MUSCLE (3.8) multiple sequence alignment

TBLA0A07290        MRQKRAKSYKKQLIVYNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIK
TPHA0J00280        MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTL-QAENIK
KNAG0F02880        MRQKRAKSYRKQLLVYNHTFRFREPYQVILDDEIVLQATESKFDLYKALQRTV-QAE-VK
ZYRO0C07920g       MRQKRAKSYKKQMLVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTL-QAE-VK
CAGL0E02673g       MRQKRAKSYRKQLLVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTL-QAE-VK
KAFR0A05060        MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTL-QAE-VK
NDAI0I02250        MRQKRAKSYRKQLLVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTL-QSE-VK
NCAS0D02660        MRQKRAKSYRKQLLVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTL-QAE-VK
TDEL0G04540        MRQKRAKAYRKQMLVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTL-QAE-VK
KLTH0C11352g       MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTL-QAE-VK
Kwal_56.22399      MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTL-QAE-VK
Ecym_3019          MRQKRAKAYKKQMLVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTL-QAE-VK
ACR011C            MRQKRAKAYKKQMLVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTL-QAE-VK
KLLA0D01023g       MRQKRAKSYRKQMLVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTL-QAE-VK
SAKL0E01056g       MRQKRAKSYRKQMLVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTL-QAE-VK
Kpol_1045.74       MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTL-QAE-VK
Smik_15.173        MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTL-QAD-VK
YOR004W            MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTL-QAD-VK
Skud_15.165        MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTL-QAD-VK
Suva_15.179        MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTL-QAD-VK
                   ***.***:*.**::**.: *.** *** ::*: :*     : :::   *...: .:: :*

TBLA0A07290        PMITQCCISALYKSEDQESISIGKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHRYI
TPHA0J00280        VMITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYV
KNAG0F02880        LMITQCCMQALYATNNRQAIDMAKRYERRRCNHPPKDPKSPFECIESVVDIKGENKHRYI
ZYRO0C07920g       PMITQCCMQALYFTKNQDAIELGKSFERRRCNHPPKEAKPPHECIQSVVNVNGSNKHRYV
CAGL0E02673g       PMITQCCMQALYETKNEHAIDLGKEFERRRCGHMPGEAVSPKECILNVVDVKGKNKHRYV
KAFR0A05060        PMITQCCMQALYETRDQNAIDMAKGFERRRCNHPPKEPKTPIECVLSVVNVNGKNKHRYV
NDAI0I02250        VMITQCCMQALYEENNQDAIELARRFERRRCNHNPKEPKTAIECIESVVNINGQNKHRYV
NCAS0D02660        VMITQCCMQALYEANDQNAIELARRFERRRCNHNPKDPKTPIECIESVVNINGQNKHRYV
TDEL0G04540        VMITQCCMQALYETNKQGAIELAKTFERRRCNHPPKEPKPPIECLESIVCVNGHNKHRYV
