLIVNYFSSIVEKKEISEDSADSLNVAMDCISEAFGFEREAVPSILEN
Smik_15.176        ---MLASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFERDAASGILGK
YOR007C            ---MSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGK
KLTH0C11220g       ---MNPTKKELASLIIDYLCRTAEGKEIGEDYIDSLNVAIDCVTEAFEVEKESASSVI-E
Kwal_56.22433      ---MSPSNKDLANLIVDFLSHTVENKEVSEDYVDSLNVAIDCITEAFEFDRESVATTL-E
SAKL0E01210g       ---MAQSNKEIAALIVDFLSSTVEKNAVSEDYADSLNVAIDCISEAFEFERDAVSEIV-K
Kpol_1037.26       ---MSVSNKDIAALIIDFLSTVVDKNEVSEDNADSLNVAMDCIAEAFEFERDSVAGVV-K
TPHA0J00340        ---MAASNKEIAALIVDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTV-K
                          . : .  ::.::        :  :  :*: **: *: :   .           

TBLA0A07270        LKFSKSDLTSILNNFAKNNYKNITSTKETTPLTLEPSSLNESVKKNQSNISNDNNEKISI
NDAI0I02240        --LKERTLKTILQEN----LNTLEATQK-------------------------IHNE---
NCAS0D02670        --SADSDLATVLLAN------LNLEPEP------------------------KLSEK---
TPHA0M00270        TAYRSNDLLTYLPNGKRSALNLDKKNTTINVSVQTKDKINAYNDLSRNKDDINVPVKVIE
Kpol_1032.8        DVFNKSDLKTITLKG----LGLQNVSDV---------------------VELEVKNE--E
KNAG0M01170        SKFNGKSLTELLDAA--SQNAGNTDECK------------------TETVKINIPQE---
NDAI0D00810        NKFNGKTLVDILNTT--STATANTTIEK------------------EESVEVNIPVE---
NCAS0H00830        DKFSGKTLKEILSSA--SATSTGSEKEE--------------------SVKVNIPVE---
TBLA0G01050        SKFGGKSLTELLDAA-TNAKGRSSSPED---------------------IKVSISDKDEE
ACR005W            EKCGGRSLSQLLTTG---MAHTSDAGEP------------------------KVAAE---
KAFR0L00410        SKFYNLSLPELLEVA-----MENSAKEN---------------------VTVNVPKDELE
Ecym_3025          KAYNGRGLVDLVKSG--ASEPTLSSSEP---------------------TGNNTDAH---
CAGL0E02739g       QSGISKGLEECLECM----KGGAVKSED---------------------VKVNIPAE---
ZYRO0C07788g       --FGGKNLAELLSAG---AGAPSSQGEN---------------------VKVNIPAE---
TDEL0G04480        --FGGKGLVELLQNE--SGSSSETATTQ------------------AESIKVNIPAE---
KLLA0D01155g       GPFNGKKLPELLASA---PSSGGVSGEP---------------------VKVHIPVE---
Suva_15.182        STFKGQSLNNLLSSS--SKLPESGKKDD------------------AQNVEVNIPEE---
Skud_15.168        SEFKGQNLTDLLNST--SRVSESTKKDD------------------AQNVEVNIPEE---
Smik_15.176        SEFKGKSLADVLNSA--SKASESNEKDD------------------AQNVEVNIPEE---
YOR007C            SEFKGQHLADILNSA--SRVPESNKKDD------------------AENVEINIPED---
KLTH0C11220g       KSFGGQSLEQIVGAS--SKGPTATQQEP---------------------VKVNIPVE---
Kwal_56.22433      KTFAGRSLKQVVEAA---SVGSSSPQES---------------------VKVNIPVE---
SAKL0E01210g       NSFDNRKLDELLKSA---ATALPTQSEP---------------------VKVNIPAE---
Kpol_1037.26       SSFQGNSLSSYLNGSTSASAATTTADET---------------------VKVNVTED---
TPHA0J00340        SAFNGNGLTSFLSGS---------ATND---------------------IQVNIADD--A
                          *                                                    

TBLA0A07270        NLNDTSKNNFSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKY-----PCDPIYY
NDAI0I02240        ----------------EAEALKKEGNEAMIEGQYEEAIKKYTEAIQF------SKNVAYY
NCAS0D02670        -ERELVN--------EQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYL
TPHA0M00270        DIEETKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLY-----PTNFNYY
Kpol_1032.8        ISEDKKK---------EAEALKLEGNKQMSLKNYKSAIDKYSKAIEIY-----PSNPFYY
KNAG0M01170        -DAETKA---------KAEALKLEGNKAVASKDYDLAVEKYTEAIKIL-----PTNAVYF
NDAI0D00810        -DAEIKA---------NAEAFKLEGNKAMAMKDFHLAVEKYTEAIKIL-----PTNAIYY
