MUSCLE (3.8) multiple sequence alignment

ACR008W            MVIYPWLKNTTELTIALPKKPIIHANMDVLGSPRGGTPTGEHEINAQDGSPINFSPSPDF
KLLA0D01089g       -----------------------------------------------MNDCENFSPSPEF
TBLA0G01040        ----------------------------MNSSNEVIIPVSTTTKESPATTPKNFAPSPDF
KLTH0C11286g       ------------------------------MDGNGKCPSETDTSKISENEPHNFAPSPDF
Kwal_56.22414      ---------------MRTKNFGHGQGFRVFMLEANTENLAQQPGEVSQKKPQNFAPSPDF
CAGL0E02695g       -----------------------------MADEGGLETGAHDELKGTEEQAVNFAPSPDF
TPHA0M00260        -----------------------------------MTSVPNMNIDTSEREPRNFSPSPDF
KNAG0F02870        ------------------------------------------MSEKVEEGPTNFAPSPDF
Kpol_1032.7        --------------------MRNPTPILVSTNTNTNATFTSKADTNDIEEPHNFSPSPDF
Skud_15.166        ----------------------------------------MTPAPEFIPEPQNFAPSPDF
Suva_15.180        ----------------------------------------MASALQAIPEPHNFAPSPDF
Smik_15.174        ----------------------------------------MVSTLDSVPEPQNFAPSPDF
YOR005C            ----------------------------------------MISALDSIPEPQNFAPSPDF
KAFR0A05050        ----------------------------------------MDLTVPEVEVPRNFAPSPQF
NDAI0I02260        --------------------------------MDGKAVTPTLDNDTRPATPHNFAPSPSF
NCAS0D02650        ----------------------------------MSQQIQLSQEPPPVMTPCNFSPSPAF
ZYRO0C07854g       ----------------------------------------MSTKTDDQNKPHNFAPSPDF
TDEL0G04510        ------------------------MESAEILTSTHEVSQELQESESTEKAPPNFAPSPDF
                                                                       **:*** *

ACR008W            CWLCDELFIKLEEVA------LKKKDLGKPRKVRNLEITSNFVSLWRKTVGNDIYPALVL
KLLA0D01089g       KWLCDELLGKIYETS------SKKHLIGKPVTVRYLEIITNFIKLWRSTVGNYIYPALRL
TBLA0G01040        KWLCDELFVKIDKIREQIKNKTANTISNKPISTRYFDTITHFIKLWRTTIGDDIFPALRL
KLTH0C11286g       RWLCEELFHRLDAIN------EHRQELGKAVTVKRVEIITCFIKLWRTTVGDDFFPALRL
Kwal_56.22414      RWLCDELFSKLEEIT------EDRQKLGKAVTVKRVEVIMYFIKLWRTTVGDNIYPVLRL
CAGL0E02695g       LWLCEQLFAKIDHVQ----FERANNLLTKPVTARYYEVISNFTTLWRTTVGNNIYPALRL
TPHA0M00260        KWLCNELFVKLDEVR-----LKPKSVDTRPKNIQYDIVINNFIHLWRVTVGNDIYPALRL
KNAG0F02870        QWLCDELFVKFDLVA-----TQDRRINLKPITVRYYEVVSNFVQLWRKTVGNNFYPVLIL
Kpol_1032.7        KWLCDELFVKLDQIQ----FRPKELNGSKPKYIEYYDIINNFIDIWRRTVGNDIYPALIL
Skud_15.166        KWLCEELFVRIDNVR-----INGTAGTGKSASFKYYEIISNFVESWRKGVGNNIYPALVL
Suva_15.180        RWLCEELFAKVEEVL-----INGTAGTGKSVSFRYYEIISNFTELWRKTVGNNIYPALIL
Smik_15.174        KWLCEELFSKIDEVQ-----VKGTIGTGKSRSFKYYEVLSNFVEMWRKTVGNNIYPALIL
YOR005C            KWLCEELFVKIHEVQ-----INGTAGTGKSRSFKYYEIISNFVEMWRKTVGNNIYPALVL
KAFR0A05050        KWLCEELFSKLEEVP------NQRHLTTKRITLRYYEIITNFVNLWRTTVGDDIYPALIL
NDAI0I02260        RWLCDELFVKLERIQ-QASTSKASKEFQKPINVQYYEVIQHFINLWRKTVGNDIYPALIL
NCAS0D02650        QWLCDELFVKLEDIQ----SKRDPKNIGKPVTVRYYEVINHFIALWRKTVGNDIFPALIL
ZYRO0C07854g       KWLCDELFVKIDNVQ----KQTRDHGAFKSLTVKYFEIISFFVKLWRKTVGDNIYPALIL
TDEL0G04510        IWLCEELFVKLEDVQ----RQGREHLGNKPLSVRYYEVISHFIRLWRKTVGNNIFPALVL
                    ***::*: ..                 .            *   **  :*: ::*.* *

ACR008W            SLPYNDRRSYRVKDVTLVKALCKHMKLPRNSETERRLLHWKQNAPRGVKLSTFCVEELQK
KLLA0D01089g       IVPFRDRRIYNVKENTLIKALCRYLRLPKSSETENRLLRWKQRAARGVKLSDFCVEEIRK
TBLA0G01040        ILPYRDRRVYNIKDLTLIRAICSYLKLPKNSVVERRLIRWKYKADRYETLATFCIHEISK
KLTH0C11286g       MFPYRDPRAYHIKDFTLIKAVCKALNLSRDSLTERRLLNWKQYAGRGTSLSKFCVQEISK
Kwal_56.22414      ILPYRDSRAYNIKDYTLVKAVCRSLNLPKDSLTEKRLLNWKQYAPRGTSLSKFCVEEIMK
CAGL0E02695g       ILPYRDRRVFNIKDYTLIKAICAFLKLPKDSSTEKKLINWKQDAGRSVRLSKFCVEEIKK
TPHA0M00260        ILPYRDRRNYYIREHTLIRIVCDYLKLQKNSVTEQRLRRWKQKARRSINLSSFCIQEIKK
KNAG0F02870        ALPYRDRRTYNIKDVTLIKAICLYLDLPKRSSTEKKLLNWKQRASRNERLSSFCVAEIRK
Kpol_1032.7        TIPYRDRRMYNIKESKLIRIVCDYLKLPKNSETERRLMRWKHRADRNVRLSTFCVEEIKK
Skud_15.166        ALPYRDRRIYNIKDYILIRTICSYLKLPRNSVTEQRLKSWKQRVSRARNLSSLLVEEIAK
Suva_15.180        ALPYRDRRIYNIKDYVLIRTVCSYLKLPKNSPTEQRLKDWKQRVGKGRSLSSLLVEEISK
Smik_15.174        ALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEGRLKDWKQRVGKGKNLSSLLVEEIAK
YOR005C            ALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEQRLKDWKQRVGKGGNLSSLLVEEIAK
KAFR0A05050        ALPYRDRRMYNVKDYTLIKAICTYLKLPKNSFTEKRLLNWKQRADRSVKLSVSCVNEMRK
NDAI0I02260        ILPYRDRRIYNVRDYTLIKAICSYLKLPKNSFTEKRLLSWKQRAGRSVRLSSFIVSEIKK
NCAS0D02650        ILPYRDRRLFNIRDYTLIKAICAYLKLPRNSFTEKRLLSWKARAGKGVKLSQFCVNEIKK
ZYRO0C07854g       ILPYRDRRIFNIKDYTLIKAICSFLRLPANSVTEKRLLRWKRRAGRGIKLSDFCVEEIRR
TDEL0G04510        SLPYRDRRIYNIKDYTLVKAICSYLALPKQSATEKRLLKWKRRATRGVRLSNFCVEEIRK
                    .*:.* * : :.:  *:. :*  : *   * .* .*  **  . .   *:   : *: .

ACR008W            RRREPV--VPKRMSIDEVNGMLDKLEHESNV-----GKWSYISLAESPAFNYCLEHMSYV
KLLA0D01089g       RQKDYE--GANRITIDELNGYLDEVSQEGNGK-----RMGYMALTDSRAFNYCLNHMTFM
TBLA0G01040        RKNEPQVTQVERISIDKLNEILDDLVVNRQNW----NNKKRSNLLQVETFKFCLENMTFI
KLTH0C11286g       RRKEPL--PERQLTIDGLNEKLDELAKEASGK----KAWGTTGLSESHSFQFCLKNLSFL
Kwal_56.22414      RRKEPQ--GSQRLTIDALNKCLDELSKEASAK-----KWGFNGLSKSPSFQNCLQNMSFS
CAGL0E02695g       RRSEPQIDRNERITIDDLNGYLDQLAIERTEQ----GR-SFKNLANSDIMNKCLTSMTFL
TPHA0M00260        RLSEPV--SKEKITIDKLNSILDSLSMERSSSKITNGS-SGKKLSQLESIKYCFENMSFI
KNAG0F02870        RKSGPDPSKRQAITLDKLNSILDDLANGKSSR----GQ-GSRTLADSSHFKFCLENMSFI
Kpol_1032.7        RKGEPR--EKIKITIDKLNECLDNLVLERGYK----GS-KSQKISESETFKFCFENMTYV
Skud_15.166        RRPEP---NGKSITIDGVNDYLDELSKERSIS----GR-GFKDLVNSKPFLSCLESMSFV
Suva_15.180        RRTEP---TRKSITVDSVNFYLDELSKEMNAS----GR-GFKNLVKSKPFLHCLENMTFV
Smik_15.174        RRSEP---NGKAITIDGINSTLDELSKDRSTS----GR-GFKNLVKSSPFLHCLESMSFV
YOR005C            RRAEP---SSKAITIDNVNHYLDSLSGDRFAS----GR-GFKSLVKSKPFLHCVENMSFV
KAFR0A05050        RKSEPV--EKSPITLDELNTLLDFLSQDRNIK----GR-GYKNLSESSIFTYCIEKMSFM
NDAI0I02260        RKSEPQVGTREEITIDKLNQCLDSLSEERNSK----GSMGYRGLSDSPTFVFCLENMTFV
NCAS0D02650        RKSEPK--DKIEITIDRLNECLDKLAEERNSK----GR-GFKKLADSPTFKFCLENMSFI
ZYRO0C07854g       RRSEPL--NGERITIDKLNECLDQLAEERNTK----GR-GFKSLADSSVFKYCLENMSFT
TDEL0G04510        RKSEPS--PGRRITIDKLNECLDHLVEERNAK----G--GFKGLSDSPTFNFCLQNMSFI
                   *           :::* :*  ** :                  : .   :  *.  ::: 

