MUSCLE (3.8) multiple sequence alignment

KAFR0L00390        ------------------------------------------MAKGKGKNKLGK--TGGN
TBLA0A07250        --------------------------------------------MAKGKNKGHE--ERSN
KLTH0C11264g       -----------------------------------------MAKSSKGKGSNKQ---RGA
Kwal_56.22421      -----------------------------------------MRKGGRSNKGSNK--VRTG
Ecym_3023          --------------------------------------------MGKGRNKDYD----KN
NDAI0D00790        MMYHHPLRRVIIIDQEIRLSLPNLRQTKTRGDGTEEEHIFITIKMGKGKNKSRDDGPKNP
NCAS0H00810        --------------------------------------------MGKGKNKKRDDGDSKG
ACR007W            --------------------------------------------MAKGKNKKTE---ERQ
CAGL0E02717g       ------------------------------------------MAKGKGKNKSHD--EGRS
KLLA0D01111g       --------------------------------------------MGKGKNKESS---TRP
KNAG0M01150        ------------------------------------------MAKGKGKNKSRG--DETS
Skud_15.167        --------------------------------------------MGKGKNKTHE--PKNE
Suva_15.181        --------------------MTIELLGTPELKALHCRAFYRATKMGKGKNKTHE--PKNG
Smik_15.175        --------------------------------------------MGKGKNKAHE--PKNG
YOR006C            --------------------------------------------MGKGKNKMHE--PKNG
TDEL0G04500        --------------------------------------------MSKGKNKNRE--AKNG
SAKL0E01144g       --------------------------------------------MGKGKNKNHE--ERSS
ZYRO0C07832g       --------------------------------------------MGKGKNKNHE--VRST
Kpol_1037.24       --------------------------------------------MAKGKNKQHE--ARTG
TPHA0J00320        --------------------------------------------MAKGKNKSSE--TRSG
                                                                ....           

KAFR0L00390        GAIRTNSNGHHSRHNNKKMEFKQ------------------HVSRETSFPVKLAMWDFDH
TBLA0A07250        R----------KSNNSRRNESKHSL------------S---IKSTKTNFPVKLAMWDFDH
KLTH0C11264g       H-SSKPSSGHTS--THRHVESKHG-----------------ANKSGKNFPVKLAMWDFDQ
Kwal_56.22421      H-SNRSSSGY--------VETKHG-----------------AHNNGRNFPVKLAMWDFDQ
Ecym_3023          H-SQKGSNGHSSRTNHRRIETKY------------------NAIQGSKFPVTLAMWDFDH
NDAI0D00790        R-AHRGANGHSSRHNHKNMEMKKHNDFTSTQMVNDNDDGIDEIHSVKKIPVKLGMWDFDH
NCAS0H00810        R-QHRGANGHSSRHNHKNMEMRKHE------------NE--DTSNVKKIPVKLGMWDFDH
ACR007W            K-PAKGSSKHNGKSNQRRTELKH------------------GHTKETEFPAKLAMWDFDH
CAGL0E02717g       N-KSGGSNGHHTRRNHRHMEMKYC-----------------GGSKDSSFPVKLAMWDFDH
KLLA0D01111g       R-SQKGSNGHSSRLNHKRMEMKH------------------VDSTTSKFPVKLAMWDFDH
KNAG0M01150        RGSHKGSNGHSSRLNHKRMELRQH-----------------DGVKGTKFPVKMAMWDFDH
Skud_15.167        R-QQRGANGHSARQNHKHMEMKY------------------DKSEKMKFPVKLAMWDFDH
Suva_15.181        R-PQRGANGHSSRQNHKRMEMKY------------------DNSEMTNFPVKLAMWDFDH
Smik_15.175        R-PQRGANGHSSRQNHRRMEMKY------------------ENSDKVKFPVKLAMWDFDH
YOR006C            R-PQRGANGHSSRQNHRRMEMKY------------------DNSEKMKFPVKLAMWDFDH
TDEL0G04500        H-SGKGSNGHSSRQNHKRMEMK-------------------RGTEDTKFPVKLAMWDFDH
SAKL0E01144g       R-PHRGANGHSSRLNHKRMEMKRGG----------------DSSAGNKFPVKLAMWDFDH
ZYRO0C07832g       R-PGRGANGHNSKQNHKHMEMKHGG------------A---SNSNKTNFPVKLGMWDFDH
Kpol_1037.24       K-PSRGSNGHSSKLNHKHMEMKKYG------------K---NISQDDKFPVKLAMWDFDH
TPHA0J00320        K-PSRGSNGHHTRTNHKRMEMKFSN------------AGTGANSKEAGFPVKLAMWDFDH
                                      * .                          :*..:.*****:

KAFR0L00390        CDPKRCSGKKLERLNLIRSLKINQKFQGITVSPNGKKFVSPEDRELVTEFGCAVVECSWA
TBLA0A07250        CDPKRCSGKKLERTGLAQSLRVGQRFNGMVVSPNGKRVVSPADRETIEQYGIAVVECSWA
KLTH0C11264g       CDPKRCSGKKLERLGIIKSLRVGQKFQGIVVSPNGKSVVCPNDRNIVEENGAAVVECSWA
Kwal_56.22421      CDPKRCSGKKLERLGIIKSLRVGQKFQGIVVSPNGKGVVCPNDKQIVEESGAAVVECSWA
Ecym_3023          CDPKRCSGKKLERLGLIKSLRVKQKFQGIVVSPNGKTVVCPNDREIAEKYGVSVVECSWA
NDAI0D00790        CDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPDDADIIKEFGAAVVECSWA
NCAS0H00810        CDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPEDADIIKEFGAAVVECSWA
ACR007W            CDPKRCSGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSWA
CAGL0E02717g       CDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKSVVCPDDREIVEAHGASVVECSWA
KLLA0D01111g       CDPKRCSGKKLERLGLIKSLRVGQKFQGVVVSPNGKTVVCPDDKALVEENGASVVECSWA
KNAG0M01150        CDPKRCSGKKLERLGLITSLKVGQKFQGIVVSPNGQGVVCPDDRAIVEEFGASVVECSWA
Skud_15.167        CDPKRCSGKKLERLGLIRSLRVGQKFQGVVVSPNGQGVVCPNDLEIVEQHGASVVECSWA
Suva_15.181        CDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGNGVVCPDDLEVVEQHGASVVECSWA
Smik_15.175        CDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEVVEQHGASVVECSWA
YOR006C            CDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEIVEQHGASVVECSWA
TDEL0G04500        CDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGSGVVCPDDKSIVEEHGASVVECSWA
SAKL0E01144g       CDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGRGVVCPNDRVIVEEHGASVVECSWA
ZYRO0C07832g       CDPKRCSGKKLERLGLIRSLRVGQKFQGVVVTPNGTGVVCPNDKSIVEEHGASVVECSWA
Kpol_1037.24       CDPKRCSGKRLERLGLIKSLRVGQKFQGVVVSPNGKGVLCPNDREIVEEFGASVVECSWA
TPHA0J00320        CDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDKETVEEFGASVVECSWA
                   *********.*** .:  **.: *.*:*: ::***  .:.* *       * :*******

KAFR0L00390        RIDEIPFSKF---STPK--LDRLLPYLVAANQVNYGRPWKLNCVEAIAACLAIVGFMDLA
TBLA0A07250        RLDEVPFNKL----GGKPSNEVLLPYLVAANPVNYGRPWRLNCVEAFAACLAIVGFKEYA
KLTH0C11264g       RLDEVPFNKI----GGR--NERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRLDLA
Kwal_56.22421      RLNEIPFNKI----GGR--NERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLA
Ecym_3023          RLEEIPFEKI----GGR--HERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLA
NDAI0D00790        RLDEIPFSKLNGGNGGK--NERLLPYLVAANQVNYGRPWKLNCVEALAACFAIIGRSDWA
NCAS0H00810        RLDEIPFSKLNGGNGGK--NERLLPYLVAANQVNYGRPWKLNCVEALAACFAIIGRSDWA
ACR007W            RLDEIPFSKI----GGR--HERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLA
CAGL0E02717g       RLEEVPFNKI----GGK--HERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLA
KLLA0D01111g       RLDEVPFNKI----GGK--NERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLA
KNAG0M01150        RLDEVPFNRI----GGK--HERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLA
Skud_15.167        RLEEVPFNKI----GGK--YERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGKMDWA
Suva_15.181        RLEEVPFNKI----GGK--HERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWA
Smik_15.175        RLEEVPFNKI----GGK--HERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWA
YOR006C            RLEEVPFNKI----GGK--HERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWA
TDEL0G04500        RLDEVPFNKI----GGK--HERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWA
SAKL0E01144g       RLDEVPFGRI----GGK--HERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLA
ZYRO0C07832g       RLDEVPFNRI----GGR--HERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWA
Kpol_1037.24       RLDEVPFNKI----GGK--HERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWA
TPHA0J00320        RLDEVPFNKI----GGK--HERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRVDLA
                   *::*:** .:      .   : ********* *******.******:***:**:*  : *

KAFR0L00390        EELLSHFSWGVNFLKLNRELLEIYQQCTDSDEIEAAQDAWMDQIEKEVQERKASNNAQNV
TBLA0A07250        SKVLEGFSWGHAFLELNDELLDIYGNCTDSISVEKAQDEWLEKIELENKERK--EKMNSA
KLTH0C11264g       TELLSHFSWGLQFLELNKELLEVYQRCTDADSIKKAEDAWLEQIEKEAQERK--ARNPGD
Kwal_56.22421      TELLAHFSWGLGFLELNKELIEVYQKCTDAESVKEAEASWLEKIEREANERR--NHSATD
Ecym_3023          ETLLSHFSWGLGFLELNKEILEIYQKCTDHDSIKAAEEAWLKQIETEAMERR--KQTKEN
NDAI0D00790        SDLLSNFSWGLNFLKLNEELFELYSKCTDSDSVKAAQEEWLDKIEQEATERK--LQAQET
NCAS0H00810        ADLLSNFSWGMNFLTLNEELFELYSQCTDSDSIQEAQEAWLNKIDEEAKERK--LQAQDN
ACR007W            EELLSHFSWGPGFLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRR--KQTHEE
CAGL0E02717g       HELLSHFSWGLGFLELNKDLLERYQQCTDSESIKKVEEDWLQQIDQEVQERK--LKAQTE
KLLA0D01111g       ADLLSNFSWGPAFLELNKELLDIYQQCTDHDSVKAAEEKWLQKIEQEAIERK--QQAKTE
KNAG0M01150        SDLLSNFSWGLGFLELNKELLEVYQKCTDHESVKKAEEDWLNKIEEEAQQRK--NEARDG
Skud_15.167        SELLSHFSWGLGFLDLNKELLEIYQRCTDADSVKKAEKEWLEKLEMETQERK--SHTKKT
Suva_15.181        SGLLSHFSWGLGFLDLNRELLEIYQKCTDSNSVKKAEEEWLQKLEKETQERK--SQSKDE
Smik_15.175        SELLSHFSWGMGFLELNKELLEIYQQCTDADSVKRAEEEWLQKLEKETQERK--SQAKEE
YOR006C            SELLSHFSWGMGFLELNKELLEIYQQCTDCDSVKRAEEEWLQKLEKETQERK--SRAKEE
TDEL0G04500        SELLSHFSWGLGFLELNQELLEIYQQCTDADSVKAAESAWLVKIQKEVEERK--SQAKDE
SAKL0E01144g       SELLSNFSWGLGFLELNKELLEIYQQCTDADSVKAAEEAWLKKIEEEAQQRK--QQSKEE
ZYRO0C07832g       SELLSNFSYGPSFLEINAELLEIYQQCTDAESVKDAESAWLEKIEKEIKDRK--AQAKNE
Kpol_1037.24       AELLSNFSWGLGFLEINEELLKIYQQCTDSESVKKAEEEWLAKIEQEIQERK--TQARES
TPHA0J00320        AELLEHFSWGLGFLELNKELLEMYQKCTDSESVKKVEEEWLEKIDKEVQERK--SQSREG
                     :*  **:*  ** :* :::. * .***  .:: .:  *: ::: *  :*.        

KAFR0L00390        DIWMSGNVNRIDESDEDNEDEDSE----------------------------DEEVTYDN
TBLA0A07250        DAWLIGNTNRKNLNDFDNSS-------------------------------------EST
KLTH0C11264g       DLWLTGNVNHKKGHGVTQNENKDE-----------------AEVGSTWEQGENSE--YES
Kwal_56.22421      DLWMTGNVNRRSPLGNDTESSQEE-----------------SE--NSVDTGDEED--DDN
Ecym_3023          DIWMMGNVNRKN-----ASKELHP----------------------------YSD--IDD
NDAI0D00790        DIWMMGNTNRLDANLRSMNISDED----------------------------EEE--EEE
NCAS0H00810        DIWLMGNTNRVNDNLRDLTLSDGD-----------------------------ED--EEE
ACR007W            DIWMMGNVNRKAPNMRSSMLDSDD--------------NSDSEYASDVDHDLVSD--TEE
CAGL0E02717g       DVWMMGNTNRGNSGLMPPSDSEEE----------------------------YEE--EAE
KLLA0D01111g       DIWMIGNVNRASRDL--PGSSGE-----------------------------EEE--EDY
KNAG0M01150        DIWMMGNVNRNMNKMTL----------------------------------------SDE
Skud_15.167        DIWMMGNINRRGNGVQSDELESG----------------------------------EDS
Suva_15.181        DIWMMGNVNRKDNGAQSDESESE----------------------------------EDS
Smik_15.175        DIWMMGNINRRGGGWQSDESESG----------------------------------GSS
YOR006C            DIWMMGNINRRGNGSQSDTSESE----------------------------------ENS
TDEL0G04500        DIWMTGNVNRKGTTFLDDNEEEES------------------------------S--EVE
SAKL0E01144g       DIWMMGNVNRRRTCDTSEEEEEEE------------------------------E--EEE