NCAS0H00830        -DAEIKA---------TAESFKLEGNKAMAAKDYRLAIEKYSEAIKTL-----PTNVIYY
TBLA0G01050        EDKELAA---------KAEALKLEGNKAMAAKDYNLAVEKYNAAIKLV-----PTKAVYY
ACR005W            ---ELKK---------EAEALKLEGNRAMAAKDYETAIQKYTAAIEVL-----PTDAVYY
KAFR0L00410        NDEETKV---------KAEKLKLEGNKAMAMKDFDLAIAKYSEAISIS-----PNNAIYY
Ecym_3025          -APEVAE---------RAENLKLEGNKAFAAKDFEGAVKKYTEAIELM-----PNNAVFY
CAGL0E02739g       -DAETKA---------KAEALKLEGNKAMAGKDFELAIAKYSEAIEVL-----PTNAIYY
ZYRO0C07788g       -DAELKS---------KAESLKLEGNKAMAGKDYELAIKKYSEAISVV-----PTNAVYY
TDEL0G04480        -DAETKA---------KAETLKLEGNKAMACKDFDLAIKKYSDAIEVL-----PTNAVYY
KLLA0D01155g       -DAAAKA---------KAEELKLQGNKAMAAKKFDEAIEKYTAAIEVS-----PSNAVYY
Suva_15.182        -DAETKA---------KAEELKIQGNKAMANKEYELAIKKYTEAIDVL-----PTNAIYY
Skud_15.168        -DAEIKA---------KAEDLKMQGNKAMANKDYELAINKYTEAIKVL-----PTNAIYY
Smik_15.176        -DAETKA---------KAEDLKMQGNKAMANKDYELAINKYTEAIQVL-----PTNAIYY
YOR007C            -DAETKA---------KAEDLKMQGNKAMANKDYELAINKYTEAIKVL-----PTNAIYY
KLTH0C11220g       -DAEIKA---------KAEALKLEGNKAMATKDFEHAISKYSEAIRTL-----PSNAVYF
Kwal_56.22433      -DAETKA---------KAESLKLEGNKAMAAKDFEQAVLKYSEAIQVL-----PTNAVYY
SAKL0E01210g       -DANTKA---------KAEDLKLQGNKAMASKDFETAIKKYTEAIEVL-----PSNAVYY
Kpol_1037.26       -DTEASE---------AAEALKLEGNKAMAGKDYELAIKKYTEAIATL-----PTNAVYF
TPHA0J00340        ADEEQKA---------TAEGLKLEGNKAMATKDYESAIKKYSEAIEVL-----PTNAVYY
                                    *  :* :**  .   .:  *:  *. **        . .  : 

TBLA0A07270        SNRSVAYLKVNDYESAINDANFCISID----ANFSKAYIRLANIKVQQHQYIDALDYYKK
NDAI0I02240        SNRSLAYSKLGRYEDAVNDATLAINID----PSFSKAYSRLGYAKCCQDKLEDGMTAYKR
NCAS0D02670        SNKSLALTKSGRYEEACDDALACIKID----PTFSKGYSRLAEAKIGQNKYEDAMNAYKQ
TPHA0M00270        NNRALAYIKANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKR
Kpol_1032.8        SNRAAAYQMIEDFTNAVLDANTAIKLD----PTYSKAYSRLGAAKLAEGNNEDAVHAFKK
KNAG0M01170        ANRAAAYTNSQNYDEAVKDAEEAIKLD----PAYSKGYSRLAYAKYVQENFEESLEAYKK
NDAI0D00810        ANRAAAHSSLKEFEEAIKDAESAIKID----PSYSKGYSRLAFAKYGLGKHEEALESYKK
NCAS0H00830        ANRAAAYSSVKEYDNAIKDAEKAIEID----PAYSKGYSRLAFAKYALNKPEEALEYYKK
TBLA0G01050        ANRAAAYSSQEKYDEAIKDAESAIKVE----PNWSKGYSRLGFAKFAQGKSQEALEAYKK
ACR005W            ANRAAAYSSLQQYEKAVEDAEKATKVD----SSYSKGFSRLGYAKYALGRHEEALEAYKR
KAFR0L00410        ANRAAAYSSLKDFEKATEDAESAIRVD----PNYSKGYSRLGFAKYALNKPEEALEAYKK
Ecym_3025          GNRAAAYSSFKKFEEAVRDAESAVRIN----PSYSRGYSRLGLAKYALGKPEEAMEAYKK
CAGL0E02739g       ANRAAAHSSLKQYDEAVVDAEKAIEID----PAYSKGYSRLGFAKYAQNKPEEALEAYKK
ZYRO0C07788g       ANRAAAHSSLKNYDEAIKDAESAVKVD----SSYSKGYSRLGYAKFAQGKSEEALEAYKK
TDEL0G04480        ANRAAAHSSMKAYEEAIKDAESAIKTD----PTYSKGYSRLGYAKFALGQAEDALEAYKK
KLLA0D01155g       SNRAAAYSSLKQYEQAVKDAEQAIEVD----PTYSKGFSRLGFAKYALNKPEEALDAYKK
Suva_15.182        ANRAAAHSSLKEYDEAIKDAESAISVD----PSYFRGYSRLGFAKYAQGKPEEALEAYKK
Skud_15.168        ANRAAAHSSLKGYDEAVEDAESAISID----PTYFRGYSRLGFAKYAQGKPEEALEAYKK
Smik_15.176        ANRAAAHSSLREYDEAVKDAESSISID----PSYFRGYSRLGFAKYAQGKPEEALEAYKK
YOR007C            ANRAAAHSSLKEYDQAVKDAESAISID----PSYFRGYSRLGFAKYAQGKPEEALEAYKK
KLTH0C11220g       ANRAAAYSSLKKYAEAVEDAEAAIKVN----PSYSKGYSRLGFAQYALGRPEEALDAYKK
Kwal_56.22433      ANRAAAHSSLKKYEEAVKDAEDAIKVN----PSYSKGYSRLGFAQYALGKPEEALDAYKK
SAKL0E01210g       ANRAAAYSSLKKYEESVQDAESAIKVN----PSYSKGYSRLGFAKYALGKPEEALEAYKT
Kpol_1037.26       ANRAAAYSSLKKYDEAVEDANSAIKIN----PTYSKGYSRLGFAKFAQGKAEDALEAYKK