ACR008W            ELRFFFDIVLKVPIVSGLESLLLSCWHPDAESYFKVVSDLRIVAHTLYDPNERLEKNDLS
KLLA0D01089g       EMKFFFDIILKTRVLSGLENMFLTAWHPDATDYLSVVSDLDVLSQRLYNPNERLRQTDLS
TBLA0G01040        ELKYFFDIIVKNKILGSLENMFLKIWHPDSKEYLSVVSDLRTLSNKLWNPSIKINNSDLS
KLTH0C11286g       ELRYFFDIVLKNRVIGGLEHKFLACWHPDAQIYLGVVTDLKILSKKLWNPSVRLDKRDLS
Kwal_56.22414      EQRYFFDIILKTRVIGGLEHKFLNCWHPDAQDYLGVVSDLKVLSETLWNPTMRLGKNELS
CAGL0E02695g       EMQYFFDILLKNRPLGGHEHKLLNCWHPDAQDYLSVVSDLETVAKRLWDPSQRLGNQDLK
TPHA0M00260        ELEYFFDILIKARLIGGLEHKFLNAWHPDANDYLSVVSELNIVTEKLWNPNFRLNSKDLT
KNAG0F02870        ELKYFFDILLKVRIIGGHEHKLLNAWHPDAVDYFSVVSDLSSVTKKLYEPSVRLRNEDLT
Kpol_1032.7        ELKYFFDILLKDKIVGGLEHKFLNCWHPDAQDYLSVVSDLKIVSSKLWNPEFRLKYDDLT
Skud_15.166        ELKYFFDIVLKNRVIGGQEHRFLNCWHPDAQDYLSVVSDLKVVTSKLYDPRVRLKNDDLS
Suva_15.180        ELKFFFDILLKNRVIGGQEHKLLNCWHPDAQDYLSVVSDLRVVTSKLYDPDIRLKNDDLS
Smik_15.174        ELKYFFDILLKSRVIGGQEHKFLSCWHPDAQDYLSVVSDLKVVASKLYDPRVRLKNDDLT
YOR005C            ELKYFFDIVLKNRVIGGQEHKLLNCWHPDAQDYLSVISDLKVVTSKLYDPKVRLKDDDLS
KAFR0A05050        ELRYFFDIILKARVIGPHEHKLLNAWHPDAEDYLSVVSDLKTVCTRLWNPNIRLRHDELS
NDAI0I02260        ELQFFFDIILKSRVIGGHEHKFLNVWHPDAQDYLSVVSDLKTVANKLWDPAVHLKNDDLT
NCAS0D02650        ELQFFFDILLKNRVIGGQEHKFLNAWHPDAQDYLSVVSDLRTVTTRLWDPEIRLQNNDLV
ZYRO0C07854g       EMKYYFDIILKSRVIGGQEHKFLNCWHPDARDYLSVVSDLKTVADKLWDPSHRLKNDDLG
TDEL0G04510        ELRFFFDIVLKNRVIGGQEHKLLNCWHPDALDYLSVVSDLETVASRLWDPEHRLRRDDLS
                   *  ::***::*   :.  *  :*  ****:  *: *:::*  :   *::*  .:   :* 

ACR008W            VRIGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNGI
KLLA0D01089g       ITISHAFEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIKYLSRRGV
TBLA0G01040        IKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGERIQLHYMNYGETVKFFSRHGT
KLTH0C11286g       INIGHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQLHYVNGGSVLKFLSRRGI
Kwal_56.22414      INIGRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGERIQLHYIERGAKIRFLSRRGT
CAGL0E02695g       INIGLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFYSRRAT
TPHA0M00260        IALHNAFEPQLAKKVNLSYEVLSRRMNNKFTIEEKMDGERIQIHYMDYGHQIKYFSRRGN
KNAG0F02870        LKIGSAFAPHLAKRLNISYEKILKKLGSDFSIEEKMDGERIQIHYMDYGNEIKFLSRRGT
Kpol_1032.7        INIDHAFTPETAKRLTYSYDTIARRLKNDFFIEEKMDGERIQLHYMNYGAKLKFLSRRGL
Skud_15.166        IKVGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIKFFSRRGI
Suva_15.180        IKVGFAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIKFFSRRGI
Smik_15.174        IKVGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVRFYSRRGI
YOR005C            IKVGFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIKFFSRRGI
KAFR0A05050        INIGYAFAPHLAKKLSISYDKICKKLKNDFFIEEKMDGERIQIHYMDYGNDIKFLSRRGV
NDAI0I02260        INVGSPFAPQSAKKLSISYEKICAKLKHDFFIEEKMDGERIQLHYQDYGNKLSFLSRRGT
NCAS0D02650        INPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHYQDYGEKLKFFSRRGT
ZYRO0C07854g       VNLGLPFAPFLAKRLYISYDKVALRLKSDFYIEEKMDGERIQLHYMDYGRKLKWFSRRGN
TDEL0G04510        INLGYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAKIRFLSRRGV
                   :     * *  * .   .*: :   :  .* :******:*:*:** : *  : : **.. 

ACR008W            NYTYLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVNF
KLLA0D01089g       DFSYLYGENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQIQS
TBLA0G01040        DYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKSSASSQL--
KLTH0C11286g       DFSHLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRKIILPFGIVKSAAVDELIN
Kwal_56.22414      DFTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKEKNVVLPFGIVKSTAMEELMN
CAGL0E02695g       DYTYLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSAKNML--
TPHA0M00260        DYTYLYGKDKSTATISKYLQLNEDVKECILDGEMVSYDKSRNCILPFGMVKSGAANSL--
KNAG0F02870        DYTYLYGGDTSTGTIACYLKLNENVKECILDGEMVTYDQEKQMILPFGLVKSSAKNFL--
Kpol_1032.7        DYSYLYGDNRNNGAIGRYLNFHKDVKECILDGEMVTYDSVKNCILPFGLVKSSAMQSL--
Skud_15.166        DYTYLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGSAKGVL--
Suva_15.180        DYTYLYGVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGSAKEAL--
Smik_15.174        DYTYLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARRKVILPFGLVKGSAKDAL--
YOR005C            DYTYLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLVKGSAKEAL--
KAFR0A05050        DYTYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAAMNAL--
NDAI0I02260        DYTYLYGESIKDGTVSKYLHLDNNVQNCVLDGEMVTFDKERNALLPFGLVKSSARSII--
NCAS0D02650        DYTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGLVKSSARSML--
ZYRO0C07854g       DYTYLYGEDIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFGLVKSSARDSL--
TDEL0G04510        DYTQLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKSSARQAL--
                   ::: *** .   . :.  : :   *.:*:** *::::*     :****:.*. *   :  

ACR008W            ETTGHT-EPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCS
KLLA0D01089g       ELAGIAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMKAI
TBLA0G01040        NKKDID-NDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEILSSIRCT
KLTH0C11286g       SEVGNE-NDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDVVEILKGIRAC
Kwal_56.22414      SDTKVD-TDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLRSILSPVANIVEILSDVRAS
CAGL0E02695g       SQDGID-TQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEIIKSIRAN
TPHA0M00260        KIDGLE-NDLCSPLFIVFDVLFLNGSPLTNLPLYQRKEYLSNILTPKKSHIEILKFSIAH
KNAG0F02870        SKESIS-NGSYHPLFMAFDLVYLNGTSLVDLPLYQRKDYLSKILTKCNGFVDIVSFARCN
Kpol_1032.7        SVSDIE-PDGYHPLYMAFDLVYLNGSSLSTLPLHQRKNYLDKLLIPCPDFVEILPALHCN
Skud_15.166        SCSDIN-NSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQSTRCY
Suva_15.180        SFNDIN-NNDFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRYSRCY
Smik_15.174        SFNSIN-NVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRTSRCY
YOR005C            SFNSIN-NVDFHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRSSRCY
KAFR0A05050        TKEEIS-GQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFTRCS
NDAI0I02260        TQEGVA-NEGYRPLLMVFDLVYLNGVSLVNIPLYQRKLYLEKIFTPERHIVELLRSKRCS
NCAS0D02650        TKDGIM-NEGYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPHIIELLSSYHRF
ZYRO0C07854g       TAEGIL-TQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEIIQSMHCY
TDEL0G04510        STEGIC-SQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEILPYVRCS
                               *:   :*.:::*   *       *. :*  ::      : ::      

ACR008W            DAEAITAALGAAVAHGSEGIVLKKARSKYSVGKRDDSWIKIKPEYLENFGENMDLVVIGR
KLLA0D01089g       NAEAIKDSLEQAISMGSEGIVLKHLHSKYFVGSRNTDWIKIKPEYLEQFGENMDLLIIGR
TBLA0G01040        DSIQIKKGLDAAISVGSEGIVLKQYISKYIPNARHNNWIKVKPEYLEEFGENMDLIVIGR
KLTH0C11286g       DAKAIKNFMQRAIEMGSEGVIVKQASSTYEVGARNDHWVKIKPEYFEDLGETMDLVVIGR
Kwal_56.22414      EPNAIKVSLERAIEMGSEGIILKQFSSPYEIGARNDSWIKIKPEYFEELGETMDLVVIGR
CAGL0E02695g       DEQMIKKSLEKALSVGSEGIILKRYDSRYVIASRSDDWIKIKPEYLEQFGENMDLVLMGR
TPHA0M00260        DSESIRSALQAAISVGSEGIVLKKYDSLYSVGDRNNDWIKVKPEYLEQFGENLDLIVIGR
KNAG0F02870        NLESITKSLAAAISVGSEGIILKKLNSRYMVASRNDSWIKIKPQYLKQFGENMDLIIIGR
Kpol_1032.7        DSSLIKSSLEKAIELGSEGIILKRFDSQYLVAKRSDDWIKIKPEYLEQFGENMDLIVIGR
Skud_15.166        DVQSVKNSLEVAISLGSEGVVLKYYNSSYNIASRNYNWIKVKPEYLEEFGENLDLIIIGR
Suva_15.180        DAESVKKSLEVAISLGSEGVVLKHYSSSYNVASRNNNWIKVKPEYLEEFGENLDLIIIGR
Smik_15.174        NVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLVIIGR
YOR005C            GVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLIVIGR
KAFR0A05050        NENIIRKSLEHAISVGSEGIVLKNYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLIVIGR
NDAI0I02260        DERSIKNALEHAISIGSEGVVLKHYNSRYTVASRNDDWIKVKPEYLEQFGENMDLIVIGK
NCAS0D02650        NEDSIRKSLELAISMGSEGIVLKRYDSRYTVASRNDDWIKVKPEYLEQFGENMDLIVIGR
ZYRO0C07854g       DDTSIKSSLEKAIMMGSEGIILKHFKSKYEIGARTDNWIKIKPEYLEQFGENLDLLVIGR
TDEL0G04510        EHTAIRKSLEKSISMGSEGIVLKSYKARYEIGARNDYWIKVKPEYLEQFGENLDLVIIGR
                       :   :  ::  ****:::*   : *    *   *:*:**:*::::**.:**:::*.

