MUSCLE (3.8) multiple sequence alignment

ACR004W            -----MNQGRLRDKPRMEG------APPSKEPGQKGIATD-AKKPGLKEAFFASPLYDFL
Ecym_3027          ----------------MSG------SSGAVASEKGQDTRR----SCVEESFFASPLYDFL
KNAG0F02890        -------MSSEKKEPQGED------ASSKTKSLSKLQRNKDEAAPEVEECFYASPIYDFL
Skud_15.163        -----------------------------MAIGKRLLVNK-----PAEESFYASPMYDFL
Suva_15.177        -----------------------------MAIGKRLLVNK-----PAEESFYASPMYDFL
YOR002W            -----------------------------MAIGKRLLVNK-----PAEESFYASPMYDFL
Smik_15.171        -----------------------------MAIGKRLLVNK-----PAEESFYASPMYDFL
CAGL0E02629g       --------------------------MSSEKKDKKAVSKF--ESEQGEESFYASPLYDFL
TDEL0G04470        -----------------------------MAPKNKEAKRN-----TVEESFYASPLYDFL
ZYRO0C07744g       ---------------------------MPSKTSKKVEKAQ--ADNTAEESFYASPLYDFL
TBLA0G00970        -----------------------------MSSKKKLLKKQ--QKPGEEEAFYASPLFDFL
NDAI0C02630        MVPKKKTLMKNGSTSTVTSSSSQKSKVEDTKKSKKMNNNQPLETETSKESFYASPLYDFL
NCAS0D02160        --------MAGKNKIPKKD------LSSQKKSGKTKETSK--KHDIPEESFYASPLYDLL
KAFR0A05070        -----MRSPEPKKKSPKTK------LKAKSKSNPKKASKL--NNEAIEEVFYASPLYDFL
TPHA0J00350        ----------MGKSGKHNS------KKFVKQTHKNDISSL--DETLDTEPFYASPLYTFL
Kpol_1037.27       ------------------------------MASKKKISRI---NKPVEESFFASPLYDFL
KLLA0D01221g       -----MGLKKKQTPKNAVKKTVSSLPANAETTTSTAIMKK----VESVEAFFASPMYDFL
SAKL0E01364g       -----------------------------MSSKRKPYSRK-----IVKESFFASPLFDFL
KLTH0C11176g       ------------------------------MDARKSLPK---------ESFFASPLYDFL
Kwal_56.22437      ------------------------------MAGKKVSKN---------EPFFASPLYDFL
                                                                   * *:***:: :*

ACR004W            YPLRPVTNQWAAKYIIVIFALIIRLAVGLGGYSGMGKPPMFGDFEAQRHWMEVTQHIPVS
Ecym_3027          YPLRPVANQWSAKYIILIFALIVRLAVGLGGYSGKGKGPLFGDFEAQRHWMEITTCLPIS
KNAG0F02890        YPFRSPGSQWVTEYIIVVFLLIIKSAIGLGSYSGFQTPPMFGDFEAQRHWMEITQHLPVS
Skud_15.163        YPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSGKDSPPLHGDFEAQRHWMEITQHLPLS
Suva_15.177        YPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSGKATPPLHGDFEAQRHWMEITQHLPLS
YOR002W            YPFRPVGNQWLPEYIIFVCAVILRCTIGLGPYSGKGSPPLYGDFEAQRHWMEITQHLPLS
Smik_15.171        YPFRPVGNQWLPEYIIFVCAVIVRCTIGLGPYSGKGSPPLHGDFEAQRHWMEITQHLPLS
CAGL0E02629g       FPFRPAGSQWLTEWIIIMFAMIIRCAIGLGPYSGYKDGPMHGDFEAQRHWMEITQHLPIS
TDEL0G04470        YPFRPAGSQWLTEYVIVLFALIIGCAVGHGSYSGQFSPPMFGDFEAQRHWMEITQHLAPS
ZYRO0C07744g       YPFKPVGSQWLPEYIIILFAVIIRCAIGLGPYSGQSVKPMHGDFEAQRHWLEITQHLPIS
TBLA0G00970        YPFRPVGSQWLTEYVIIIFAIIIRCAISLGSYSGKGTPPMFGDFEAQRHWMEITQHLPIS
NDAI0C02630        YPFRPAGSQWMTEYIIVLFAIIIRCAVGLGPYSGFNTPPMFGDFEAQRHWMEITQYLPIS
NCAS0D02160        YPFRPAGSQWMTEYTIVLFSLIIRCAVGLGPFSGYGVPPMFGDFEAQRHWMEITQHLPIH
KAFR0A05070        YPFRPAGNQWLAQYIIVTFALIIRCAIGLGSYSGMGHSPMFGDFEAQRHWMEITQHLPIS
TPHA0J00350        SPFKSTTNQWLSVYIIVLFALIIRCAIGLGPYSGMNEAPMFGDFEAQRHWMEITQHLPIS
Kpol_1037.27       SPFRPVSNQWLTEYIIVIFALIVRCAIGLGSYSGMGNPPMFGDFEAQRHWMEITQHLPIS
KLLA0D01221g       TPFRPVGNQWCAKYVIVIFALIIRCAVGLGGYSGMNTPPMFGDFEAQRHWMEITQHLPVR
SAKL0E01364g       SPFRPVANQWCAKYIIVLFALIIRCGVGLGSFSGMNVPPMHGDFEAQRHWMELTTNLPLS
KLTH0C11176g       SPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGEATVPMHGDFEAQRHWMELTTNLPLS
Kwal_56.22437      SPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGENSGPIHGDFEAQRHWMELTNHLPLS
                    *:..  .*: . : *.   :::   :. * :**    *:.*********:*:*  :.  