TPHA0J00340        ANRAAAYSSLKKYDDAVNDAESAIKVN----PTYSKGYSRLGFAKFAQGKVEDALDAYKK
                    *.: *      :  :  **  .   :    .   ..: **.  :        .:  :* 

TBLA0A07270        FIEL-----NKDSVPEKITREFEDLK------LKVQTDISLR--EISNDHSNN------N
NDAI0I02240        AIDL-----EGTNASKTLYDDYEDARFKYEQLKKNDDSEERKSIKEVTSEECPEKNNNQD
NCAS0D02670        VLDL-----EGNKATDTMKRDFEITK------QKFE-TLNFS--THIDSGSAT-PISEAA
TPHA0M00270        MIEIAQENNKGDEITKQMDADYEKAK------EKVQELFFMQ--ITKSTGKEG-------
Kpol_1032.8        VLEL-----EGDKSTEVMKNDYENAK------KLVQTFVTLN--KNVPDP----------
KNAG0M01170        VLEI-----EGDSATEVTKRGYETAK------KRVEESLNLE--KSVPTESAG-------
NDAI0D00810        VLDI-----EGDNATAGMKRDYETAK------KRVEESMNVEKSKTPEQGQGQQQTNESA
NCAS0H00830        VLDM-----EGDKATPAMKRDFEMAK------NRVESSMNLE--KSSTTTPEP---SRSA
TBLA0G01050        ALEV-----DGDKATDIMKRDYETAK------KKVEQSLNVE--KSATPS----------
ACR005W            VLDI-----EGDNATEAMRRDYESAK------RKVEESINMD--RNAEVTESG-------
KAFR0L00410        VLDL-----EGDKATEIMKRDYETAK------KRVEQSLNLE--KKESTPKEE---SV--
Ecym_3025          VLDI-----EGDNATEAMKRDYESAK------KKVEESLNLE--ALPKGEEQQ-------
CAGL0E02739g       VMDL-----EGDKATDIMKRDYETAK------KKVEQSLNLE--KTPDARGAD---SG--
ZYRO0C07788g       VLDI-----EGDSATDVMKRDYETAK------RKVEQALELN--KTDETETSD---RG--
TDEL0G04480        VLDI-----EGDKASDVMKRDYETAK------KKVEQSLDLE--KKPETQARG---AD--
KLLA0D01155g       VLDI-----EGEKATDVMKRDYETAK------KKVETSMNLE--KSSTSASSE-DVSDKS
Suva_15.182        VLDI-----EGDNATDAMKRDYESAK------KRVEQSLNLE--KTAPEQPRD---AG--
Skud_15.168        VLDI-----EGDNATEAMKRDYESAK------KKVEQSLNLE--KTVPEQSRD---ADAN
Smik_15.176        VLDI-----EGDNATEAMKRDYESAK------KKVEQSLNLE--KAVPEQSRD---AD--
YOR007C            VLDI-----EGDNATEAMKRDYESAK------KKVEQSLNLE--KTVPEQSRD---AD--
KLTH0C11220g       VLDI-----EGSNATDAMKRDYDTAM------KKVEQSLNVE--RSAPAASNA-------
Kwal_56.22433      VLDI-----EGEAATDAMKRDYDTAM------KKVGQSLNVE--KSAPAATRD-------
SAKL0E01210g       VLDI-----EGDKATDVMKRDYETAK------RKVEQSLNLE--KSVPTQTDE---QE--
Kpol_1037.26       VLDI-----EGDKATEMMKRDYETAK------KKVEQSLNLE--KSTVSGNAT-AESDSA
TPHA0J00340        VLDI-----EGDKATDIMKRDYETAK------KKVEQSLNLE--KVTPKEAETESNADAG
                    :::     .    .      ::                                     

TBLA0A07270        YNENS---------------------YNSTK------NSP--DIGSIL------------
NDAI0I02240        EGFTAVNHYAQNNDNKSKEETKEENRSQAA-------DLS--NIARLL------------
NCAS0D02670        NKYPPKDEEIRTRSSLVKVDVPAEQTNTNEEHSTPNTNTPRFNIAQLI------------
TPHA0M00270        SGNSV---------------------NDGPKRKV---TLN--DILNMA------------
Kpol_1032.8        SGPPP---------------------LNTTD------VLT--DIATVL------------
KNAG0M01170        GQTNP---------------------AAGG-------GFP--DFSSLM------------
NDAI0D00810        QGNAP---------------------NPFAG------GMP--DMSSLF--------GGAG
NCAS0H00830        GQQPA---------------------NPFAGS-----GMP--DMSSLF-----------G
TBLA0G01050        ASASA---------------------SASAG------GMP--DMASML------------
ACR005W            DSAAG---------------------SAGGS------GLP--DLASMFGGGGLGGGLGGG
KAFR0L00410        TESAA---------------------NAAAG------GFP--DMSSML------------
Ecym_3025          TSEGS---------------------SAG--------GFP--DLSSML------------
CAGL0E02739g       AGAGA---------------------GAGGAG-----GF---DFSSML------------
ZYRO0C07788g       TGEPA---------------------GANPGG-----GF---DLSSML------------
TDEL0G04480        AGAGG---------------------AGGSG------GFG--DFASML------------