ZYRO0C07832g       DIWMTGNVNRMPAASQESDEEEDE------------------------------D--EDE
Kpol_1037.24       DIWMMGNTNRNMNGD--DDEEEGNSYEALSGDDYEEENNNKSARYDNLGNIIESE--EDY
TPHA0J00320        DIWLQGNTNRDLQDMSDDEEFDSE-------QYYSEENTERKIRYDNLGNVLISE--EEN
                   * *: ** *.                                                  

KAFR0L00390        LGNIIENEP---REVR--YDNLGNIIEESSEESSG----EEEEDEEEDV-----------
TBLA0A07250        EDNISTVSS---ADER--YDALGNLIS----------------NDSHSL-----------
KLTH0C11264g       DESAADGEEAYHGPVK--YDSLGNEITLSESSDP-----EYSDSEELLE-----------
Kwal_56.22421      EDDYATGNR--KRVVK--YDNLGNEIYPSESSESSEERDDLDEQEEVKY-----------
Ecym_3023          IDEDETSDF---KSDL--SDSNNDLCVANIS--------KEDNNKEYGL-----------
NDAI0D00790        YDEEEDGGEHITRNKELRYDNLGNVIEDTDE--------EYLSEEEKEI-----------
NCAS0H00810        EDAEDYLTE---KSVK--YDNLGNVIE--------------SSEDEITL-----------
ACR007W            GEDIAIGSK---RDVT--YDSLGNVIENGRR-----------------------------
CAGL0E02717g       EEEEDTTTR---KNVR--YDNLGNIIEDSED--------DNNESDYSNE-----------
KLLA0D01111g       LNGDSLIDV---RDIK--YDSLGNVISYNDE--------EEDEEGEGEV-----------
KNAG0M01150        ESDEEETEA---SSIR--YDNLGNAIIDES---------DEEEPEISSI-----------
Skud_15.167        EQSGLENSE---QPIE--YDALGNAIHVDS---------VKSRIMLSGV-----------
Suva_15.181        DQSELESDK---QSIE--YDSLGNAICIDN---------VKSRKMLSEG-----------
Smik_15.175        GESESEGDK---QCVE--YDSLGNAICIDS---------INSRKSLSEE-----------
YOR006C            EQSDLEGNN---QCIE--YDSLGNAIRIDN---------MKSREAQSEE-----------
TDEL0G04500        ESDEEEDNG---KTLR--YDRLGNLIES-----------DSGDEESSEE-----------
SAKL0E01144g       EEEEEEEEE---EEEE--EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE
ZYRO0C07832g       EEEEEEEEE---EEKE--EDVKEDVSVA--------------------------------
Kpol_1037.24       DDYDDEEDR---VEVK--YDSLGNIIENSD---------YEQYEEEKEL-----------
TPHA0J00320        ESEEEEEVR---------YDALGNIIE--------------SEEEAAEL-----------
                                      :   :                                    

KAFR0L00390        ------------------------------------------------------KYDSLG
TBLA0A07250        ------------------------------------------------------KYDSLG
KLTH0C11264g       ------------------------------------------------------EPDFLG
Kwal_56.22421      ------------------------------------------------------KFDSLG
Ecym_3023          ------------------------------------------------------VYRSPS
NDAI0D00790        ------------------------------------------------------RYDNLG
NCAS0H00810        ------------------------------------------------------RYDNLG
ACR007W            ------------------------------------------------------EFVPET
CAGL0E02717g       ------------------------------------------------------ESSDEA
KLLA0D01111g       ------------------------------------------------------SEHELA
KNAG0M01150        ------------------------------------------------------RYDNLG
Skud_15.167        ------------------------------------------------------SEDEES
Suva_15.181        ------------------------------------------------------SEDEES
Smik_15.175        ------------------------------------------------------SEDEEN
YOR006C            ------------------------------------------------------SEDEES
TDEL0G04500        ------------------------------------------------------ELEEAG
SAKL0E01144g       EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEERCEKMPQENEYDSLG
ZYRO0C07832g       ------------------------------------------------------------
Kpol_1037.24       ------------------------------------------------------RYDSLG
TPHA0J00320        ------------------------------------------------------KYDSLG
                                                                               

KAFR0L00390        NVIEESESL---------------------------------QKKLDGLNI-------
TBLA0A07250        NVIESEGDALPPK-----------------------------YDKLGNIIEDN-----
KLTH0C11264g       DNSFSNDSDIRDV-----------------------------TVGLSKVAIKGDVTEQ
Kwal_56.22421      NIIGKEHENGTL------------------------------NESLSKLTIEGK----
Ecym_3023          EISSDRDCIKDNTSFEVDFLGTKSQNSDKCKDKILLNSLNYVDNKIRNLSLDLEENI-
NDAI0D00790        NIIESEEEEEEEKEEGIELR----------------------YDSLGNIIE-------
NCAS0H00810        NVIEEEEEEKR-------------------------------YDALGNLIEN------
ACR007W            KILESDEEDQQ-----------------------------------------------
CAGL0E02717g       SDEDYEDEHVDEV-----------------------------VNRVGKLAIE------
KLLA0D01111g       NEDIGISCELS-------------------------------SLSLQDTV--------
KNAG0M01150        NVIVDESDEEASSST-------------------------------------------
Skud_15.167        DFGENEKPVN--------------------------------YDSLGNLI--------
Suva_15.181        EFEEDEEPVS--------------------------------YDSLGNII--------
Smik_15.175        DLEENKEPVS--------------------------------YDSLGNLI--------
YOR006C            GSKENGEPLS--------------------------------YDPLGNLIR-------
TDEL0G04500        GSVEKVYI--------------------------------------------------
SAKL0E01144g       NIIEKHSKETDFKTTRHNSFGSTTSSEEDEYIEELHTKKEAKYDSFGNISEGVQNLSL
ZYRO0C07832g       ----------------------------------------------------------
Kpol_1037.24       NLIESEGEISSEEEDEVGDEDEVDYE----------------EDKIEHKMENLKV---
TPHA0J00320        NLIEDDEQEV--------------------------------EEDLARTTEKLKKLET
                                                                             

FASTA FORMAT for MUSCLE Version 3.6

>KAFR0L00390
------------------------------------------MAKGKGKNKLGK--TGGN
GAIRTNSNGHHSRHNNKKMEFKQ------------------HVSRETSFPVKLAMWDFDH
CDPKRCSGKKLERLNLIRSLKINQKFQGITVSPNGKKFVSPEDRELVTEFGCAVVECSWA
RIDEIPFSKF---STPK--LDRLLPYLVAANQVNYGRPWKLNCVEAIAACLAIVGFMDLA
EELLSHFSWGVNFLKLNRELLEIYQQCTDSDEIEAAQDAWMDQIEKEVQERKASNNAQNV
DIWMSGNVNRIDESDEDNEDEDSE----------------------------DEEVTYDN
LGNIIENEP---REVR--YDNLGNIIEESSEESSG----EEEEDEEEDV-----------
------------------------------------------------------KYDSLG
NVIEESESL---------------------------------QKKLDGLNI-------
>TBLA0A07250
--------------------------------------------MAKGKNKGHE--ERSN
R----------KSNNSRRNESKHSL------------S---IKSTKTNFPVKLAMWDFDH
CDPKRCSGKKLERTGLAQSLRVGQRFNGMVVSPNGKRVVSPADRETIEQYGIAVVECSWA
RLDEVPFNKL----GGKPSNEVLLPYLVAANPVNYGRPWRLNCVEAFAACLAIVGFKEYA
SKVLEGFSWGHAFLELNDELLDIYGNCTDSISVEKAQDEWLEKIELENKERK--EKMNSA
DAWLIGNTNRKNLNDFDNSS-------------------------------------EST
EDNISTVSS---ADER--YDALGNLIS----------------NDSHSL-----------
------------------------------------------------------KYDSLG
NVIESEGDALPPK-----------------------------YDKLGNIIEDN-----
>KLTH0C11264g
-----------------------------------------MAKSSKGKGSNKQ---RGA
H-SSKPSSGHTS--THRHVESKHG-----------------ANKSGKNFPVKLAMWDFDQ
CDPKRCSGKKLERLGIIKSLRVGQKFQGIVVSPNGKSVVCPNDRNIVEENGAAVVECSWA
RLDEVPFNKI----GGR--NERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRLDLA
TELLSHFSWGLQFLELNKELLEVYQRCTDADSIKKAEDAWLEQIEKEAQERK--ARNPGD