KLTH0C11352g       PMITQCCIQAIYETKNQDAIELAKSFERRRCNHPPKEAKPPIECLQSVVSVNGNNKHRYV
Kwal_56.22399      PMITQCCIQAIYETNDQEAIELAKSFERRRCNHPPKEAKPPLECLQSVVNVNGVNKHRYV
Ecym_3019          PMITQCCVQKLYESKNQGAIAQAKMYERRRCNH-YKEPKEPSECIRSVVDINGRNLHRYV
ACR011C            PMITQCCMQKLYDTKNQDAIAQGKLYERRRCNH-VKEPKEPIECLQSVVAVNGQNRHRYI
KLLA0D01023g       PMITQCCMQSLYQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHRYV
SAKL0E01056g       PMITQCCMQALYATKDQGAIEMAKTYERRRCNHPPKESKTSLECIESVVNFNGKNKHRYV
Kpol_1045.74       VMITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYV
Smik_15.173        VMITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPADCIESVVDINGANKHRYV
YOR004W            VMITQCCIQALYETRNDGAINLAKQFERRRCNHSFKDPKSPAECIESVVNISGANKHRYV
Skud_15.165        VMITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYV
Suva_15.179        VMITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYV
                    ******:. :*   .   *  .. :*****.*   :.    :*: .:* ..* * ***:

TBLA0A07290        VATQDLELRRKLRKIPGVPLIHFKRSVMVMEPLSDASCEYNEEVESKKLTSGLNSTKA-S
TPHA0J00280        VATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKY-S
KNAG0F02880        VACQNIDLRRKLRRVPGVPLIHVSRAVMIMEPLSDASARISKRMEQQKLFSGLNDAKA-A
ZYRO0C07920g       VASQDVTLRRKLRKVPGVPLIHMSRSVMVMEPLSEASSRVNEMSEREKLLKGLNDPKL-A
CAGL0E02673g       VACQDVEIRRLLRKVPGVPLLHISRSVMIMEPLSDASAKVSRMEEESKLFRGLNDPKY-A
KAFR0A05060        VASQDIDIRRQLRRVPGVPLVHISRSVMIMEPLSDTSAKISSRMEQEKLYKGLNDPKY-A
NDAI0I02250        VASQDLATRRKLRQVPGVPLIHISRAVMIMEPLSDVSAQVSRRKENEKLYKGLNDPKF-T
NCAS0D02660        VAAQDVAIRRKLRQVPGVPLVHISRAVMIMEPLSDASAKVSKRKENEKLYKGLNDPKY-T
TDEL0G04540        VASQDIDTRRILRRTPGVPLVHTVRSVMVMEPLSDASAKVSSAAEAEKLHKGLNDPRN-A
KLTH0C11352g       VASQDPSIRKKLRQVPGVPLIYMNRSVMVMEPLSKASGDFSRAQEKEKLFKGLNDPKY-A
Kwal_56.22399      VATQNQEIRGCLRKVPGVPLVFMNRSVMVMEPLSKASQNVSRVQEREKLFKGLNDPKF-A
Ecym_3019          VATQDIEIRRILRRVPGVPLIYMNRSVMVMEPLSSNSQQVSQQVENEKLVKGLNDPKY-A
ACR011C            VASQDIAIRRALRKVPGVPLVYINRAVMVMEPLSSTSEQVSREAEKQKLFKGLNDPKY-T
KLLA0D01023g       VATQDVEIRRRLRKIPGVPLVYMNRSVMVMEPLSNASEKVSREVEEQKLYKGLNDPKF-A
SAKL0E01056g       VATQDIDIRRKLRRVPGVPLIYMNRSVMVMEPLSEASERLSKVREEEKLFKGLNDPKH-A
Kpol_1045.74       VASQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTA
Smik_15.173        VASQDIGLRRKLRNVPGVPLIHLTRSVMVMEPLSTASAKASKMTEERKLYKGLNDPNV-D
YOR004W            VASQDIDLRRKLRTVPGVPLIHLTRSVMVMEPLSTASAKASKITEEQKLYKGLNDPNI-E
Skud_15.165        VASQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNV-E
Suva_15.179        VASQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDPNI-E