ACR004W            KWYFHQLQYWGLDYPPLTAYHSYLLGKLGSYISPEWFSLHASRGYESE--DLKSYMRLTV
Ecym_3027          RWYFYDLEYWGLDYPPLTAYHSYILGRLGSFVNATWFKLNTSRGFESI--DLKSFMRITV
KNAG0F02890        QWYWFDLQYWGLDYPPFTAYHSYLLGKIGTFIYPPWFELDASRGMETD--GIKSYMRFTV
Skud_15.163        KWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFNPSWFALDKSRGFESPDNGLKTYMRSTV
Suva_15.177        KWYWYDLQYWGLDYPPLTAFHSYLLGLIGTFFNPSWFALDKSRGFESPDNGLKTYMRSTV
YOR002W            KWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWFALEKSRGFESPDNGLKTYMRSTV
Smik_15.171        KWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWFALDKSRGFESPDNGLKTYMRSTV
CAGL0E02629g       KWYYYDLKYWGLDYPPLTAFHSYLLGKLGTFCNPDWFALDSSRGIETQ--GLKNYMRFTV
TDEL0G04470        QWYWFDLEYWGLDYPPLTAYHSYVLGKIGSFIKPEWFELNESRGIETP--DLKTFMRFTV
ZYRO0C07744g       QWYYFDLEYWGLDYPPLTAYHSYILGKLGSLINPDWFALNVSRGLESN--DLKTYMRFTV
TBLA0G00970        KWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSSRGYESDDNGLKTYMRFTV
NDAI0C02630        QWYWFDLQYWGLDYPPLTAFHSYLCGKIGSFFQPNWFTLGDSRGYEGQ--DLKTFMRLTV
NCAS0D02160        KWYWFDLKYWGLDYPPLTAYHSYICGKIGSFFNPNWFALDSSRGYEAQ--DLKTFMRLTV
KAFR0A05070        KWYWFDLQYWGLDYPPLTAYHSYILGKIGSFIYPKWFTLNDSRGIEME--GIKSYMRTTV
TPHA0J00350        QWYFYDLQYWGLDYPPLTAYHSYICGLIGKFFNPAWFELETSRGMEMK--ELKTFMRLTA
Kpol_1037.27       KWYFFDLEYWGLDYPPLTAYHSYVLGVIGSFLNKSWFALNDSRGYESENNDLKTYMRTTV
KLLA0D01221g       EWYWYDLQYWGLDYPPLTAYHSYLLGKLGSFFREGWFDLESSRGYESL--NLKSYMRFTV
SAKL0E01364g       QWYWYDLPYWGLDYPPLTAYHSYILGKLGDIFDPTWFQLGVSRGQESM--DLKSYMRFTV
KLTH0C11176g       QWYWFDLQYWGLDYPPLTAYHSYALGKLGSVLNPEWFALGSSRGNETP--ELKAYMRFTV
Kwal_56.22437      QWYWYDLQYWGLDYPPLTAYHSYVLGKLGSLLNSEWFALLSSRGIENP--DIKAYMRFTV
                    **:.:* ********:**:**   * :*      ** *  *** *     :* :** *.