ACR008W            DKGRKDSFICALAVTDDSEKNNPSSYESGSDS------------DS-DSEPIIVQPKIEK
KLLA0D01089g       EQGKKDSFFCGLSISDPNEVAEK-----------------------------------PR
TBLA0G01040        DSGKKDCLICGILVTEEKQELSENMKRESEIEIISDS-------GD-DDLDTKPSQGIKK
KLTH0C11286g       DPGKKDSLMCGLLVSDSEHILENFG----------------------PIEHGKEGDPIIK
Kwal_56.22414      DPGKKDSLMCGLILADETDGSSVNL-------------------AS-QDDPLRPKQRNPK
CAGL0E02695g       DPSKKDSLMLGLLDYEEVIQDSPIM-------------------VN-SQSSEENSQRFRG
TPHA0M00260        DPGKKDSLMCGVAVLENEESYEKILQ---EEVITLTSDDDDSQNNI-PEDKPIRTKRITK
KNAG0F02870        DPGKKDAFMCALGVTIDDPQPRVLQQ---EENVNLDLDT-----ED-SEPETPKASRIVK
Kpol_1032.7        DPGKKDSLMCGLILTGDNE---------PEEITSLDSN------PT-DTAESFLKPDKRK
Skud_15.166        DSGKKDSFMLGLLVIDEREMEERDQELSSSEVVNDS--------KI-EQDVINSKKKVKK
Suva_15.180        DSGKKDSFMLGLLVVDEQETGKTDQE-GPSEILNDS--------ST-ERRATNPKKRVRK
Smik_15.174        DPGKKDSFMLGLLLLNEKEMDKRDQE--VSSGIANN--------SK-NENILYSQKKVKK
YOR005C            DSGKKDSFMLGLLVLDEEEYKKHQGD--SSEIVDHS--------SQ-EKHIQNSRRRVKK
KAFR0A05050        DSAKKDSFYCGLTVLDEEEEK--LVEEIDKGVVNLVSD------ES-DYENPENNRHIKK
NDAI0I02260        DPGKKDSLMCGLAVVEEDE---PEIDEDGNEIVNLDSQDSIGEGEDKEGNEIEREKTIKR
NCAS0D02650        DPGKKDSLMCGLAVVEEDEKAD-LNENNDDNVIILD--------DD-EDAPVEQERTIHK
ZYRO0C07854g       DPGKKDSLMCGLAVLEGDEEPGAQSD---KQVVNLD-----------SEEEEEPRKAVKK
TDEL0G04510        TPGKKDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSE------GD-ELDDTDGKKIIKY
                     ..**.:  .:                                                

ACR008W            FISFCSIANGISNEEFKEIDRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNSVVLE
KLLA0D01089g       FISFCTIANGLSNEEFKDIERKTWGKWHIFSEDPPSPNLLGFGTKVPYEWIHPEDSVVLE
TBLA0G01040        VISFCTIANGLSQNELKEINRITRGAWKNYNNETPPIDVLEFGTKKPVEWIYPQDSVVLE
KLTH0C11286g       CVSFCNVANGVSDEEFKEINRKTRGSWVSYKEKPPPLSLLEFGSKIPVEWIDPKNSVVIE
Kwal_56.22414      VISFCNIANGVSDAEFKEIERKTRGLWNLTTACPPPSGLLEFGTKLPTEWIDPRSSLVLE
CAGL0E02695g       FVSLCIIANGISNEEYKEIDRKTKGLWND-SEKIPPLEYMKFGSKVPRQWIDPKKSLILE
TPHA0M00260        FISFCVIANGISNEEFKEIDRKTFGCWKKFSDEAPPTDYLEFGTRLPVEWINPHDSVVLE
KNAG0F02870        FVSFCTIANGISNAEFKEIDQKTRGLWRRFDQVKPPSEYLQFGTKKPVEWIDPKESLVLE
Kpol_1032.7        IISFCNIANGISQKEFRDIDRYTFGHWIKFDDELPPQDLFEFGTKHPIEWIYPEHSVVLE
Skud_15.166        VLSFCSVANGISHEEFKEINRRTRGHWKRTSDFSPP-SILQFGSRIPAEWIEPSDSIVLE
Suva_15.180        VLSFCSIANGISQEEFKEIDRKTRGHWKKTSGLSPPPSILEFGSKLPAEWIEPSESIVLE
Smik_15.174        ILSFCSVANGISQEEFKEIDRKTRGCWKKTSEVAPPASIFEFGSKIPAEWIEPNESIVLE
YOR005C            ILSFCSIANGISQEEFKEIDRKTRGHWKRTSEVAPPASILEFGSKIPAEWIDPSESIVLE
KAFR0A05050        VVSFCMIANGISQNEYKEIYRKTRGFWKKTEEVPPPPELIEFGTQVPMEWIEPEHSVVLE
NDAI0I02260        FVSFCSIANGISQEEFKYIGRITKGCWKKSDEIPPPSDLLEFGSRVPAEWIDPKDSIVIE
NCAS0D02650        FVSFCVIANGLSQEEFKQIDRKTRGLWNRSDEIPPPDTLLQFGTRLPIEWIDPKKSVVIE
ZYRO0C07854g       FISFCTIANGISQEEFKQIERKTAGKWKNTEDHKPP-KILEFGSKLPEEWIYPEDSVVLE
TDEL0G04510        FISFCVIANGISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKNSIMLE
                    :*:* :***:*  * . * . * * *       *.   . **:. * :** *  *:::*

ACR008W            VKARSIDNEESKSDLYKTGSTLYNAYCKRIRHDKNWSTASTVAEYDTAREARSYFNVSQN
KLLA0D01089g       VKARAIDTKESEKRKYRSGCTLHFGYCKQIRYDKDWKTVASFSEFEDMKDARNFYNKRKS
TBLA0G01040        IKARSLDRTDQTQYKYATGCTLYGGYCRQIRQDKDWTSCYTLHDLTYNEIKRHEKKNKNK
KLTH0C11286g       VKARSVENSEYSSKRYRAGSTLHSAYCRRIRNDKDWTTCTSVAQYQQAKAAHNYHRYKRK
Kwal_56.22414      VKARSVDTDELSSKKYKTGSTLRGAYCRALRFNKDWSTCATVQQYEQAKRAHNYHKGKRK
CAGL0E02695g       IKARSLDNTRSSERKFAAGCTLFGGYCRQIREDKNWKTCYTLQEFERAKSGNNWRKRGSS
TPHA0M00260        VKARSLENNEALRDKFKTGYTLYGAYCRRIRTDKDFNDCYTFSDLVIATNKKRSSSELYG
KNAG0F02870        VKSRSLDNTESNVKKYRAGVTLFGGYCRAVRYDKDWTTCYTVSEFERDRQYKLPKVNAGE
Kpol_1032.7        IKARSLETNESARIKYGTGSTLFGGYCRQIRYDKDWVSCFTYNEFMESRNLKNALVNYPD
Skud_15.166        IKSRSLDNTETSIRRYATSCTLYGGYCRRIRYDKDWTDCYTLAQLYEDRPIKSKPNQQDE
Suva_15.180        IKSRSLDNTETNMQKYATNCTLYGGYCRRIRYDKDWTECYTLDELYENRRTKSNPSHQVE
Smik_15.174        IKSRSLDNTETNMQKYATSCTLYGGYCKRIRFDKDWTDCFTLNELYDSRSARFNPSYQAE
YOR005C            IKSRSLDNTETNMQKYATNCTLYGGYCKRIRYDKEWTDCYTLNDLYESRTVKSNPSYQAE
KAFR0A05050        IKARSLDNTESSCKRFKAGCTLYGGYCRRIRDDVDWKSSFSLAELRRDRRIKHYPGTSEK
NDAI0I02260        VKARSLNNDEEATKKFKTGITLYGGYCRQIREDKDWKTCYTLSELRRMKRFKLGSNKRAN
NCAS0D02650        VKARSIDAAESNGRKFATGCTLYGGYCRGIREDKDWQTCYTLSEFLRTKNVKSRRNGSDQ
ZYRO0C07854g       VKARSLDNTESSGRKFKVGCTLHGGYCRRIREDKNWTECYTLYELWQERRKKVPLSEDSN
TDEL0G04510        VKARSLDNTESSKKKFAAGCTLHGGYCRRIRDDKDWTGCYSFSELWQERLHKSSTGVGSF
                   :*:*:::        :  . **  .**. :* : ::    :  :       .        