                   ** *:   *  **  ****::.  *:**::**:*  *   .   *  **  ***...   

TBLA0A07290        V----------------EGGQENGIKKKK----VKGVNPLSMKKKSNSNSNSNSNSNSNS
TPHA0J00280        MAPTPKE-GTPD-----TEGTQPAATKKR--KGVKEPNPLSKKKKV-------------K
KNAG0F02880        GIKAAET-EKVE--DKGKEAPEAKPKKRK--LGPKQPNPLSMKKKKKD---------GNS
ZYRO0C07920g       GLKTTPS-VENE-----LESESQPPAKKR--KGPKGPNPLSVRKKQKKPEQQGQGQGQEQ
CAGL0E02673g       GLKGEHE-EEEQ------SKEQTVAKKRK--IGPKQPNPLSMKKKK-----------KEN
KAFR0A05060        GLKLDEE-EATE-----TQGSGEKTAKKK--RGPKGPNPLSVRKKV------------KT
NDAI0I02250        GVKSAVD-KETV-----KEKESTDQQKKKRKIGPKGPNPLSMKKKK-----------TAS
NCAS0D02660        GVKTAAE-DVKI-------DDKPKPKKSK--YGPKSPNPLSMKKKK------------QE
TDEL0G04540        GIK--------------TENPQTSIKKR-----TKQPNPLSVKKRK------------TE
KLTH0C11352g       GLPAEEE-GGKT-----DNGTEVSKNKRK---GPKGPNPLSIKKKKTVPDS-------KD
Kwal_56.22399      GLPLTEQ-PATATAATVDKEGAGAPAKKR--KGPKGPNPLSIKKKK---TSESRKEPVNP
Ecym_3019          GTPNNTEDASVD-----PKSPDANQLKRK-IKGPKEPNPLSIKKPR--------------
ACR011C            GIAENSA--PAG-----AQPAEGAPTLKR--KGPKAPNPLSMKKRK--------------
KLLA0D01023g       GIARDEN-DEAG-----AENQENKPKKRK---GPKEPNPLSMKKKKTTESTGSISSLSAS
SAKL0E01056g       GLAHDES-VDLV-----DSVKQKQPSKKK--GGPKEPNPLSVKRKR-------------D
Kpol_1045.74       GLDEPKS----------EKSEKTSESKKN--KGPKQPNPLSMKKRK--------------
Smik_15.173        KVQEISE----------GSGKESVTKKRK--FGPKAPNPLSVKKKK------------KA
YOR004W            KLQESGD----------GSGKESITKKRK--LGPKAPNPLSVKKKK------------KV
Skud_15.165        KTEKVSS----------ESGKESAPKKRK--IGPKAPNPLSVKKKK-------------T
Suva_15.179        KAEAISK----------GSEKESTPKKRK--AGPKAPNPLSMKKKK------------KT
                                                     *  **** ..                

TBLA0A07290        KPKPKPIKHERDNENATDQPAKKRRKRKHTSNA------------NAKKSEE--------
TPHA0J00280        VEIPKPAATTTD-------AANKKRRRKHRSNKNSENGNEGEDPKETGNSEEQVPESQDA
KNAG0F02880        EQKNVGTKKDNE----DDSTDKKKRKRRHKAKK-----EPSDSHGESQKQDESDA-----
ZYRO0C07920g       EQEHESEREHED-----AGKKKRRRRRKHKGSH-EDGDGQENSAGEVEAEDRPQEDRPQE
CAGL0E02673g       TKKEQQTETSAD----QSQPTKRRRSRKHKHGS----KNSTDTNENGNLSEEEN------
KAFR0A05060        LNEPKQTDKNDD--VQEETTEKKKRRRKHRPKKDTGINEDTNINDEKEYEQESN------
NDAI0I02250        NSMNENIKNREGHNDANIDDSKKKRRRKHKSKT-----GTEIENKDKDAAEGANSE----
NCAS0D02660        PKRNREDSTEDQ----ESSENKKKRRRKHKPKT------EADTVTEPAASDSLGQQ----
TDEL0G04540        SKGEPKAAQDTE----PVASNTKKRRRKHKSST-----------TEPQGQEEST------
KLTH0C11352g       ESPPSDKISVTDAEPVDRSSSGRRRRRHHKRSS--------TEAGEEGESGNISS-----
Kwal_56.22399      AENTSATLTEND----NKEQPSRRRKRSHKKTT-------PQTAEETTSEQQDT------
Ecym_3019          --VNKAQLPSED----VFNLTDKKKGGGSMGHRIFVTTLHRPMNIRIKFTQEYREE----
ACR011C            VKEEQPTSDASE----QKADASKKRRRKHKKAT------------SAETPAESTSD----
KLLA0D01023g       SNNISTPTEAGD----VSGTSKNKRRRKHKKSN-----------DKPNDSADSIQ-----
SAKL0E01056g       QREENTKAPAET----AEQSERKRRKRRHGKPALKSSGEGAPENGTAKAPQSDSDSS---
Kpol_1045.74       ---SKPASNEVE----AETESKKKRRRKHRSNA----NSNESEIKHSDNENASDGE----
Smik_15.173        YSTSDEARGKED-----TSKEKKRRRRKHGSHT------NSITNRTTAA-----------
YOR004W            NSPSDEVKDKED----TSKEKKKRRRRKHKSNT-----NVPVSNGTTAAQ----------
Skud_15.165        SQPSNETKGEDD------AFKEKKRRRKHKSST-----NKSAINGTTVLQVQPSSD----
Suva_15.179        GPSDDEVKDKDD-----ASKDKKRRRRRHKSNA-----DDSIASGTSVAQGQASSD----
                                         ...                                   