KLLA0D01155g       ATEGP---------------------GAGAG------GLP--DLSSLLG--------GGG
Suva_15.182        ANAGQ---------------------GAGAG------GLP--DLGSLL------------
Skud_15.168        ADASQ---------------------GAGTS------GLP--DLGSLL------------
Smik_15.176        ANASQ---------------------GAGSS------GLP--DLGSLL------------
YOR007C            VDASQ---------------------GASAG------GLP--DLGSLL------------
KLTH0C11220g       -ESPD---------------------AAGGS------GFP--DIASML---------GGG
Kwal_56.22433      -GAGS---------------------ATGSG------GLP--DISSML------------
SAKL0E01210g       SSTDA---------------------GAGAS------GFP--DMASLL------------
Kpol_1037.26       SAADP---------------------FAGMG------GMP--DFSSML---------G--
TPHA0J00340        TGAAG---------------------MGGMG------GFP--DLSSML---------GGG
                                                             ::  :             

TBLA0A07270        -GDGFAAL---LSNPMLQQMIFKIIQ-NNPDAAKNIGYVLANPAMKNLLQNFKN---GS-
NDAI0I02240        -GSGVGGL---MNNPQLKQMVFQAIN-DNPDASRQVKDVLNNPLLRTTLSELMNTKMGGK
NCAS0D02670        -GNGIGTI---LNNPQVQLALSHFAQ-RNPDAARKVQEISNNPMFKMALSQLMDA--ANQ
TPHA0M00270        -GNNLNII---MSNPLFKEVVEQLLA-SNPQAKQQFDNVMNDPRVRQMKENVNS---DS-
Kpol_1032.8        -GSSFGSL---MNNTQMMQRAQQMMQTQNPEMMQQVEGLMQNPVVRQFAENVAN---GNG
KNAG0M01170        -SGGLEGL---MNNPQMMQAAQSMMS--NPGAMEKIQSMMQNPAIQQMAEQFKG---GN-
NDAI0D00810        MGGGLGSL---LSNPDFMSTAQKLMS--DPNAMQQVQSMMSDPSMRDLANNFKN---GN-
NCAS0H00830        NGGGMGGLSSFLNNPQVMQAAQQMMS--DPNSMQKMQEMMQNPNLREMAQNLAS---GD-
TBLA0G01050        -GGGLGSF---LNNPQIMQAAQQMMS--NPRAMEQMESMMQNPSIRQMAENLSS---GS-
ACR005W            LGGGLGGL---LNNPQVMQAAQKMMQ--NPSAI---QEMMSNPAIKKMAENFAS---GNG
KAFR0L00410        -GGGLNGL---LNNPQLMQAAQQMMS--DPNAMSKIQSMMQNPSIRQMAENFQN---GN-
Ecym_3025          -GGGLGGL---LNNPQVMQAAQKMMQ--NPSAM---QEMMNNPAIKQMAQNFAS---GGG
CAGL0E02739g       -SGGLSGL---MNNPQIMQAAQQMMS--NPQALQQMQSMMQDPSIRQMAEQFTS---GNG
ZYRO0C07788g       -GGGLGGL---LNNPQVMQAAQQMMQ--NPQAMSQMETMMQNPNVRQMAEKFAG---GNG
TDEL0G04480        -GGGLGGL---LNNPQLMQAAQQMMQ--NPQAMSQMESMMQNPGVRQMAENFAQ---GNG
KLLA0D01155g       LGGGLGAL---LNNPQVMQAAEKMMQ--NPGLM---QDMMSNPAMKQMANQFSS---GGG
Suva_15.182        -GGGLGGL---MNNPQLMQAAQKMMS--NPGAMQNIQNMMQDPSIRQMAEGFTS---GGG
Skud_15.168        -GGGLGGL---MNNPQLMQAAQKMMS--NPGAMQNIQKMMQDPNIKQMAEGFTS---GGG
Smik_15.176        -GGGLGGL---MNNPQLMQAAQKMMS--NPGAMQNIQKMMQDPSIRQMAEGFTS---GGG
YOR007C            -GGGLGGL---MNNPQLMQAAQKMMS--NPGAMQNIQKMMQDPSIRQMAEGFAS---GGG
KLTH0C11220g       LGGGLGGL---LKNPQVMQAAQQMMQ--NPNAM---QEMMSNPAIKQMADKFQS---GGG
Kwal_56.22433      -GGGLGGL---LNNPQLMQAAQQMMQ--NPNAM---QEVMNNPAVKQMAEKFQS---GGG
SAKL0E01210g       -GGGLGGL---LNNPQVMSAAQKLMQ--NPGAM---DEMMKNPAVRQMAENFSS---GGG
Kpol_1037.26       -GGGLGNL---LNNPQLMQAAQQMMQ--DPEAMKQVESMMQNPSVKQMADQFSS---GNG
TPHA0J00340        LGGGLGDL---LKNPQIMQAAQQMMQ--NPNAMQQMESMMQNPAVRQMAENFAS---GEG
                    ....  :   :.*. .           :*        :  :* ..   . .        

TBLA0A07270        ------AFDKKLFMDLLDSLLNPNSNTNTNPNNNSNTT----------
NDAI0I02240        TPQ--EMLQSGTVNNLIQSFLAGTQQGKK-------------------
NCAS0D02670        SPE--EFFKSEKFKNLVNSFIPGAL-----------------------
TPHA0M00270        ------MSNIPILKDLFYSLLNTTVYEENLNGKK--------------
Kpol_1032.8        PGGLSDVLNNPSVKEVANGLMNGYNVASSVTVEEPESKNPEKQ-----
KNAG0M01170        TPDFSEMMNNPAVRNMASSLFSGAGEPAAPKDDAKPE-----------