ACR008W            AKFGKD----RSSPRKRRTFHLVGDIDVTKPSK--AD-FLKGYYFYVTSGYFDLQSKKNI
KLLA0D01089g       HQVTDG----KKRASKRAKIGIVNSSEPTALVAPVSN-TFSNCRFRVISDYFDSTKRRRI
TBLA0G01040        QTLIR-----SYSRKKSKIISPAGMLPNGTDLRLISD-LFHGLYFYIISDYIPDSDAQRI
KLTH0C11286g       VHQVSP----RRKRNVHEIFEYCAGEAKSELDTEGSS-IFEGLHFYILSDYVTS-QRRRY
Kwal_56.22414      SHQISPR---KQRKLANVSELYPLLADDSRESIFESN-IFQGLQFYILSDYIDS-QKKRY
CAGL0E02695g       KPQKVI----SKKRRYNIISSVNKALEDFAELEHRSD-IFDGMYFYVLSDYFDGVKRKRI
TPHA0M00260        NHSHIK----KKRSRTSKVNMLNQTLSIQDDDTGFTSKIFDGLSFFVISDYVDSNSSFRL
KNAG0F02870        SITTSNKG--RKKRNTTSILGVISPRKKRTPEGEHSD-IFQNLHFCVLSDYLDPYTGNRI
Kpol_1032.7        NKNLIGR---KKRPKKRMFNSLTEIFENTKDAPDESNVIFRGLHFYVISDYIDETDGSRL
Skud_15.166        NFQL------QLAHKKRKRALISDPFHQIREQKLISS-IFAGLFFYVLSDYVTKDTGVRI
Suva_15.180        NLQL------QLVPKKRKRALVSDPFQQSREQKPISG-VFAGLFFYVLSDYINSVTGVRI
Smik_15.174        KSHL------KLVRKKRREVLTSNTFDQKTEQIPTSI-IFAGLYFYVLSDYVTNASEVRI
YOR005C            RSQL------GLIRKKRKRVLISDSFHQNRKQLPISN-IFAGLLFYVLSDYVTEDTGIRI
KAFR0A05050        DTLLKS----KKRRKKQLLTPLNQNLNP-RDIQTTSK-IFDGLFFYILSDYFDTNENVRI
NDAI0I02260        NDATHALDSSKRRKARRIDYGFEKYFEQTPTTLDQSR-IFDGLYFYVISDVVDA-TGSRV
NCAS0D02650        VIHGV-----KRQKKNRRKYILDQSLEEEGGLLKNTA-FFRNLYFYVISDVFDDVLGTRI
ZYRO0C07854g       NQKPMKS---KKIRRPRIVSRLNQTLSCD-DEAKTSS-IFDGLIFYVISDYMASQDSERI
TDEL0G04510        NKQYSK----KMKSKKRKIDPFSGQAAKKHDVFDSTN-IFKGLQFYVLSDYIDVSRNVRI
                                                      :   : .  * : *. .      . 

ACR008W            DASEIGEAVVSCGGTYIHNLRIRA-SLDKLYILGCKDTRELKMLIERGYDIIHPEWLMDC
KLLA0D01089g       SQEDLCSVILEHGGEIVYTSDENNLPQDNLYIIGEKLTRECKILLNAKNLIIRPSWIFSC
TBLA0G01040        DREDICSLIIKNGGRVIYNVIAKTYTISKLRILSSKSTIECTDLVRRGYDVINLSWLFDC
KLTH0C11286g       ERGMVAAKVVKHGGLIVKNIDMRPEHLSYLRIVSGKTTIECRNLVNRGYDIIDPCWIFDC
Kwal_56.22414      EKDQIGTLVRKNSGHVLHNNFVRREEFSRLRIISGKNTVECRSLTEKGYDIIHPSWIFDC
CAGL0E02695g       KKSEIQKVIVANGGQLVQNVITRNYNLNDLRIISSRNTVECNSLIVRGYDIISPKWVFDC
TPHA0M00260        RIDELINIIKVNGGQLIFNLVSQNLNEKYVRIMSCKKTFECNELIKRGYDIIHPKWILDC
KNAG0F02870        DRNTLTQLIIDYGGKVIYNVLAKEGEEGMLRIICDGFNMECNALIKRGYDILSPSWVLDC
Kpol_1032.7        SKSDLCNLVLEHNGKLVHNPISRIDILNRLRIISMKYTRETTSLIERGYDIIHPQWILDC
Skud_15.166        TRAGLEDAIVKHGGKLIHNVILKRHCIGDVRLISCKTTIECRILIDRGYDIVHPSWVMDC
Suva_15.180        TRSELNDVIVKHGGKLIHNVILKRHCIGDVRLIGCKLTRECRALIDRGYDILHPRWIMDC
Smik_15.174        TRGELENAIVRHGGRLIYNIILKRHYIGDVRLISCKNTTECRALINRGYDILHPSWVIDC
YOR005C            TRAELEKTIVEHGGKLIYNVILKRHSIGDVRLISCKTTTECKALIDRGYDILHPNWVLDC
KAFR0A05050        SKDDLQKLLLENGGKISHNIVSKRESKSNLRILCGKYTAECNVLIKRGYDILSPQWVIDC
NDAI0I02260        SREELYDKILNRGGVIVHNVIAKHHGENQFRILCGKYTAECQSLIDRGYDIIEPQWVLDC
NCAS0D02650        EKERMYKYIQEGGGTLIHNIISKQFGTRNLRIISGKLTNECSALIERGYDVINPQWIVDC
ZYRO0C07854g       SKEQLCDLISGNGGKLTFNVISDHRVKGGLRIISGKYTLECKALIERGYDILSPQWLMDC
TDEL0G04510        TKSEFDDLILQNSGKLVRNLISKHHSESQFRIISGKYTAECRALIERGYDILSPQWILDC
                       .   :   .*    .          . ::    . *   *      ::   *:..*

ACR008W            VKYGTMLQIEPKYVYSASEELMKQARNQEDKYGESYQLPVTEDTLKALANKQVEEG----
KLLA0D01089g       IEEGYKTP------FTESDIFRGELESSMDCSQ--FYTDFNTASLNHLLETANRGI----
TBLA0G01040        LQAGVILPLEPAHCLFVSNELLAIATDRIDKFGDSYEATLIDSKLLKLLDSNINKVNRSN
KLTH0C11286g       ISAGFQLGIEPKHCFQTSRRLLDNSRQRVDQYGDSFSRPLDTTEFQQLFKFFCSSP-SDF
Kwal_56.22414      LNYGSLVKLEPRHCFRTSRKLLENSRQRVDRFGDSFCRPLSYTEFDELVNGQSVVS----
CAGL0E02695g       LLSGKIMKLEPSHCFNFSKQLMDYAYKRIDQYGDPYERDINKYEWSSLTSEKICTT---A
TPHA0M00260        IANDKLLDFEPSHCFNVSQSLSTISKQRVDLLGDSYQKYITEEELELLISSKTPKE---Q
KNAG0F02870        IESARLLKLERNHCFNVSKELMELSSTRVDEYDDSFENEISTTRLDRLIDVHLHNM--PS
Kpol_1032.7        ISNRKLVRLLPSHCFNVSSSLMEVTKTRVDRYGDSYETSLTEKDFEILINRQVLKS---E
Skud_15.166        IAYKQLIFIEPSYCFSVSHKLREVAEKRVDCLGDSFENNISERKLSLLFKSRQDLS----
Suva_15.180        TAYNKLLPIEPSYCFSVSGKLRAVARRRVDCFGDSFENDISESKLSSLQKSQPDLL----
Smik_15.174        VAYKKLIPIEPCYCFNVSQKMRAVAEKRVDCLGDSFENDISETKLSLLYKSQHNLP----
YOR005C            IAYKRLILIEPNYCFNVSQKMRAVAEKRVDCLGDSFENDISETKLSSLYKSQLSLP----
KAFR0A05050        VENKKIVKIEPSHCFSVSDDLMALAMRRVDKYGDSYESLLSVSRLSYILRSSKDIS---P
NDAI0I02260        IKDDMLLKLEPKYCFNVSEELMKIAKRRVDGFGDSFEAQISEDSFSRLIERNVRSL---R
NCAS0D02650        VQSKSLLKLEPKYCFNVSTELKKLTEKRVDTFGDSYEVPITEEQLSTLLETELNLV--RV
ZYRO0C07854g       VNTGFLVTIEPRHCFSVSEDMEKIARTRVDHFGDSYDVEITEDRLRDILTSKEFDS---D
TDEL0G04510        IRNRMVVKLEPRHCFNVSSELMTIVNGRVDEYGDSFVNPITEQQLDNLIDTNMKQT----
                                    *  :        *     :   .       :            

ACR008W            -YASEMGTDAVSEYERLLIFKGWLFYILDDYAYHSSWSDIVKWNIESCGGEVTNDLELAT
KLLA0D01089g       ---KNPDSDLLLPEVPLFLFSNLKLAVLNSENVLDTSILEVEFAIKCHGGELVH-IENAS
TBLA0G01040        SNLLLINKDEGVDSIPIFLFTNRKFFLIKE-DILLGDRDTLIFQIKLYGGSLVTKLEDCN
KLTH0C11286g       SSRISSMLQDDLDEAPLFLLQRFKIYVLAA-DLIPQQFSILRRKIELYGGVVSETLEGAN
Kwal_56.22414      ---PHLSAPEELDGIPLFLFQNFKIYFARV-GNDPDQEEYLEKTLRLFGGERSLTLDCCN
CAGL0E02695g       KQQPDVQFDNSLMDVPHFLFHGRIVFLLSD----NNNIQKESFMVDAYGGKVTNELSSAN
TPHA0M00260        LYSNPLQFDQQIEKIPIFLFSNKKAYTPKQ-CFSEKLLKETNLYIKLYGGTSVNNINDCN
KNAG0F02870        GSFSGENLDFELRGLPPLLFFDRSVFIAET-KLSDRIYAKISSETKLFGGQVTHTIEDCN
Kpol_1032.7        SADKRITEGENHLKIPILLFCNRRFFIPET--LPSTPIYELKSKVELYGGKLVNKISDCN
Skud_15.166        -SIGEIGIDSEAQVIPLFLFSNRIVYIPRT-KTGLREEKLLEMKIRLFGGEITGQQSLCN
Suva_15.180        -STRQADKSFELQIIPLFLFSNRIVYIPRS-KIGPKDEMLLEMKIRLFGGKITDQQSLSN
Smik_15.174        -PPEEVERDAEVQVFPLFLFSNRIVYIPPR-KIGMKYEKTLEMKIRLFGGKITDRQSLCN
YOR005C            -PMGELEIDSEVRRFPLFLFSNRIAYVPRR--KISTEDDIIEMKIKLFGGKITDQQSLCN
KAFR0A05050        DLLSPANMSLDFEKVPYFLFWRRKAFVMEH-NFDKSSIRETILKIQLYGGKVVKNISECN
NDAI0I02260        NAPPSIQYDM-VDTVPLFLFYGRTILLRIK---DKALFTKLKVQIRLYGGKTTGDLASCN
NCAS0D02650        QGLVTPYADEELIKIPLFLFQDRIMLFPNT---ESKTISFLQEKIKLYGGKLTTDIGKCN
ZYRO0C07854g       FSTGSLDVISDVEDIPLFLFSRRIVFIPEG--FSYLDTQLLKHKVRLYGGQLTDNVNQCN
TDEL0G04510        EPNLMREANSELDVVPLFLFSTRAVYIPPQ-VFNAVDAYGLTSKFKLHGGSIASDIPSCN
                                    :::                            **        ..