TBLA0A07290        ----------
TPHA0J00280        N---------
KNAG0F02880        ----------
ZYRO0C07920g       DRPQGDQNSD
CAGL0E02673g       ----------
KAFR0A05060        ----------
NDAI0I02250        ----------
NCAS0D02660        ----------
TDEL0G04540        ----------
KLTH0C11352g       ----------
Kwal_56.22399      ----------
Ecym_3019          ----------
ACR011C            ----------
KLLA0D01023g       ----------
SAKL0E01056g       ----------
Kpol_1045.74       ----------
Smik_15.173        ----------
YOR004W            ----------
Skud_15.165        ----------
Suva_15.179        ----------
                             

FASTA FORMAT for MUSCLE Version 3.6

>TBLA0A07290
MRQKRAKSYKKQLIVYNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIK
PMITQCCISALYKSEDQESISIGKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHRYI
VATQDLELRRKLRKIPGVPLIHFKRSVMVMEPLSDASCEYNEEVESKKLTSGLNSTKA-S
V----------------EGGQENGIKKKK----VKGVNPLSMKKKSNSNSNSNSNSNSNS
KPKPKPIKHERDNENATDQPAKKRRKRKHTSNA------------NAKKSEE--------
----------
>TPHA0J00280
MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTL-QAENIK
VMITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYV
VATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKY-S
MAPTPKE-GTPD-----TEGTQPAATKKR--KGVKEPNPLSKKKKV-------------K
VEIPKPAATTTD-------AANKKRRRKHRSNKNSENGNEGEDPKETGNSEEQVPESQDA
N---------
>KNAG0F02880
MRQKRAKSYRKQLLVYNHTFRFREPYQVILDDEIVLQATESKFDLYKALQRTV-QAE-VK
LMITQCCMQALYATNNRQAIDMAKRYERRRCNHPPKDPKSPFECIESVVDIKGENKHRYI
VACQNIDLRRKLRRVPGVPLIHVSRAVMIMEPLSDASARISKRMEQQKLFSGLNDAKA-A
GIKAAET-EKVE--DKGKEAPEAKPKKRK--LGPKQPNPLSMKKKKKD---------GNS
EQKNVGTKKDNE----DDSTDKKKRKRRHKAKK-----EPSDSHGESQKQDESDA-----
----------
>ZYRO0C07920g
MRQKRAKSYKKQMLVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTL-QAE-VK
PMITQCCMQALYFTKNQDAIELGKSFERRRCNHPPKEAKPPHECIQSVVNVNGSNKHRYV
VASQDVTLRRKLRKVPGVPLIHMSRSVMVMEPLSEASSRVNEMSEREKLLKGLNDPKL-A
GLKTTPS-VENE-----LESESQPPAKKR--KGPKGPNPLSVRKKQKKPEQQGQGQGQEQ
EQEHESEREHED-----AGKKKRRRRRKHKGSH-EDGDGQENSAGEVEAEDRPQEDRPQE
DRPQGDQNSD
>CAGL0E02673g
MRQKRAKSYRKQLLVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTL-QAE-VK
PMITQCCMQALYETKNEHAIDLGKEFERRRCGHMPGEAVSPKECILNVVDVKGKNKHRYV
VACQDVEIRRLLRKVPGVPLLHISRSVMIMEPLSDASAKVSRMEEESKLFRGLNDPKY-A
GLKGEHE-EEEQ------SKEQTVAKKRK--IGPKQPNPLSMKKKK-----------KEN
TKKEQQTETSAD----QSQPTKRRRSRKHKHGS----KNSTDTNENGNLSEEEN------
----------
>KAFR0A05060
MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTL-QAE-VK
PMITQCCMQALYETRDQNAIDMAKGFERRRCNHPPKEPKTPIECVLSVVNVNGKNKHRYV