NDAI0D00810        -TDMNDIMNNPAIRNMASNLFKGNPSEENQDKQ---------------
NCAS0H00830        -ANLDDLMNNPSVKDMANNLFGPNGAPK--------------------
TBLA0G01050        SEGMGDFMNNPAIREMASNLFGGAGAGAGADSNGANSSANAGKDADKN
ACR005W            SSGLGDLMADPAVRNMASKFFGPK------------------------
KAFR0L00410        TPDFSQLMNDPNIKDMAKNFFGGNNQQQ--------------------
Ecym_3025          TPNLGDMMKDPNIKDMAGKFFGQK------------------------
CAGL0E02739g       TPNMDDLMSNPALRNMASSMFGGAGAPGADADAPGAEPKGEIDEK---
ZYRO0C07788g       TPNLNDIMNNPALRDMAGGLFGGAGGGANPGGAPRP------------
TDEL0G04480        MPNMGDLMNNPALRDMAGSLFGGANGNAPNDVPKNSDNGSN-------
KLLA0D01155g       MPDLSQMMNDPSIRDMAKNMFGGGNGSQQ-------------------
Suva_15.182        TPNLSDLMKNPALRNMAGSLFGGADAPSTEDTPDSETKQ---------
Skud_15.168        APNLSDLMNNPALRSMAGNLFGGAGAPSTEDTSDSENKQ---------
Smik_15.176        APNLSDLMNNPALRNMAGNLFGGADAPSSEGTPDSENK----------
YOR007C            TPNLSDLMNNPALRNMAGNLFGGAGAQSTDETPDNENKQ---------
KLTH0C11220g       TPSMADLMNNPALMDMAKNMFGGPKQ----------------------
Kwal_56.22433      TPSMADLMNNPALMDMAKNMFGGGKQ----------------------
SAKL0E01210g       TPNLGDLMSNPAIKDMAKNLFGPN------------------------
Kpol_1037.26       TPDFSALMNDPSIRDMAKNMFGNGGFQGAPPS----------------
TPHA0J00340        TPDLSAMMNNPDLKDMAKNMFGNGGFPGAPK-----------------
                               . .:   ::                           

FASTA FORMAT for MUSCLE Version 3.6

>TBLA0A07270
MSTTQINDKDVACLIVNFLENVISKKEISQDNIDSLNVAIDCIQQCYNLNEAYISSSL-I
LKFSKSDLTSILNNFAKNNYKNITSTKETTPLTLEPSSLNESVKKNQSNISNDNNEKISI
NLNDTSKNNFSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKY-----PCDPIYY
SNRSVAYLKVNDYESAINDANFCISID----ANFSKAYIRLANIKVQQHQYIDALDYYKK
FIEL-----NKDSVPEKITREFEDLK------LKVQTDISLR--EISNDHSNN------N
YNENS---------------------YNSTK------NSP--DIGSIL------------
-GDGFAAL---LSNPMLQQMIFKIIQ-NNPDAAKNIGYVLANPAMKNLLQNFKN---GS-
------AFDKKLFMDLLDSLLNPNSNTNTNPNNNSNTT----------
>NDAI0I02240
---MSLTKEQTASLIISYLSYLTNNNVLDEDKKESLRVAITCIGESFSLDGDILPTS---
--LKERTLKTILQEN----LNTLEATQK-------------------------IHNE---
----------------EAEALKKEGNEAMIEGQYEEAIKKYTEAIQF------SKNVAYY
SNRSLAYSKLGRYEDAVNDATLAINID----PSFSKAYSRLGYAKCCQDKLEDGMTAYKR
AIDL-----EGTNASKTLYDDYEDARFKYEQLKKNDDSEERKSIKEVTSEECPEKNNNQD
EGFTAVNHYAQNNDNKSKEETKEENRSQAA-------DLS--NIARLL------------
-GSGVGGL---MNNPQLKQMVFQAIN-DNPDASRQVKDVLNNPLLRTTLSELMNTKMGGK
TPQ--EMLQSGTVNNLIQSFLAGTQQGKK-------------------
>NCAS0D02670
---MSLSNKEIASRIVSYLSSLIRTGQVTEDYAESISVAIECIRDSFDLQEEV-------
--SADSDLATVLLAN------LNLEPEP------------------------KLSEK---
-ERELVN--------EQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYL
SNKSLALTKSGRYEEACDDALACIKID----PTFSKGYSRLAEAKIGQNKYEDAMNAYKQ
VLDL-----EGNKATDTMKRDFEITK------QKFE-TLNFS--THIDSGSAT-PISEAA
NKYPPKDEEIRTRSSLVKVDVPAEQTNTNEEHSTPNTNTPRFNIAQLI------------
-GNGIGTI---LNNPQVQLALSHFAQ-RNPDAARKVQEISNNPMFKMALSQLMDA--ANQ
SPE--EFFKSEKFKNLVNSFIPGAL-----------------------
>TPHA0M00270
---MNTTDQEIASIIVDYFNKCITSGKLNQDNVDSLNVAIDCIADVFDVDKDLISNIL-K
TAYRSNDLLTYLPNGKRSALNLDKKNTTINVSVQTKDKINAYNDLSRNKDDINVPVKVIE
DIEETKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLY-----PTNFNYY
NNRALAYIKANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKR
MIEIAQENNKGDEITKQMDADYEKAK------EKVQELFFMQ--ITKSTGKEG-------
SGNSV---------------------NDGPKRKV---TLN--DILNMA------------
-GNNLNII---MSNPLFKEVVEQLLA-SNPQAKQQFDNVMNDPRVRQMKENVNS---DS-
------MSNIPILKDLFYSLLNTTVYEENLNGKK--------------
>Kpol_1032.8