ACR008W            IVVAVKDCFSQL----SLQAVRNNIGARITG--SNDVQPIPKIVTSEWVEACMEAQYLVD
KLLA0D01089g       IIIVFNDFISRE----DLFSLRQKIASKAVKESTESTPRIPRMVDISWALDSIKDNYIAE
TBLA0G01040        IIVGVCGSQLVNKK---LGDLRCKLVKQYVD--ANFPQPIPRAVNVSWITESIKAGYQLS
KLTH0C11286g       LVLVPSALSTARTAY-YVQELRQKIAGNAFA--GNTNTRIPHIVRSEWLDTCTTEQCLVP
Kwal_56.22414      LVVVRVSFKEQKKLFKLVEGLRKRIASTAYS--SEVDHRIPHLVSSNWLEACINEQCLVP
CAGL0E02695g       LVIVVGAVTQRR-----INDIRKQISSEVIK--QDHPPRIPDMVSEGWLYDCIKQNTQVA
TPHA0M00260        VIIIGDEHSKSSNE--KISSIRKELSIHAVS--SNNVIPIPRIVSYKWIEKSIAQGTQVV
KNAG0F02870        LIIIPNTDDEDKIQ--VLQKIRGKLASMIQK--LNSTERIPPIVSEEWLYQSIKENIQVP
Kpol_1032.7        VIVFTNTHTENRKE--VMKKIRRALVCLDPN--SMQVPVLPRIVDANWIDACISECVQVP
Skud_15.166        LIIIPYVDSSRRKD--CIEKVNEQIKEQMKA--SHTVPKVARIVSPGWVDHSINENCQVP
Suva_15.180        LIIIPYADPIWRGD--CLEEVHSQINEHVKASNSDTVPRIPRIVTPEWVDHSISENCQVP
Smik_15.174        LVIIPYGDPTWRKD--CIKEVNEQIKEQVKA--LDTIPKIPRIVAPEWVDHSIYGNCQVP
YOR005C            LIIIPYTDPILRKD--CMNEVHEKIKEQIKA--SDTIPKIARVVAPEWVDHSINENCQVP
KAFR0A05050        IVIFPKAEITVIRE--SMKFIRNTLAKTVST--SVELPMLPRIVSFEWIDASIEKNVQVP
NDAI0I02260        LVVIQQNEIAV------AKDVRSSLLKLTSD--TDKPPVLPYIVTPEWIDSSISEGCQVP
NCAS0D02650        LIILPNGNQQL------LQRTRDLLTKNIMN--SGEVPTIPYIVNPLWIERSIEENSQVP
ZYRO0C07854g       LIIVPDGKINLRGR--IISDLRRLLSTFAAM--TELPPAIPWIVIPAWIDRSIEENIQVP
TDEL0G04510        LIIMPNENQRLGTQ--SLVEMRQSVLQAMGR--NDSTPSIPYIVTPDWVEKSIEENCQVP
                   :::                  .  :              :.  *   *   .        

ACR008W            EDEYAAI---
KLLA0D01089g       TEHYQCL---
TBLA0G01040        PEDYPIL---
KLTH0C11286g       EEDFSSI---
Kwal_56.22414      EEDFPPL---
CAGL0E02695g       EDNYRLP---
TPHA0M00260        EEDFPIIF--
KNAG0F02870        EENYSVLS--
Kpol_1032.7        EEDYPAV---
Skud_15.166        EEDFPVVNCG
Suva_15.180        EEDFPVSHY-
Smik_15.174        EEDFPVVTY-
YOR005C            EEDFPVVNY-
KAFR0A05050        EEDYVPM---
NDAI0I02260        EEDHPVV---
NCAS0D02650        EEDYPVI---
ZYRO0C07854g       EEDFLAV---
TDEL0G04510        EEDFTPVYA-
                    : .      