VASQDIDIRRQLRRVPGVPLVHISRSVMIMEPLSDTSAKISSRMEQEKLYKGLNDPKY-A
GLKLDEE-EATE-----TQGSGEKTAKKK--RGPKGPNPLSVRKKV------------KT
LNEPKQTDKNDD--VQEETTEKKKRRRKHRPKKDTGINEDTNINDEKEYEQESN------
----------
>NDAI0I02250
MRQKRAKSYRKQLLVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTL-QSE-VK
VMITQCCMQALYEENNQDAIELARRFERRRCNHNPKEPKTAIECIESVVNINGQNKHRYV
VASQDLATRRKLRQVPGVPLIHISRAVMIMEPLSDVSAQVSRRKENEKLYKGLNDPKF-T
GVKSAVD-KETV-----KEKESTDQQKKKRKIGPKGPNPLSMKKKK-----------TAS
NSMNENIKNREGHNDANIDDSKKKRRRKHKSKT-----GTEIENKDKDAAEGANSE----
----------
>NCAS0D02660
MRQKRAKSYRKQLLVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTL-QAE-VK
VMITQCCMQALYEANDQNAIELARRFERRRCNHNPKDPKTPIECIESVVNINGQNKHRYV
VAAQDVAIRRKLRQVPGVPLVHISRAVMIMEPLSDASAKVSKRKENEKLYKGLNDPKY-T
GVKTAAE-DVKI-------DDKPKPKKSK--YGPKSPNPLSMKKKK------------QE
PKRNREDSTEDQ----ESSENKKKRRRKHKPKT------EADTVTEPAASDSLGQQ----
----------
>TDEL0G04540
MRQKRAKAYRKQMLVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTL-QAE-VK
VMITQCCMQALYETNKQGAIELAKTFERRRCNHPPKEPKPPIECLESIVCVNGHNKHRYV
VASQDIDTRRILRRTPGVPLVHTVRSVMVMEPLSDASAKVSSAAEAEKLHKGLNDPRN-A
GIK--------------TENPQTSIKKR-----TKQPNPLSVKKRK------------TE
SKGEPKAAQDTE----PVASNTKKRRRKHKSST-----------TEPQGQEEST------
----------
>KLTH0C11352g
MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTL-QAE-VK
PMITQCCIQAIYETKNQDAIELAKSFERRRCNHPPKEAKPPIECLQSVVSVNGNNKHRYV
VASQDPSIRKKLRQVPGVPLIYMNRSVMVMEPLSKASGDFSRAQEKEKLFKGLNDPKY-A
GLPAEEE-GGKT-----DNGTEVSKNKRK---GPKGPNPLSIKKKKTVPDS-------KD
ESPPSDKISVTDAEPVDRSSSGRRRRRHHKRSS--------TEAGEEGESGNISS-----
----------
>Kwal_56.22399
MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTL-QAE-VK
PMITQCCIQAIYETNDQEAIELAKSFERRRCNHPPKEAKPPLECLQSVVNVNGVNKHRYV
VATQNQEIRGCLRKVPGVPLVFMNRSVMVMEPLSKASQNVSRVQEREKLFKGLNDPKF-A
GLPLTEQ-PATATAATVDKEGAGAPAKKR--KGPKGPNPLSIKKKK---TSESRKEPVNP
AENTSATLTEND----NKEQPSRRRKRSHKKTT-------PQTAEETTSEQQDT------
----------
>Ecym_3019
MRQKRAKAYKKQMLVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTL-QAE-VK
PMITQCCVQKLYESKNQGAIAQAKMYERRRCNH-YKEPKEPSECIRSVVDINGRNLHRYV
VATQDIEIRRILRRVPGVPLIYMNRSVMVMEPLSSNSQQVSQQVENEKLVKGLNDPKY-A
GTPNNTEDASVD-----PKSPDANQLKRK-IKGPKEPNPLSIKKPR--------------
--VNKAQLPSED----VFNLTDKKKGGGSMGHRIFVTTLHRPMNIRIKFTQEYREE----
----------
>ACR011C
MRQKRAKAYKKQMLVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTL-QAE-VK
PMITQCCMQKLYDTKNQDAIAQGKLYERRRCNH-VKEPKEPIECLQSVVAVNGQNRHRYI
VASQDIAIRRALRKVPGVPLVYINRAVMVMEPLSSTSEQVSREAEKQKLFKGLNDPKY-T