---MSLNNKDFGALIVNYLHKIIDGKEVSEDNAESLNVAIDCISDVFELDPTSEEKII-N
DVFNKSDLKTITLKG----LGLQNVSDV---------------------VELEVKNE--E
ISEDKKK---------EAEALKLEGNKQMSLKNYKSAIDKYSKAIEIY-----PSNPFYY
SNRAAAYQMIEDFTNAVLDANTAIKLD----PTYSKAYSRLGAAKLAEGNNEDAVHAFKK
VLEL-----EGDKSTEVMKNDYENAK------KLVQTFVTLN--KNVPDP----------
SGPPP---------------------LNTTD------VLT--DIATVL------------
-GSSFGSL---MNNTQMMQRAQQMMQTQNPEMMQQVEGLMQNPVVRQFAENVAN---GNG
PGGLSDVLNNPSVKEVANGLMNGYNVASSVTVEEPESKNPEKQ-----
>KNAG0M01170
---MAYSNKEVSSLIIDYLNKVVSKAEVSADDIDSLNVAIDCLTEVFGVEKDTLSATI-E
SKFNGKSLTELLDAA--SQNAGNTDECK------------------TETVKINIPQE---
-DAETKA---------KAEALKLEGNKAVASKDYDLAVEKYTEAIKIL-----PTNAVYF
ANRAAAYTNSQNYDEAVKDAEEAIKLD----PAYSKGYSRLAYAKYVQENFEESLEAYKK
VLEI-----EGDSATEVTKRGYETAK------KRVEESLNLE--KSVPTESAG-------
GQTNP---------------------AAGG-------GFP--DFSSLM------------
-SGGLEGL---MNNPQMMQAAQSMMS--NPGAMEKIQSMMQNPAIQQMAEQFKG---GN-
TPDFSEMMNNPAVRNMASSLFSGAGEPAAPKDDAKPE-----------
>NDAI0D00810
---MSLNNKDIGALIVDFLSTIIEKNEVSEDNADSLNVAMDCISEALEFDREVVPETI-K
NKFNGKTLVDILNTT--STATANTTIEK------------------EESVEVNIPVE---
-DAEIKA---------NAEAFKLEGNKAMAMKDFHLAVEKYTEAIKIL-----PTNAIYY
ANRAAAHSSLKEFEEAIKDAESAIKID----PSYSKGYSRLAFAKYGLGKHEEALESYKK
VLDI-----EGDNATAGMKRDYETAK------KRVEESMNVEKSKTPEQGQGQQQTNESA
QGNAP---------------------NPFAG------GMP--DMSSLF--------GGAG
MGGGLGSL---LSNPDFMSTAQKLMS--DPNAMQQVQSMMSDPSMRDLANNFKN---GN-
-TDMNDIMNNPAIRNMASNLFKGNPSEENQDKQ---------------
>NCAS0H00830
---MSLSNKEVGSLIVDFLSTVIKNKEISEDSADSLNVAIDCITESFEFERDTVAQTL-Q
DKFSGKTLKEILSSA--SATSTGSEKEE--------------------SVKVNIPVE---
-DAEIKA---------TAESFKLEGNKAMAAKDYRLAIEKYSEAIKTL-----PTNVIYY
ANRAAAYSSVKEYDNAIKDAEKAIEID----PAYSKGYSRLAFAKYALNKPEEALEYYKK
VLDM-----EGDKATPAMKRDFEMAK------NRVESSMNLE--KSSTTTPEP---SRSA
GQQPA---------------------NPFAGS-----GMP--DMSSLF-----------G
NGGGMGGLSSFLNNPQVMQAAQQMMS--DPNSMQKMQEMMQNPNLREMAQNLAS---GD-
-ANLDDLMNNPSVKDMANNLFGPNGAPK--------------------
>TBLA0G01050
---MSYSNKDIANLLVDFLSTAIEKKAVSSDNADSLNVAIDCITEAFEFEKDDVKSTL-A
SKFGGKSLTELLDAA-TNAKGRSSSPED---------------------IKVSISDKDEE
EDKELAA---------KAEALKLEGNKAMAAKDYNLAVEKYNAAIKLV-----PTKAVYY
ANRAAAYSSQEKYDEAIKDAESAIKVE----PNWSKGYSRLGFAKFAQGKSQEALEAYKK
ALEV-----DGDKATDIMKRDYETAK------KKVEQSLNVE--KSATPS----------
ASASA---------------------SASAG------GMP--DMASML------------
-GGGLGSF---LNNPQIMQAAQQMMS--NPRAMEQMESMMQNPSIRQMAENLSS---GS-
SEGMGDFMNNPAIREMASNLFGGAGAGAGADSNGANSSANAGKDADKN
>ACR005W
---MSPSNKDIAALIVDFLTT--SAKTVGEDYEDSLKVAIDCITEAFELGPGEADTLV-S
EKCGGRSLSQLLTTG---MAHTSDAGEP------------------------KVAAE---
---ELKK---------EAEALKLEGNRAMAAKDYETAIQKYTAAIEVL-----PTDAVYY
ANRAAAYSSLQQYEKAVEDAEKATKVD----SSYSKGFSRLGYAKYALGRHEEALEAYKR
VLDI-----EGDNATEAMRRDYESAK------RKVEESINMD--RNAEVTESG-------
DSAAG---------------------SAGGS------GLP--DLASMFGGGGLGGGLGGG
LGGGLGGL---LNNPQVMQAAQKMMQ--NPSAI---QEMMSNPAIKKMAENFAS---GNG
SSGLGDLMADPAVRNMASKFFGPK------------------------
>KAFR0L00410
---MPLSNKEISTLIVDYLVKVTEKNDVSEDVKDSLNVAIDCITDSFEFERDSTSGLI-K
SKFYNLSLPELLEVA-----MENSAKEN---------------------VTVNVPKDELE
NDEETKV---------KAEKLKLEGNKAMAMKDFDLAIAKYSEAISIS-----PNNAIYY
ANRAAAYSSLKDFEKATEDAESAIRVD----PNYSKGYSRLGFAKYALNKPEEALEAYKK
VLDL-----EGDKATEIMKRDYETAK------KRVEQSLNLE--KKESTPKEE---SV--
TESAA---------------------NAAAG------GFP--DMSSML------------
-GGGLNGL---LNNPQLMQAAQQMMS--DPNAMSKIQSMMQNPSIRQMAENFQN---GN-
TPDFSQLMNDPNIKDMAKNFFGGNNQQQ--------------------
>Ecym_3025