FASTA FORMAT for MUSCLE Version 3.6

>ACR008W
MVIYPWLKNTTELTIALPKKPIIHANMDVLGSPRGGTPTGEHEINAQDGSPINFSPSPDF
CWLCDELFIKLEEVA------LKKKDLGKPRKVRNLEITSNFVSLWRKTVGNDIYPALVL
SLPYNDRRSYRVKDVTLVKALCKHMKLPRNSETERRLLHWKQNAPRGVKLSTFCVEELQK
RRREPV--VPKRMSIDEVNGMLDKLEHESNV-----GKWSYISLAESPAFNYCLEHMSYV
ELRFFFDIVLKVPIVSGLESLLLSCWHPDAESYFKVVSDLRIVAHTLYDPNERLEKNDLS
VRIGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNGI
NYTYLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVNF
ETTGHT-EPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCS
DAEAITAALGAAVAHGSEGIVLKKARSKYSVGKRDDSWIKIKPEYLENFGENMDLVVIGR
DKGRKDSFICALAVTDDSEKNNPSSYESGSDS------------DS-DSEPIIVQPKIEK
FISFCSIANGISNEEFKEIDRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNSVVLE
VKARSIDNEESKSDLYKTGSTLYNAYCKRIRHDKNWSTASTVAEYDTAREARSYFNVSQN
AKFGKD----RSSPRKRRTFHLVGDIDVTKPSK--AD-FLKGYYFYVTSGYFDLQSKKNI
DASEIGEAVVSCGGTYIHNLRIRA-SLDKLYILGCKDTRELKMLIERGYDIIHPEWLMDC
VKYGTMLQIEPKYVYSASEELMKQARNQEDKYGESYQLPVTEDTLKALANKQVEEG----
-YASEMGTDAVSEYERLLIFKGWLFYILDDYAYHSSWSDIVKWNIESCGGEVTNDLELAT
IVVAVKDCFSQL----SLQAVRNNIGARITG--SNDVQPIPKIVTSEWVEACMEAQYLVD
EDEYAAI---
>KLLA0D01089g
-----------------------------------------------MNDCENFSPSPEF
KWLCDELLGKIYETS------SKKHLIGKPVTVRYLEIITNFIKLWRSTVGNYIYPALRL
IVPFRDRRIYNVKENTLIKALCRYLRLPKSSETENRLLRWKQRAARGVKLSDFCVEEIRK
RQKDYE--GANRITIDELNGYLDEVSQEGNGK-----RMGYMALTDSRAFNYCLNHMTFM
EMKFFFDIILKTRVLSGLENMFLTAWHPDATDYLSVVSDLDVLSQRLYNPNERLRQTDLS
ITISHAFEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIKYLSRRGV
DFSYLYGENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQIQS
ELAGIAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMKAI
NAEAIKDSLEQAISMGSEGIVLKHLHSKYFVGSRNTDWIKIKPEYLEQFGENMDLLIIGR
EQGKKDSFFCGLSISDPNEVAEK-----------------------------------PR
FISFCTIANGLSNEEFKDIERKTWGKWHIFSEDPPSPNLLGFGTKVPYEWIHPEDSVVLE
VKARAIDTKESEKRKYRSGCTLHFGYCKQIRYDKDWKTVASFSEFEDMKDARNFYNKRKS
HQVTDG----KKRASKRAKIGIVNSSEPTALVAPVSN-TFSNCRFRVISDYFDSTKRRRI
SQEDLCSVILEHGGEIVYTSDENNLPQDNLYIIGEKLTRECKILLNAKNLIIRPSWIFSC
IEEGYKTP------FTESDIFRGELESSMDCSQ--FYTDFNTASLNHLLETANRGI----
---KNPDSDLLLPEVPLFLFSNLKLAVLNSENVLDTSILEVEFAIKCHGGELVH-IENAS
IIIVFNDFISRE----DLFSLRQKIASKAVKESTESTPRIPRMVDISWALDSIKDNYIAE
TEHYQCL---
>TBLA0G01040
----------------------------MNSSNEVIIPVSTTTKESPATTPKNFAPSPDF
KWLCDELFVKIDKIREQIKNKTANTISNKPISTRYFDTITHFIKLWRTTIGDDIFPALRL
ILPYRDRRVYNIKDLTLIRAICSYLKLPKNSVVERRLIRWKYKADRYETLATFCIHEISK
RKNEPQVTQVERISIDKLNEILDDLVVNRQNW----NNKKRSNLLQVETFKFCLENMTFI
ELKYFFDIIVKNKILGSLENMFLKIWHPDSKEYLSVVSDLRTLSNKLWNPSIKINNSDLS
IKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGERIQLHYMNYGETVKFFSRHGT
DYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKSSASSQL--
NKKDID-NDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEILSSIRCT
DSIQIKKGLDAAISVGSEGIVLKQYISKYIPNARHNNWIKVKPEYLEEFGENMDLIVIGR
DSGKKDCLICGILVTEEKQELSENMKRESEIEIISDS-------GD-DDLDTKPSQGIKK
VISFCTIANGLSQNELKEINRITRGAWKNYNNETPPIDVLEFGTKKPVEWIYPQDSVVLE
IKARSLDRTDQTQYKYATGCTLYGGYCRQIRQDKDWTSCYTLHDLTYNEIKRHEKKNKNK
QTLIR-----SYSRKKSKIISPAGMLPNGTDLRLISD-LFHGLYFYIISDYIPDSDAQRI
DREDICSLIIKNGGRVIYNVIAKTYTISKLRILSSKSTIECTDLVRRGYDVINLSWLFDC
LQAGVILPLEPAHCLFVSNELLAIATDRIDKFGDSYEATLIDSKLLKLLDSNINKVNRSN
SNLLLINKDEGVDSIPIFLFTNRKFFLIKE-DILLGDRDTLIFQIKLYGGSLVTKLEDCN
IIVGVCGSQLVNKK---LGDLRCKLVKQYVD--ANFPQPIPRAVNVSWITESIKAGYQLS
PEDYPIL---
>KLTH0C11286g
------------------------------MDGNGKCPSETDTSKISENEPHNFAPSPDF
RWLCEELFHRLDAIN------EHRQELGKAVTVKRVEIITCFIKLWRTTVGDDFFPALRL
MFPYRDPRAYHIKDFTLIKAVCKALNLSRDSLTERRLLNWKQYAGRGTSLSKFCVQEISK
RRKEPL--PERQLTIDGLNEKLDELAKEASGK----KAWGTTGLSESHSFQFCLKNLSFL
ELRYFFDIVLKNRVIGGLEHKFLACWHPDAQIYLGVVTDLKILSKKLWNPSVRLDKRDLS
INIGHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQLHYVNGGSVLKFLSRRGI
DFSHLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRKIILPFGIVKSAAVDELIN
SEVGNE-NDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDVVEILKGIRAC
DAKAIKNFMQRAIEMGSEGVIVKQASSTYEVGARNDHWVKIKPEYFEDLGETMDLVVIGR
DPGKKDSLMCGLLVSDSEHILENFG----------------------PIEHGKEGDPIIK
CVSFCNVANGVSDEEFKEINRKTRGSWVSYKEKPPPLSLLEFGSKIPVEWIDPKNSVVIE
VKARSVENSEYSSKRYRAGSTLHSAYCRRIRNDKDWTTCTSVAQYQQAKAAHNYHRYKRK
VHQVSP----RRKRNVHEIFEYCAGEAKSELDTEGSS-IFEGLHFYILSDYVTS-QRRRY
ERGMVAAKVVKHGGLIVKNIDMRPEHLSYLRIVSGKTTIECRNLVNRGYDIIDPCWIFDC
ISAGFQLGIEPKHCFQTSRRLLDNSRQRVDQYGDSFSRPLDTTEFQQLFKFFCSSP-SDF
SSRISSMLQDDLDEAPLFLLQRFKIYVLAA-DLIPQQFSILRRKIELYGGVVSETLEGAN
LVLVPSALSTARTAY-YVQELRQKIAGNAFA--GNTNTRIPHIVRSEWLDTCTTEQCLVP
EEDFSSI---
>Kwal_56.22414
---------------MRTKNFGHGQGFRVFMLEANTENLAQQPGEVSQKKPQNFAPSPDF
RWLCDELFSKLEEIT------EDRQKLGKAVTVKRVEVIMYFIKLWRTTVGDNIYPVLRL
ILPYRDSRAYNIKDYTLVKAVCRSLNLPKDSLTEKRLLNWKQYAPRGTSLSKFCVEEIMK
RRKEPQ--GSQRLTIDALNKCLDELSKEASAK-----KWGFNGLSKSPSFQNCLQNMSFS
EQRYFFDIILKTRVIGGLEHKFLNCWHPDAQDYLGVVSDLKVLSETLWNPTMRLGKNELS
INIGRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGERIQLHYIERGAKIRFLSRRGT
DFTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKEKNVVLPFGIVKSTAMEELMN
SDTKVD-TDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLRSILSPVANIVEILSDVRAS
EPNAIKVSLERAIEMGSEGIILKQFSSPYEIGARNDSWIKIKPEYFEELGETMDLVVIGR
DPGKKDSLMCGLILADETDGSSVNL-------------------AS-QDDPLRPKQRNPK
VISFCNIANGVSDAEFKEIERKTRGLWNLTTACPPPSGLLEFGTKLPTEWIDPRSSLVLE
VKARSVDTDELSSKKYKTGSTLRGAYCRALRFNKDWSTCATVQQYEQAKRAHNYHKGKRK
SHQISPR---KQRKLANVSELYPLLADDSRESIFESN-IFQGLQFYILSDYIDS-QKKRY
EKDQIGTLVRKNSGHVLHNNFVRREEFSRLRIISGKNTVECRSLTEKGYDIIHPSWIFDC
LNYGSLVKLEPRHCFRTSRKLLENSRQRVDRFGDSFCRPLSYTEFDELVNGQSVVS----
---PHLSAPEELDGIPLFLFQNFKIYFARV-GNDPDQEEYLEKTLRLFGGERSLTLDCCN
LVVVRVSFKEQKKLFKLVEGLRKRIASTAYS--SEVDHRIPHLVSSNWLEACINEQCLVP
EEDFPPL---
>CAGL0E02695g
-----------------------------MADEGGLETGAHDELKGTEEQAVNFAPSPDF
LWLCEQLFAKIDHVQ----FERANNLLTKPVTARYYEVISNFTTLWRTTVGNNIYPALRL
ILPYRDRRVFNIKDYTLIKAICAFLKLPKDSSTEKKLINWKQDAGRSVRLSKFCVEEIKK
RRSEPQIDRNERITIDDLNGYLDQLAIERTEQ----GR-SFKNLANSDIMNKCLTSMTFL
EMQYFFDILLKNRPLGGHEHKLLNCWHPDAQDYLSVVSDLETVAKRLWDPSQRLGNQDLK
INIGLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFYSRRAT
DYTYLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSAKNML--
SQDGID-TQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEIIKSIRAN
DEQMIKKSLEKALSVGSEGIILKRYDSRYVIASRSDDWIKIKPEYLEQFGENMDLVLMGR
DPSKKDSLMLGLLDYEEVIQDSPIM-------------------VN-SQSSEENSQRFRG
FVSLCIIANGISNEEYKEIDRKTKGLWND-SEKIPPLEYMKFGSKVPRQWIDPKKSLILE
IKARSLDNTRSSERKFAAGCTLFGGYCRQIREDKNWKTCYTLQEFERAKSGNNWRKRGSS
KPQKVI----SKKRRYNIISSVNKALEDFAELEHRSD-IFDGMYFYVLSDYFDGVKRKRI
KKSEIQKVIVANGGQLVQNVITRNYNLNDLRIISSRNTVECNSLIVRGYDIISPKWVFDC
LLSGKIMKLEPSHCFNFSKQLMDYAYKRIDQYGDPYERDINKYEWSSLTSEKICTT---A
KQQPDVQFDNSLMDVPHFLFHGRIVFLLSD----NNNIQKESFMVDAYGGKVTNELSSAN