GIAENSA--PAG-----AQPAEGAPTLKR--KGPKAPNPLSMKKRK--------------
VKEEQPTSDASE----QKADASKKRRRKHKKAT------------SAETPAESTSD----
----------
>KLLA0D01023g
MRQKRAKSYRKQMLVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTL-QAE-VK
PMITQCCMQSLYQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHRYV
VATQDVEIRRRLRKIPGVPLVYMNRSVMVMEPLSNASEKVSREVEEQKLYKGLNDPKF-A
GIARDEN-DEAG-----AENQENKPKKRK---GPKEPNPLSMKKKKTTESTGSISSLSAS
SNNISTPTEAGD----VSGTSKNKRRRKHKKSN-----------DKPNDSADSIQ-----
----------
>SAKL0E01056g
MRQKRAKSYRKQMLVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTL-QAE-VK
PMITQCCMQALYATKDQGAIEMAKTYERRRCNHPPKESKTSLECIESVVNFNGKNKHRYV
VATQDIDIRRKLRRVPGVPLIYMNRSVMVMEPLSEASERLSKVREEEKLFKGLNDPKH-A
GLAHDES-VDLV-----DSVKQKQPSKKK--GGPKEPNPLSVKRKR-------------D
QREENTKAPAET----AEQSERKRRKRRHGKPALKSSGEGAPENGTAKAPQSDSDSS---
----------
>Kpol_1045.74
MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTL-QAE-VK
VMITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYV
VASQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTA
GLDEPKS----------EKSEKTSESKKN--KGPKQPNPLSMKKRK--------------
---SKPASNEVE----AETESKKKRRRKHRSNA----NSNESEIKHSDNENASDGE----
----------
>Smik_15.173
MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTL-QAD-VK
VMITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPADCIESVVDINGANKHRYV
VASQDIGLRRKLRNVPGVPLIHLTRSVMVMEPLSTASAKASKMTEERKLYKGLNDPNV-D
KVQEISE----------GSGKESVTKKRK--FGPKAPNPLSVKKKK------------KA
YSTSDEARGKED-----TSKEKKRRRRKHGSHT------NSITNRTTAA-----------
----------
>YOR004W
MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTL-QAD-VK
VMITQCCIQALYETRNDGAINLAKQFERRRCNHSFKDPKSPAECIESVVNISGANKHRYV
VASQDIDLRRKLRTVPGVPLIHLTRSVMVMEPLSTASAKASKITEEQKLYKGLNDPNI-E
KLQESGD----------GSGKESITKKRK--LGPKAPNPLSVKKKK------------KV
NSPSDEVKDKED----TSKEKKKRRRRKHKSNT-----NVPVSNGTTAAQ----------
----------
>Skud_15.165
MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTL-QAD-VK
VMITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYV
VASQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNV-E
KTEKVSS----------ESGKESAPKKRK--IGPKAPNPLSVKKKK-------------T
SQPSNETKGEDD------AFKEKKRRRKHKSST-----NKSAINGTTVLQVQPSSD----
----------
>Suva_15.179
MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTL-QAD-VK
VMITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYV
VASQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDPNI-E
KAEAISK----------GSEKESTPKKRK--AGPKAPNPLSMKKKK------------KT
GPSDDEVKDKDD-----ASKDKKRRRRRHKSNA-----DDSIASGTSVAQGQASSD----
----------