DLWLTGNVNHKKGHGVTQNENKDE-----------------AEVGSTWEQGENSE--YES
DESAADGEEAYHGPVK--YDSLGNEITLSESSDP-----EYSDSEELLE-----------
------------------------------------------------------EPDFLG
DNSFSNDSDIRDV-----------------------------TVGLSKVAIKGDVTEQ
>Kwal_56.22421
-----------------------------------------MRKGGRSNKGSNK--VRTG
H-SNRSSSGY--------VETKHG-----------------AHNNGRNFPVKLAMWDFDQ
CDPKRCSGKKLERLGIIKSLRVGQKFQGIVVSPNGKGVVCPNDKQIVEESGAAVVECSWA
RLNEIPFNKI----GGR--NERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLA
TELLAHFSWGLGFLELNKELIEVYQKCTDAESVKEAEASWLEKIEREANERR--NHSATD
DLWMTGNVNRRSPLGNDTESSQEE-----------------SE--NSVDTGDEED--DDN
EDDYATGNR--KRVVK--YDNLGNEIYPSESSESSEERDDLDEQEEVKY-----------
------------------------------------------------------KFDSLG
NIIGKEHENGTL------------------------------NESLSKLTIEGK----
>Ecym_3023
--------------------------------------------MGKGRNKDYD----KN
H-SQKGSNGHSSRTNHRRIETKY------------------NAIQGSKFPVTLAMWDFDH
CDPKRCSGKKLERLGLIKSLRVKQKFQGIVVSPNGKTVVCPNDREIAEKYGVSVVECSWA
RLEEIPFEKI----GGR--HERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLA
ETLLSHFSWGLGFLELNKEILEIYQKCTDHDSIKAAEEAWLKQIETEAMERR--KQTKEN
DIWMMGNVNRKN-----ASKELHP----------------------------YSD--IDD
IDEDETSDF---KSDL--SDSNNDLCVANIS--------KEDNNKEYGL-----------
------------------------------------------------------VYRSPS
EISSDRDCIKDNTSFEVDFLGTKSQNSDKCKDKILLNSLNYVDNKIRNLSLDLEENI-
>NDAI0D00790
MMYHHPLRRVIIIDQEIRLSLPNLRQTKTRGDGTEEEHIFITIKMGKGKNKSRDDGPKNP
R-AHRGANGHSSRHNHKNMEMKKHNDFTSTQMVNDNDDGIDEIHSVKKIPVKLGMWDFDH
CDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPDDADIIKEFGAAVVECSWA
RLDEIPFSKLNGGNGGK--NERLLPYLVAANQVNYGRPWKLNCVEALAACFAIIGRSDWA
SDLLSNFSWGLNFLKLNEELFELYSKCTDSDSVKAAQEEWLDKIEQEATERK--LQAQET
DIWMMGNTNRLDANLRSMNISDED----------------------------EEE--EEE
YDEEEDGGEHITRNKELRYDNLGNVIEDTDE--------EYLSEEEKEI-----------
------------------------------------------------------RYDNLG
NIIESEEEEEEEKEEGIELR----------------------YDSLGNIIE-------
>NCAS0H00810
--------------------------------------------MGKGKNKKRDDGDSKG
R-QHRGANGHSSRHNHKNMEMRKHE------------NE--DTSNVKKIPVKLGMWDFDH
CDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPEDADIIKEFGAAVVECSWA
RLDEIPFSKLNGGNGGK--NERLLPYLVAANQVNYGRPWKLNCVEALAACFAIIGRSDWA
ADLLSNFSWGMNFLTLNEELFELYSQCTDSDSIQEAQEAWLNKIDEEAKERK--LQAQDN
DIWLMGNTNRVNDNLRDLTLSDGD-----------------------------ED--EEE
EDAEDYLTE---KSVK--YDNLGNVIE--------------SSEDEITL-----------
------------------------------------------------------RYDNLG
NVIEEEEEEKR-------------------------------YDALGNLIEN------
>ACR007W
--------------------------------------------MAKGKNKKTE---ERQ
K-PAKGSSKHNGKSNQRRTELKH------------------GHTKETEFPAKLAMWDFDH
CDPKRCSGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSWA
RLDEIPFSKI----GGR--HERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLA
EELLSHFSWGPGFLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRR--KQTHEE
DIWMMGNVNRKAPNMRSSMLDSDD--------------NSDSEYASDVDHDLVSD--TEE
GEDIAIGSK---RDVT--YDSLGNVIENGRR-----------------------------
------------------------------------------------------EFVPET
KILESDEEDQQ-----------------------------------------------
>CAGL0E02717g
------------------------------------------MAKGKGKNKSHD--EGRS
N-KSGGSNGHHTRRNHRHMEMKYC-----------------GGSKDSSFPVKLAMWDFDH
CDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKSVVCPDDREIVEAHGASVVECSWA