LVIVVGAVTQRR-----INDIRKQISSEVIK--QDHPPRIPDMVSEGWLYDCIKQNTQVA
EDNYRLP---
>TPHA0M00260
-----------------------------------MTSVPNMNIDTSEREPRNFSPSPDF
KWLCNELFVKLDEVR-----LKPKSVDTRPKNIQYDIVINNFIHLWRVTVGNDIYPALRL
ILPYRDRRNYYIREHTLIRIVCDYLKLQKNSVTEQRLRRWKQKARRSINLSSFCIQEIKK
RLSEPV--SKEKITIDKLNSILDSLSMERSSSKITNGS-SGKKLSQLESIKYCFENMSFI
ELEYFFDILIKARLIGGLEHKFLNAWHPDANDYLSVVSELNIVTEKLWNPNFRLNSKDLT
IALHNAFEPQLAKKVNLSYEVLSRRMNNKFTIEEKMDGERIQIHYMDYGHQIKYFSRRGN
DYTYLYGKDKSTATISKYLQLNEDVKECILDGEMVSYDKSRNCILPFGMVKSGAANSL--
KIDGLE-NDLCSPLFIVFDVLFLNGSPLTNLPLYQRKEYLSNILTPKKSHIEILKFSIAH
DSESIRSALQAAISVGSEGIVLKKYDSLYSVGDRNNDWIKVKPEYLEQFGENLDLIVIGR
DPGKKDSLMCGVAVLENEESYEKILQ---EEVITLTSDDDDSQNNI-PEDKPIRTKRITK
FISFCVIANGISNEEFKEIDRKTFGCWKKFSDEAPPTDYLEFGTRLPVEWINPHDSVVLE
VKARSLENNEALRDKFKTGYTLYGAYCRRIRTDKDFNDCYTFSDLVIATNKKRSSSELYG
NHSHIK----KKRSRTSKVNMLNQTLSIQDDDTGFTSKIFDGLSFFVISDYVDSNSSFRL
RIDELINIIKVNGGQLIFNLVSQNLNEKYVRIMSCKKTFECNELIKRGYDIIHPKWILDC
IANDKLLDFEPSHCFNVSQSLSTISKQRVDLLGDSYQKYITEEELELLISSKTPKE---Q
LYSNPLQFDQQIEKIPIFLFSNKKAYTPKQ-CFSEKLLKETNLYIKLYGGTSVNNINDCN
VIIIGDEHSKSSNE--KISSIRKELSIHAVS--SNNVIPIPRIVSYKWIEKSIAQGTQVV
EEDFPIIF--
>KNAG0F02870
------------------------------------------MSEKVEEGPTNFAPSPDF
QWLCDELFVKFDLVA-----TQDRRINLKPITVRYYEVVSNFVQLWRKTVGNNFYPVLIL
ALPYRDRRTYNIKDVTLIKAICLYLDLPKRSSTEKKLLNWKQRASRNERLSSFCVAEIRK
RKSGPDPSKRQAITLDKLNSILDDLANGKSSR----GQ-GSRTLADSSHFKFCLENMSFI
ELKYFFDILLKVRIIGGHEHKLLNAWHPDAVDYFSVVSDLSSVTKKLYEPSVRLRNEDLT
LKIGSAFAPHLAKRLNISYEKILKKLGSDFSIEEKMDGERIQIHYMDYGNEIKFLSRRGT
DYTYLYGGDTSTGTIACYLKLNENVKECILDGEMVTYDQEKQMILPFGLVKSSAKNFL--
SKESIS-NGSYHPLFMAFDLVYLNGTSLVDLPLYQRKDYLSKILTKCNGFVDIVSFARCN
NLESITKSLAAAISVGSEGIILKKLNSRYMVASRNDSWIKIKPQYLKQFGENMDLIIIGR
DPGKKDAFMCALGVTIDDPQPRVLQQ---EENVNLDLDT-----ED-SEPETPKASRIVK
FVSFCTIANGISNAEFKEIDQKTRGLWRRFDQVKPPSEYLQFGTKKPVEWIDPKESLVLE
VKSRSLDNTESNVKKYRAGVTLFGGYCRAVRYDKDWTTCYTVSEFERDRQYKLPKVNAGE
SITTSNKG--RKKRNTTSILGVISPRKKRTPEGEHSD-IFQNLHFCVLSDYLDPYTGNRI
DRNTLTQLIIDYGGKVIYNVLAKEGEEGMLRIICDGFNMECNALIKRGYDILSPSWVLDC
IESARLLKLERNHCFNVSKELMELSSTRVDEYDDSFENEISTTRLDRLIDVHLHNM--PS
GSFSGENLDFELRGLPPLLFFDRSVFIAET-KLSDRIYAKISSETKLFGGQVTHTIEDCN
LIIIPNTDDEDKIQ--VLQKIRGKLASMIQK--LNSTERIPPIVSEEWLYQSIKENIQVP
EENYSVLS--
>Kpol_1032.7
--------------------MRNPTPILVSTNTNTNATFTSKADTNDIEEPHNFSPSPDF
KWLCDELFVKLDQIQ----FRPKELNGSKPKYIEYYDIINNFIDIWRRTVGNDIYPALIL
TIPYRDRRMYNIKESKLIRIVCDYLKLPKNSETERRLMRWKHRADRNVRLSTFCVEEIKK
RKGEPR--EKIKITIDKLNECLDNLVLERGYK----GS-KSQKISESETFKFCFENMTYV
ELKYFFDILLKDKIVGGLEHKFLNCWHPDAQDYLSVVSDLKIVSSKLWNPEFRLKYDDLT
INIDHAFTPETAKRLTYSYDTIARRLKNDFFIEEKMDGERIQLHYMNYGAKLKFLSRRGL
DYSYLYGDNRNNGAIGRYLNFHKDVKECILDGEMVTYDSVKNCILPFGLVKSSAMQSL--
SVSDIE-PDGYHPLYMAFDLVYLNGSSLSTLPLHQRKNYLDKLLIPCPDFVEILPALHCN
DSSLIKSSLEKAIELGSEGIILKRFDSQYLVAKRSDDWIKIKPEYLEQFGENMDLIVIGR
DPGKKDSLMCGLILTGDNE---------PEEITSLDSN------PT-DTAESFLKPDKRK
IISFCNIANGISQKEFRDIDRYTFGHWIKFDDELPPQDLFEFGTKHPIEWIYPEHSVVLE
IKARSLETNESARIKYGTGSTLFGGYCRQIRYDKDWVSCFTYNEFMESRNLKNALVNYPD
NKNLIGR---KKRPKKRMFNSLTEIFENTKDAPDESNVIFRGLHFYVISDYIDETDGSRL
SKSDLCNLVLEHNGKLVHNPISRIDILNRLRIISMKYTRETTSLIERGYDIIHPQWILDC
ISNRKLVRLLPSHCFNVSSSLMEVTKTRVDRYGDSYETSLTEKDFEILINRQVLKS---E
SADKRITEGENHLKIPILLFCNRRFFIPET--LPSTPIYELKSKVELYGGKLVNKISDCN
VIVFTNTHTENRKE--VMKKIRRALVCLDPN--SMQVPVLPRIVDANWIDACISECVQVP
EEDYPAV---
>Skud_15.166
----------------------------------------MTPAPEFIPEPQNFAPSPDF
KWLCEELFVRIDNVR-----INGTAGTGKSASFKYYEIISNFVESWRKGVGNNIYPALVL
ALPYRDRRIYNIKDYILIRTICSYLKLPRNSVTEQRLKSWKQRVSRARNLSSLLVEEIAK
RRPEP---NGKSITIDGVNDYLDELSKERSIS----GR-GFKDLVNSKPFLSCLESMSFV
ELKYFFDIVLKNRVIGGQEHRFLNCWHPDAQDYLSVVSDLKVVTSKLYDPRVRLKNDDLS
IKVGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIKFFSRRGI
DYTYLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGSAKGVL--
SCSDIN-NSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQSTRCY
DVQSVKNSLEVAISLGSEGVVLKYYNSSYNIASRNYNWIKVKPEYLEEFGENLDLIIIGR
DSGKKDSFMLGLLVIDEREMEERDQELSSSEVVNDS--------KI-EQDVINSKKKVKK
VLSFCSVANGISHEEFKEINRRTRGHWKRTSDFSPP-SILQFGSRIPAEWIEPSDSIVLE
IKSRSLDNTETSIRRYATSCTLYGGYCRRIRYDKDWTDCYTLAQLYEDRPIKSKPNQQDE
NFQL------QLAHKKRKRALISDPFHQIREQKLISS-IFAGLFFYVLSDYVTKDTGVRI
TRAGLEDAIVKHGGKLIHNVILKRHCIGDVRLISCKTTIECRILIDRGYDIVHPSWVMDC
IAYKQLIFIEPSYCFSVSHKLREVAEKRVDCLGDSFENNISERKLSLLFKSRQDLS----
-SIGEIGIDSEAQVIPLFLFSNRIVYIPRT-KTGLREEKLLEMKIRLFGGEITGQQSLCN
LIIIPYVDSSRRKD--CIEKVNEQIKEQMKA--SHTVPKVARIVSPGWVDHSINENCQVP
EEDFPVVNCG
>Suva_15.180
----------------------------------------MASALQAIPEPHNFAPSPDF
RWLCEELFAKVEEVL-----INGTAGTGKSVSFRYYEIISNFTELWRKTVGNNIYPALIL
ALPYRDRRIYNIKDYVLIRTVCSYLKLPKNSPTEQRLKDWKQRVGKGRSLSSLLVEEISK
RRTEP---TRKSITVDSVNFYLDELSKEMNAS----GR-GFKNLVKSKPFLHCLENMTFV
ELKFFFDILLKNRVIGGQEHKLLNCWHPDAQDYLSVVSDLRVVTSKLYDPDIRLKNDDLS
IKVGFAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIKFFSRRGI
DYTYLYGVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGSAKEAL--
SFNDIN-NNDFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRYSRCY
DAESVKKSLEVAISLGSEGVVLKHYSSSYNVASRNNNWIKVKPEYLEEFGENLDLIIIGR
DSGKKDSFMLGLLVVDEQETGKTDQE-GPSEILNDS--------ST-ERRATNPKKRVRK
VLSFCSIANGISQEEFKEIDRKTRGHWKKTSGLSPPPSILEFGSKLPAEWIEPSESIVLE
IKSRSLDNTETNMQKYATNCTLYGGYCRRIRYDKDWTECYTLDELYENRRTKSNPSHQVE
NLQL------QLVPKKRKRALVSDPFQQSREQKPISG-VFAGLFFYVLSDYINSVTGVRI
TRSELNDVIVKHGGKLIHNVILKRHCIGDVRLIGCKLTRECRALIDRGYDILHPRWIMDC
TAYNKLLPIEPSYCFSVSGKLRAVARRRVDCFGDSFENDISESKLSSLQKSQPDLL----
-STRQADKSFELQIIPLFLFSNRIVYIPRS-KIGPKDEMLLEMKIRLFGGKITDQQSLSN
LIIIPYADPIWRGD--CLEEVHSQINEHVKASNSDTVPRIPRIVTPEWVDHSISENCQVP
EEDFPVSHY-
>Smik_15.174
----------------------------------------MVSTLDSVPEPQNFAPSPDF
KWLCEELFSKIDEVQ-----VKGTIGTGKSRSFKYYEVLSNFVEMWRKTVGNNIYPALIL
ALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEGRLKDWKQRVGKGKNLSSLLVEEIAK
RRSEP---NGKAITIDGINSTLDELSKDRSTS----GR-GFKNLVKSSPFLHCLESMSFV
ELKYFFDILLKSRVIGGQEHKFLSCWHPDAQDYLSVVSDLKVVASKLYDPRVRLKNDDLT
IKVGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVRFYSRRGI
DYTYLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARRKVILPFGLVKGSAKDAL--
SFNSIN-NVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRTSRCY
NVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLVIIGR
DPGKKDSFMLGLLLLNEKEMDKRDQE--VSSGIANN--------SK-NENILYSQKKVKK
ILSFCSVANGISQEEFKEIDRKTRGCWKKTSEVAPPASIFEFGSKIPAEWIEPNESIVLE
IKSRSLDNTETNMQKYATSCTLYGGYCKRIRFDKDWTDCFTLNELYDSRSARFNPSYQAE
KSHL------KLVRKKRREVLTSNTFDQKTEQIPTSI-IFAGLYFYVLSDYVTNASEVRI
TRGELENAIVRHGGRLIYNIILKRHYIGDVRLISCKNTTECRALINRGYDILHPSWVIDC
VAYKKLIPIEPCYCFNVSQKMRAVAEKRVDCLGDSFENDISETKLSLLYKSQHNLP----
-PPEEVERDAEVQVFPLFLFSNRIVYIPPR-KIGMKYEKTLEMKIRLFGGKITDRQSLCN
LVIIPYGDPTWRKD--CIKEVNEQIKEQVKA--LDTIPKIPRIVAPEWVDHSIYGNCQVP
EEDFPVVTY-
>YOR005C