---MPGSNKEIAALIVQFLST--STKDVQEEYVDSLNVAIDCIAEAFEIEREDSNEIV-S
KAYNGRGLVDLVKSG--ASEPTLSSSEP---------------------TGNNTDAH---
-APEVAE---------RAENLKLEGNKAFAAKDFEGAVKKYTEAIELM-----PNNAVFY
GNRAAAYSSFKKFEEAVRDAESAVRIN----PSYSRGYSRLGLAKYALGKPEEAMEAYKK
VLDI-----EGDNATEAMKRDYESAK------KKVEESLNLE--ALPKGEEQQ-------
TSEGS---------------------SAG--------GFP--DLSSML------------
-GGGLGGL---LNNPQVMQAAQKMMQ--NPSAM---QEMMNNPAIKQMAQNFAS---GGG
TPNLGDMMKDPNIKDMAGKFFGQK------------------------
>CAGL0E02739g
------MSKEVAAVIIKYLEGVVAEKAVGEDYLDSVNVAIDCIAESFEVERGDVDSVL-K
QSGISKGLEECLECM----KGGAVKSED---------------------VKVNIPAE---
-DAETKA---------KAEALKLEGNKAMAGKDFELAIAKYSEAIEVL-----PTNAIYY
ANRAAAHSSLKQYDEAVVDAEKAIEID----PAYSKGYSRLGFAKYAQNKPEEALEAYKK
VMDL-----EGDKATDIMKRDYETAK------KKVEQSLNLE--KTPDARGAD---SG--
AGAGA---------------------GAGGAG-----GF---DFSSML------------
-SGGLSGL---MNNPQIMQAAQQMMS--NPQALQQMQSMMQDPSIRQMAEQFTS---GNG
TPNMDDLMSNPALRNMASSMFGGAGAPGADADAPGAEPKGEIDEK---
>ZYRO0C07788g
---MAPSNKDISSLIVDYLADVVDKKSVSEDSIDSLNVAIECITEAFGIEKGSSSAA---
--FGGKNLAELLSAG---AGAPSSQGEN---------------------VKVNIPAE---
-DAELKS---------KAESLKLEGNKAMAGKDYELAIKKYSEAISVV-----PTNAVYY
ANRAAAHSSLKNYDEAIKDAESAVKVD----SSYSKGYSRLGYAKFAQGKSEEALEAYKK
VLDI-----EGDSATDVMKRDYETAK------RKVEQALELN--KTDETETSD---RG--
TGEPA---------------------GANPGG-----GF---DLSSML------------
-GGGLGGL---LNNPQVMQAAQQMMQ--NPQAMSQMETMMQNPNVRQMAEKFAG---GNG
TPNLNDIMNNPALRDMAGGLFGGAGGGANPGGAPRP------------
>TDEL0G04480
---MSPSNKEVASLIVDYLSQLVEKKAVSEEAIDSLNVAIDCIGESFEVQKGDSKAV---
--FGGKGLVELLQNE--SGSSSETATTQ------------------AESIKVNIPAE---
-DAETKA---------KAETLKLEGNKAMACKDFDLAIKKYSDAIEVL-----PTNAVYY
ANRAAAHSSMKAYEEAIKDAESAIKTD----PTYSKGYSRLGYAKFALGQAEDALEAYKK
VLDI-----EGDKASDVMKRDYETAK------KKVEQSLDLE--KKPETQARG---AD--
AGAGG---------------------AGGSG------GFG--DFASML------------
-GGGLGGL---LNNPQLMQAAQQMMQ--NPQAMSQMESMMQNPGVRQMAENFAQ---GNG
MPNMGDLMNNPALRDMAGSLFGGANGNAPNDVPKNSDNGSN-------
>KLLA0D01155g
---MSLSNKEIAALIVDFLSS--SSSSVNEDYVDSLNVAIDCITEAFQFERDETDSLI-S
GPFNGKKLPELLASA---PSSGGVSGEP---------------------VKVHIPVE---
-DAAAKA---------KAEELKLQGNKAMAAKKFDEAIEKYTAAIEVS-----PSNAVYY
SNRAAAYSSLKQYEQAVKDAEQAIEVD----PTYSKGFSRLGFAKYALNKPEEALDAYKK
VLDI-----EGEKATDVMKRDYETAK------KKVETSMNLE--KSSTSASSE-DVSDKS
ATEGP---------------------GAGAG------GLP--DLSSLLG--------GGG
LGGGLGAL---LNNPQVMQAAEKMMQ--NPGLM---QDMMSNPAMKQMANQFSS---GGG
MPDLSQMMNDPSIRDMAKNMFGGGNGSQQ-------------------
>Suva_15.182
---MSASKEEIASLIVNYFSSIVEKKEVSEDSADSLNVAMDCISEAFGFERDAVSSILDK
STFKGQSLNNLLSSS--SKLPESGKKDD------------------AQNVEVNIPEE---
-DAETKA---------KAEELKIQGNKAMANKEYELAIKKYTEAIDVL-----PTNAIYY
ANRAAAHSSLKEYDEAIKDAESAISVD----PSYFRGYSRLGFAKYAQGKPEEALEAYKK
VLDI-----EGDNATDAMKRDYESAK------KRVEQSLNLE--KTAPEQPRD---AG--
ANAGQ---------------------GAGAG------GLP--DLGSLL------------
-GGGLGGL---MNNPQLMQAAQKMMS--NPGAMQNIQNMMQDPSIRQMAEGFTS---GGG
TPNLSDLMKNPALRNMAGSLFGGADAPSTEDTPDSETKQ---------
>Skud_15.168
---MSASKGEIASLIVNYFSSIVEKKEISEDSADSLNVAMDCISEAFGFEREAVPSILEN
SEFKGQNLTDLLNST--SRVSESTKKDD------------------AQNVEVNIPEE---
-DAEIKA---------KAEDLKMQGNKAMANKDYELAINKYTEAIKVL-----PTNAIYY
ANRAAAHSSLKGYDEAVEDAESAISID----PTYFRGYSRLGFAKYAQGKPEEALEAYKK
VLDI-----EGDNATEAMKRDYESAK------KKVEQSLNLE--KTVPEQSRD---ADAN
ADASQ---------------------GAGTS------GLP--DLGSLL------------
-GGGLGGL---MNNPQLMQAAQKMMS--NPGAMQNIQKMMQDPNIKQMAEGFTS---GGG
APNLSDLMNNPALRSMAGNLFGGAGAPSTEDTSDSENKQ---------
>Smik_15.176
---MLASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFERDAASGILGK
SEFKGKSLADVLNSA--SKASESNEKDD------------------AQNVEVNIPEE---
-DAETKA---------KAEDLKMQGNKAMANKDYELAINKYTEAIQVL-----PTNAIYY
ANRAAAHSSLREYDEAVKDAESSISID----PSYFRGYSRLGFAKYAQGKPEEALEAYKK
VLDI-----EGDNATEAMKRDYESAK------KKVEQSLNLE--KAVPEQSRD---AD--
ANASQ---------------------GAGSS------GLP--DLGSLL------------
-GGGLGGL---MNNPQLMQAAQKMMS--NPGAMQNIQKMMQDPSIRQMAEGFTS---GGG
APNLSDLMNNPALRNMAGNLFGGADAPSSEGTPDSENK----------
>YOR007C
---MSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGK
SEFKGQHLADILNSA--SRVPESNKKDD------------------AENVEINIPED---
-DAETKA---------KAEDLKMQGNKAMANKDYELAINKYTEAIKVL-----PTNAIYY
ANRAAAHSSLKEYDQAVKDAESAISID----PSYFRGYSRLGFAKYAQGKPEEALEAYKK
VLDI-----EGDNATEAMKRDYESAK------KKVEQSLNLE--KTVPEQSRD---AD--
VDASQ---------------------GASAG------GLP--DLGSLL------------
-GGGLGGL---MNNPQLMQAAQKMMS--NPGAMQNIQKMMQDPSIRQMAEGFAS---GGG
TPNLSDLMNNPALRNMAGNLFGGAGAQSTDETPDNENKQ---------
>KLTH0C11220g
---MNPTKKELASLIIDYLCRTAEGKEIGEDYIDSLNVAIDCVTEAFEVEKESASSVI-E
KSFGGQSLEQIVGAS--SKGPTATQQEP---------------------VKVNIPVE---
-DAEIKA---------KAEALKLEGNKAMATKDFEHAISKYSEAIRTL-----PSNAVYF
ANRAAAYSSLKKYAEAVEDAEAAIKVN----PSYSKGYSRLGFAQYALGRPEEALDAYKK
VLDI-----EGSNATDAMKRDYDTAM------KKVEQSLNVE--RSAPAASNA-------
-ESPD---------------------AAGGS------GFP--DIASML---------GGG
LGGGLGGL---LKNPQVMQAAQQMMQ--NPNAM---QEMMSNPAIKQMADKFQS---GGG
TPSMADLMNNPALMDMAKNMFGGPKQ----------------------
>Kwal_56.22433
---MSPSNKDLANLIVDFLSHTVENKEVSEDYVDSLNVAIDCITEAFEFDRESVATTL-E
KTFAGRSLKQVVEAA---SVGSSSPQES---------------------VKVNIPVE---
-DAETKA---------KAESLKLEGNKAMAAKDFEQAVLKYSEAIQVL-----PTNAVYY
ANRAAAHSSLKKYEEAVKDAEDAIKVN----PSYSKGYSRLGFAQYALGKPEEALDAYKK
VLDI-----EGEAATDAMKRDYDTAM------KKVGQSLNVE--KSAPAATRD-------
-GAGS---------------------ATGSG------GLP--DISSML------------
-GGGLGGL---LNNPQLMQAAQQMMQ--NPNAM---QEVMNNPAVKQMAEKFQS---GGG
TPSMADLMNNPALMDMAKNMFGGGKQ----------------------
>SAKL0E01210g
---MAQSNKEIAALIVDFLSSTVEKNAVSEDYADSLNVAIDCISEAFEFERDAVSEIV-K
NSFDNRKLDELLKSA---ATALPTQSEP---------------------VKVNIPAE---
-DANTKA---------KAEDLKLQGNKAMASKDFETAIKKYTEAIEVL-----PSNAVYY
ANRAAAYSSLKKYEESVQDAESAIKVN----PSYSKGYSRLGFAKYALGKPEEALEAYKT
VLDI-----EGDKATDVMKRDYETAK------RKVEQSLNLE--KSVPTQTDE---QE--
SSTDA---------------------GAGAS------GFP--DMASLL------------
-GGGLGGL---LNNPQVMSAAQKLMQ--NPGAM---DEMMKNPAVRQMAENFSS---GGG
TPNLGDLMSNPAIKDMAKNLFGPN------------------------
>Kpol_1037.26
---MSVSNKDIAALIIDFLSTVVDKNEVSEDNADSLNVAMDCIAEAFEFERDSVAGVV-K
SSFQGNSLSSYLNGSTSASAATTTADET---------------------VKVNVTED---
-DTEASE---------AAEALKLEGNKAMAGKDYELAIKKYTEAIATL-----PTNAVYF
ANRAAAYSSLKKYDEAVEDANSAIKIN----PTYSKGYSRLGFAKFAQGKAEDALEAYKK
VLDI-----EGDKATEMMKRDYETAK------KKVEQSLNLE--KSTVSGNAT-AESDSA
SAADP---------------------FAGMG------GMP--DFSSML---------G--
-GGGLGNL---LNNPQLMQAAQQMMQ--DPEAMKQVESMMQNPSVKQMADQFSS---GNG
TPDFSALMNDPSIRDMAKNMFGNGGFQGAPPS----------------
>TPHA0J00340
---MAASNKEIAALIVDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTV-K
SAFNGNGLTSFLSGS---------ATND---------------------IQVNIADD--A
ADEEQKA---------TAEGLKLEGNKAMATKDYESAIKKYSEAIEVL-----PTNAVYY
ANRAAAYSSLKKYDDAVNDAESAIKVN----PTYSKGYSRLGFAKFAQGKVEDALDAYKK
VLDI-----EGDKATDIMKRDYETAK------KKVEQSLNLE--KVTPKEAETESNADAG
TGAAG---------------------MGGMG------GFP--DLSSML---------GGG
LGGGLGDL---LKNPQIMQAAQQMMQ--NPNAMQQMESMMQNPAVRQMAENFAS---GEG
TPDLSAMMNNPDLKDMAKNMFGNGGFPGAPK-----------------