RLEEVPFNKI----GGK--HERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLA
HELLSHFSWGLGFLELNKDLLERYQQCTDSESIKKVEEDWLQQIDQEVQERK--LKAQTE
DVWMMGNTNRGNSGLMPPSDSEEE----------------------------YEE--EAE
EEEEDTTTR---KNVR--YDNLGNIIEDSED--------DNNESDYSNE-----------
------------------------------------------------------ESSDEA
SDEDYEDEHVDEV-----------------------------VNRVGKLAIE------
>KLLA0D01111g
--------------------------------------------MGKGKNKESS---TRP
R-SQKGSNGHSSRLNHKRMEMKH------------------VDSTTSKFPVKLAMWDFDH
CDPKRCSGKKLERLGLIKSLRVGQKFQGVVVSPNGKTVVCPDDKALVEENGASVVECSWA
RLDEVPFNKI----GGK--NERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLA
ADLLSNFSWGPAFLELNKELLDIYQQCTDHDSVKAAEEKWLQKIEQEAIERK--QQAKTE
DIWMIGNVNRASRDL--PGSSGE-----------------------------EEE--EDY
LNGDSLIDV---RDIK--YDSLGNVISYNDE--------EEDEEGEGEV-----------
------------------------------------------------------SEHELA
NEDIGISCELS-------------------------------SLSLQDTV--------
>KNAG0M01150
------------------------------------------MAKGKGKNKSRG--DETS
RGSHKGSNGHSSRLNHKRMELRQH-----------------DGVKGTKFPVKMAMWDFDH
CDPKRCSGKKLERLGLITSLKVGQKFQGIVVSPNGQGVVCPDDRAIVEEFGASVVECSWA
RLDEVPFNRI----GGK--HERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLA
SDLLSNFSWGLGFLELNKELLEVYQKCTDHESVKKAEEDWLNKIEEEAQQRK--NEARDG
DIWMMGNVNRNMNKMTL----------------------------------------SDE
ESDEEETEA---SSIR--YDNLGNAIIDES---------DEEEPEISSI-----------
------------------------------------------------------RYDNLG
NVIVDESDEEASSST-------------------------------------------
>Skud_15.167
--------------------------------------------MGKGKNKTHE--PKNE
R-QQRGANGHSARQNHKHMEMKY------------------DKSEKMKFPVKLAMWDFDH
CDPKRCSGKKLERLGLIRSLRVGQKFQGVVVSPNGQGVVCPNDLEIVEQHGASVVECSWA
RLEEVPFNKI----GGK--YERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGKMDWA
SELLSHFSWGLGFLDLNKELLEIYQRCTDADSVKKAEKEWLEKLEMETQERK--SHTKKT
DIWMMGNINRRGNGVQSDELESG----------------------------------EDS
EQSGLENSE---QPIE--YDALGNAIHVDS---------VKSRIMLSGV-----------
------------------------------------------------------SEDEES
DFGENEKPVN--------------------------------YDSLGNLI--------
>Suva_15.181
--------------------MTIELLGTPELKALHCRAFYRATKMGKGKNKTHE--PKNG
R-PQRGANGHSSRQNHKRMEMKY------------------DNSEMTNFPVKLAMWDFDH
CDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGNGVVCPDDLEVVEQHGASVVECSWA
RLEEVPFNKI----GGK--HERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWA
SGLLSHFSWGLGFLDLNRELLEIYQKCTDSNSVKKAEEEWLQKLEKETQERK--SQSKDE
DIWMMGNVNRKDNGAQSDESESE----------------------------------EDS
DQSELESDK---QSIE--YDSLGNAICIDN---------VKSRKMLSEG-----------
------------------------------------------------------SEDEES
EFEEDEEPVS--------------------------------YDSLGNII--------
>Smik_15.175
--------------------------------------------MGKGKNKAHE--PKNG
R-PQRGANGHSSRQNHRRMEMKY------------------ENSDKVKFPVKLAMWDFDH
CDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEVVEQHGASVVECSWA
RLEEVPFNKI----GGK--HERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWA
SELLSHFSWGMGFLELNKELLEIYQQCTDADSVKRAEEEWLQKLEKETQERK--SQAKEE
DIWMMGNINRRGGGWQSDESESG----------------------------------GSS
GESESEGDK---QCVE--YDSLGNAICIDS---------INSRKSLSEE-----------
------------------------------------------------------SEDEEN
DLEENKEPVS--------------------------------YDSLGNLI--------
>YOR006C
--------------------------------------------MGKGKNKMHE--PKNG
R-PQRGANGHSSRQNHRRMEMKY------------------DNSEKMKFPVKLAMWDFDH
CDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEIVEQHGASVVECSWA
RLEEVPFNKI----GGK--HERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWA
SELLSHFSWGMGFLELNKELLEIYQQCTDCDSVKRAEEEWLQKLEKETQERK--SRAKEE
DIWMMGNINRRGNGSQSDTSESE----------------------------------ENS
EQSDLEGNN---QCIE--YDSLGNAIRIDN---------MKSREAQSEE-----------
------------------------------------------------------SEDEES
GSKENGEPLS--------------------------------YDPLGNLIR-------
>TDEL0G04500
--------------------------------------------MSKGKNKNRE--AKNG
H-SGKGSNGHSSRQNHKRMEMK-------------------RGTEDTKFPVKLAMWDFDH
CDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGSGVVCPDDKSIVEEHGASVVECSWA
RLDEVPFNKI----GGK--HERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWA
SELLSHFSWGLGFLELNQELLEIYQQCTDADSVKAAESAWLVKIQKEVEERK--SQAKDE
DIWMTGNVNRKGTTFLDDNEEEES------------------------------S--EVE
ESDEEEDNG---KTLR--YDRLGNLIES-----------DSGDEESSEE-----------
------------------------------------------------------ELEEAG
GSVEKVYI--------------------------------------------------
>SAKL0E01144g
--------------------------------------------MGKGKNKNHE--ERSS
R-PHRGANGHSSRLNHKRMEMKRGG----------------DSSAGNKFPVKLAMWDFDH
CDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGRGVVCPNDRVIVEEHGASVVECSWA
RLDEVPFGRI----GGK--HERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLA
SELLSNFSWGLGFLELNKELLEIYQQCTDADSVKAAEEAWLKKIEEEAQQRK--QQSKEE
DIWMMGNVNRRRTCDTSEEEEEEE------------------------------E--EEE
EEEEEEEEE---EEEE--EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE
EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEERCEKMPQENEYDSLG
NIIEKHSKETDFKTTRHNSFGSTTSSEEDEYIEELHTKKEAKYDSFGNISEGVQNLSL
>ZYRO0C07832g
--------------------------------------------MGKGKNKNHE--VRST
R-PGRGANGHNSKQNHKHMEMKHGG------------A---SNSNKTNFPVKLGMWDFDH
CDPKRCSGKKLERLGLIRSLRVGQKFQGVVVTPNGTGVVCPNDKSIVEEHGASVVECSWA
RLDEVPFNRI----GGR--HERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWA
SELLSNFSYGPSFLEINAELLEIYQQCTDAESVKDAESAWLEKIEKEIKDRK--AQAKNE
DIWMTGNVNRMPAASQESDEEEDE------------------------------D--EDE
EEEEEEEEE---EEKE--EDVKEDVSVA--------------------------------
------------------------------------------------------------
----------------------------------------------------------
>Kpol_1037.24
--------------------------------------------MAKGKNKQHE--ARTG
K-PSRGSNGHSSKLNHKHMEMKKYG------------K---NISQDDKFPVKLAMWDFDH
CDPKRCSGKRLERLGLIKSLRVGQKFQGVVVSPNGKGVLCPNDREIVEEFGASVVECSWA
RLDEVPFNKI----GGK--HERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWA
AELLSNFSWGLGFLEINEELLKIYQQCTDSESVKKAEEEWLAKIEQEIQERK--TQARES
DIWMMGNTNRNMNGD--DDEEEGNSYEALSGDDYEEENNNKSARYDNLGNIIESE--EDY
DDYDDEEDR---VEVK--YDSLGNIIENSD---------YEQYEEEKEL-----------
------------------------------------------------------RYDSLG
NLIESEGEISSEEEDEVGDEDEVDYE----------------EDKIEHKMENLKV---
>TPHA0J00320
--------------------------------------------MAKGKNKSSE--TRSG
K-PSRGSNGHHTRTNHKRMEMKFSN------------AGTGANSKEAGFPVKLAMWDFDH
CDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDKETVEEFGASVVECSWA
RLDEVPFNKI----GGK--HERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRVDLA
AELLEHFSWGLGFLELNKELLEMYQKCTDSESVKKVEEEWLEKIDKEVQERK--SQSREG
DIWLQGNTNRDLQDMSDDEEFDSE-------QYYSEENTERKIRYDNLGNVLISE--EEN
ESEEEEEVR---------YDALGNIIE--------------SEEEAAEL-----------
------------------------------------------------------KYDSLG
NLIEDDEQEV--------------------------------EEDLARTTEKLKKLET