----------------------------------------MISALDSIPEPQNFAPSPDF
KWLCEELFVKIHEVQ-----INGTAGTGKSRSFKYYEIISNFVEMWRKTVGNNIYPALVL
ALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEQRLKDWKQRVGKGGNLSSLLVEEIAK
RRAEP---SSKAITIDNVNHYLDSLSGDRFAS----GR-GFKSLVKSKPFLHCVENMSFV
ELKYFFDIVLKNRVIGGQEHKLLNCWHPDAQDYLSVISDLKVVTSKLYDPKVRLKDDDLS
IKVGFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIKFFSRRGI
DYTYLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLVKGSAKEAL--
SFNSIN-NVDFHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRSSRCY
GVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLIVIGR
DSGKKDSFMLGLLVLDEEEYKKHQGD--SSEIVDHS--------SQ-EKHIQNSRRRVKK
ILSFCSIANGISQEEFKEIDRKTRGHWKRTSEVAPPASILEFGSKIPAEWIDPSESIVLE
IKSRSLDNTETNMQKYATNCTLYGGYCKRIRYDKEWTDCYTLNDLYESRTVKSNPSYQAE
RSQL------GLIRKKRKRVLISDSFHQNRKQLPISN-IFAGLLFYVLSDYVTEDTGIRI
TRAELEKTIVEHGGKLIYNVILKRHSIGDVRLISCKTTTECKALIDRGYDILHPNWVLDC
IAYKRLILIEPNYCFNVSQKMRAVAEKRVDCLGDSFENDISETKLSSLYKSQLSLP----
-PMGELEIDSEVRRFPLFLFSNRIAYVPRR--KISTEDDIIEMKIKLFGGKITDQQSLCN
LIIIPYTDPILRKD--CMNEVHEKIKEQIKA--SDTIPKIARVVAPEWVDHSINENCQVP
EEDFPVVNY-
>KAFR0A05050
----------------------------------------MDLTVPEVEVPRNFAPSPQF
KWLCEELFSKLEEVP------NQRHLTTKRITLRYYEIITNFVNLWRTTVGDDIYPALIL
ALPYRDRRMYNVKDYTLIKAICTYLKLPKNSFTEKRLLNWKQRADRSVKLSVSCVNEMRK
RKSEPV--EKSPITLDELNTLLDFLSQDRNIK----GR-GYKNLSESSIFTYCIEKMSFM
ELRYFFDIILKARVIGPHEHKLLNAWHPDAEDYLSVVSDLKTVCTRLWNPNIRLRHDELS
INIGYAFAPHLAKKLSISYDKICKKLKNDFFIEEKMDGERIQIHYMDYGNDIKFLSRRGV
DYTYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAAMNAL--
TKEEIS-GQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFTRCS
NENIIRKSLEHAISVGSEGIVLKNYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLIVIGR
DSAKKDSFYCGLTVLDEEEEK--LVEEIDKGVVNLVSD------ES-DYENPENNRHIKK
VVSFCMIANGISQNEYKEIYRKTRGFWKKTEEVPPPPELIEFGTQVPMEWIEPEHSVVLE
IKARSLDNTESSCKRFKAGCTLYGGYCRRIRDDVDWKSSFSLAELRRDRRIKHYPGTSEK
DTLLKS----KKRRKKQLLTPLNQNLNP-RDIQTTSK-IFDGLFFYILSDYFDTNENVRI
SKDDLQKLLLENGGKISHNIVSKRESKSNLRILCGKYTAECNVLIKRGYDILSPQWVIDC
VENKKIVKIEPSHCFSVSDDLMALAMRRVDKYGDSYESLLSVSRLSYILRSSKDIS---P
DLLSPANMSLDFEKVPYFLFWRRKAFVMEH-NFDKSSIRETILKIQLYGGKVVKNISECN
IVIFPKAEITVIRE--SMKFIRNTLAKTVST--SVELPMLPRIVSFEWIDASIEKNVQVP
EEDYVPM---
>NDAI0I02260
--------------------------------MDGKAVTPTLDNDTRPATPHNFAPSPSF
RWLCDELFVKLERIQ-QASTSKASKEFQKPINVQYYEVIQHFINLWRKTVGNDIYPALIL
ILPYRDRRIYNVRDYTLIKAICSYLKLPKNSFTEKRLLSWKQRAGRSVRLSSFIVSEIKK
RKSEPQVGTREEITIDKLNQCLDSLSEERNSK----GSMGYRGLSDSPTFVFCLENMTFV
ELQFFFDIILKSRVIGGHEHKFLNVWHPDAQDYLSVVSDLKTVANKLWDPAVHLKNDDLT
INVGSPFAPQSAKKLSISYEKICAKLKHDFFIEEKMDGERIQLHYQDYGNKLSFLSRRGT
DYTYLYGESIKDGTVSKYLHLDNNVQNCVLDGEMVTFDKERNALLPFGLVKSSARSII--
TQEGVA-NEGYRPLLMVFDLVYLNGVSLVNIPLYQRKLYLEKIFTPERHIVELLRSKRCS
DERSIKNALEHAISIGSEGVVLKHYNSRYTVASRNDDWIKVKPEYLEQFGENMDLIVIGK
DPGKKDSLMCGLAVVEEDE---PEIDEDGNEIVNLDSQDSIGEGEDKEGNEIEREKTIKR
FVSFCSIANGISQEEFKYIGRITKGCWKKSDEIPPPSDLLEFGSRVPAEWIDPKDSIVIE
VKARSLNNDEEATKKFKTGITLYGGYCRQIREDKDWKTCYTLSELRRMKRFKLGSNKRAN
NDATHALDSSKRRKARRIDYGFEKYFEQTPTTLDQSR-IFDGLYFYVISDVVDA-TGSRV
SREELYDKILNRGGVIVHNVIAKHHGENQFRILCGKYTAECQSLIDRGYDIIEPQWVLDC
IKDDMLLKLEPKYCFNVSEELMKIAKRRVDGFGDSFEAQISEDSFSRLIERNVRSL---R
NAPPSIQYDM-VDTVPLFLFYGRTILLRIK---DKALFTKLKVQIRLYGGKTTGDLASCN
LVVIQQNEIAV------AKDVRSSLLKLTSD--TDKPPVLPYIVTPEWIDSSISEGCQVP
EEDHPVV---
>NCAS0D02650
----------------------------------MSQQIQLSQEPPPVMTPCNFSPSPAF
QWLCDELFVKLEDIQ----SKRDPKNIGKPVTVRYYEVINHFIALWRKTVGNDIFPALIL
ILPYRDRRLFNIRDYTLIKAICAYLKLPRNSFTEKRLLSWKARAGKGVKLSQFCVNEIKK
RKSEPK--DKIEITIDRLNECLDKLAEERNSK----GR-GFKKLADSPTFKFCLENMSFI
ELQFFFDILLKNRVIGGQEHKFLNAWHPDAQDYLSVVSDLRTVTTRLWDPEIRLQNNDLV
INPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHYQDYGEKLKFFSRRGT
DYTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGLVKSSARSML--
TKDGIM-NEGYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPHIIELLSSYHRF
NEDSIRKSLELAISMGSEGIVLKRYDSRYTVASRNDDWIKVKPEYLEQFGENMDLIVIGR
DPGKKDSLMCGLAVVEEDEKAD-LNENNDDNVIILD--------DD-EDAPVEQERTIHK
FVSFCVIANGLSQEEFKQIDRKTRGLWNRSDEIPPPDTLLQFGTRLPIEWIDPKKSVVIE
VKARSIDAAESNGRKFATGCTLYGGYCRGIREDKDWQTCYTLSEFLRTKNVKSRRNGSDQ
VIHGV-----KRQKKNRRKYILDQSLEEEGGLLKNTA-FFRNLYFYVISDVFDDVLGTRI
EKERMYKYIQEGGGTLIHNIISKQFGTRNLRIISGKLTNECSALIERGYDVINPQWIVDC
VQSKSLLKLEPKYCFNVSTELKKLTEKRVDTFGDSYEVPITEEQLSTLLETELNLV--RV
QGLVTPYADEELIKIPLFLFQDRIMLFPNT---ESKTISFLQEKIKLYGGKLTTDIGKCN
LIILPNGNQQL------LQRTRDLLTKNIMN--SGEVPTIPYIVNPLWIERSIEENSQVP
EEDYPVI---
>ZYRO0C07854g
----------------------------------------MSTKTDDQNKPHNFAPSPDF
KWLCDELFVKIDNVQ----KQTRDHGAFKSLTVKYFEIISFFVKLWRKTVGDNIYPALIL
ILPYRDRRIFNIKDYTLIKAICSFLRLPANSVTEKRLLRWKRRAGRGIKLSDFCVEEIRR
RRSEPL--NGERITIDKLNECLDQLAEERNTK----GR-GFKSLADSSVFKYCLENMSFT
EMKYYFDIILKSRVIGGQEHKFLNCWHPDARDYLSVVSDLKTVADKLWDPSHRLKNDDLG
VNLGLPFAPFLAKRLYISYDKVALRLKSDFYIEEKMDGERIQLHYMDYGRKLKWFSRRGN
DYTYLYGEDIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFGLVKSSARDSL--
TAEGIL-TQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEIIQSMHCY
DDTSIKSSLEKAIMMGSEGIILKHFKSKYEIGARTDNWIKIKPEYLEQFGENLDLLVIGR
DPGKKDSLMCGLAVLEGDEEPGAQSD---KQVVNLD-----------SEEEEEPRKAVKK
FISFCTIANGISQEEFKQIERKTAGKWKNTEDHKPP-KILEFGSKLPEEWIYPEDSVVLE
VKARSLDNTESSGRKFKVGCTLHGGYCRRIREDKNWTECYTLYELWQERRKKVPLSEDSN
NQKPMKS---KKIRRPRIVSRLNQTLSCD-DEAKTSS-IFDGLIFYVISDYMASQDSERI
SKEQLCDLISGNGGKLTFNVISDHRVKGGLRIISGKYTLECKALIERGYDILSPQWLMDC
VNTGFLVTIEPRHCFSVSEDMEKIARTRVDHFGDSYDVEITEDRLRDILTSKEFDS---D
FSTGSLDVISDVEDIPLFLFSRRIVFIPEG--FSYLDTQLLKHKVRLYGGQLTDNVNQCN
LIIVPDGKINLRGR--IISDLRRLLSTFAAM--TELPPAIPWIVIPAWIDRSIEENIQVP
EEDFLAV---
>TDEL0G04510
------------------------MESAEILTSTHEVSQELQESESTEKAPPNFAPSPDF
IWLCEELFVKLEDVQ----RQGREHLGNKPLSVRYYEVISHFIRLWRKTVGNNIFPALVL
SLPYRDRRIYNIKDYTLVKAICSYLALPKQSATEKRLLKWKRRATRGVRLSNFCVEEIRK
RKSEPS--PGRRITIDKLNECLDHLVEERNAK----G--GFKGLSDSPTFNFCLQNMSFI
ELRFFFDIVLKNRVIGGQEHKLLNCWHPDALDYLSVVSDLETVASRLWDPEHRLRRDDLS
INLGYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAKIRFLSRRGV
DYTQLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKSSARQAL--
STEGIC-SQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEILPYVRCS
EHTAIRKSLEKSISMGSEGIVLKSYKARYEIGARNDYWIKVKPEYLEQFGENLDLVIIGR
TPGKKDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSE------GD-ELDDTDGKKIIKY
FISFCVIANGISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKNSIMLE
VKARSLDNTESSKKKFAAGCTLHGGYCRRIRDDKDWTGCYSFSELWQERLHKSSTGVGSF
NKQYSK----KMKSKKRKIDPFSGQAAKKHDVFDSTN-IFKGLQFYVLSDYIDVSRNVRI
TKSEFDDLILQNSGKLVRNLISKHHSESQFRIISGKYTAECRALIERGYDILSPQWILDC
IRNRMVVKLEPRHCFNVSSELMTIVNGRVDEYGDSFVNPITEQQLDNLIDTNMKQT----
EPNLMREANSELDVVPLFLFSTRAVYIPPQ-VFNAVDAYGLTSKFKLHGGSIASDIPSCN
LIIMPNENQRLGTQ--SLVEMRQSVLQAMGR--NDSTPSIPYIVTPDWVEKSIEENCQVP
EEDFTPVYA-