ACR004W            ILSELCFYIPAVLYFTRWIGRRRQQSPIGQYIAGAAILFQPALILIDHGHFQYNCVMLGL
Ecym_3027          LLSELVCYIPAVMYFTRWIGRHRNQSPIGQYVACAAILFQPSLILIDHGHFQYNCVMLGL
KNAG0F02890        LLSECIFYIPAIVYFTKWVGRRKKQSPIGQFVAAAAILFQPTLMLIDHGHFQYNCVMLGL
Skud_15.163        IISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAILFQPSLMLIDHGHFQYNSVMLGL
Suva_15.177        IISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAILFQPSLMLIDHGHFQYNSVMLGL
YOR002W            IISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASAILFQPSLMLIDHGHFQYNSVMLGL
Smik_15.171        IISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASAILFQPSLMLIDHGHFQYNSVMLGL
CAGL0E02629g       LLSEAIFYMPAVVYFTKWLGRRRNQSPIGQFIAAAAILFQPSLMLIDHGHFQYNSIMLGF
TDEL0G04470        LLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFISAAAILFQPSLMLIDHGHFQYNCVMLGL
ZYRO0C07744g       ILSEVIFYIPAVVYFTKWVGRHRGLSPVGQFIAAAAILFQPALMLIDHGHFQYNCVMLGF
TBLA0G00970        ILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAILFQPSLMLIDHGHFQYNSVMLGL
NDAI0C02630        LASESLCYIPAVVYFTKWLGKRRNQSPIGQFIAVAAILFQPSLILIDHGHFQFNSVMLGL
NCAS0D02160        LVSEALFYIPGVVYFVKWLGKHRRQSPIGQFIAAAAILLQPSLILIDHGHFQYNSVALGL
KAFR0A05070        LISEAVFYFPAIIYFSKWFGKHRNQSPIGQYIAATAILFQPSLMLIDHGHFQYNSVMLGL
TPHA0J00350        IVSEVIFYIPAIIYFTTWVGKQRKQSPMGQYIAAAAILFQPCLMLIDHGHFQYNSVMLGL
Kpol_1037.27       IISEIIFYIPGVIYFTKWVGRHRQQSLIGQYIAAAAILFQPSLMLIDHGHFQYNSVMLGL
KLLA0D01221g       IISELLLYIPAVIYFTKWVGKYRSQSPIGQYIAAAAILFQPALILVDHGHFQYNCVMLGM
SAKL0E01364g       LLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAAAAILFQPSLILIDHGHFQYNSVMLGL
KLTH0C11176g       ILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSLILIDHGHFQYNSVMLGL
Kwal_56.22437      ILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSLILIDHGHFQYNSVMLGL
                   : *:   *:*.::**  *.*  .  : :** :: :***:** *:*:******:*.: **:

ACR004W            TVCAINNLLDQYYALAAVNFVFSLGFKQMALYYAPVMFVYLLSRSIYYPRL-NIPRFVAV
Ecym_3027          VVYTINNLLDEFYGFAAICFVLSLGFKQMALYYSPVIFAYLFSRSAYYPRF-NFPRFAGI
KNAG0F02890        TVYAINNLLDGFYAMAAVCFVLSICFKQMALYYAPIFFAVLLSKSLFFPRLFNIPRFLSV
Skud_15.163        TAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFAYLLSRSLLFPKF-NIARLTVI
Suva_15.177        TAYAINNLLDEYYAMAAMCFVLSICFKQMALYYAPIFFAYLLSRSLFFPKF-NIARLTVI
YOR002W            TAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFAYLLSRSLLFPKF-NIARLTVI
Smik_15.171        TAYAINNLLDEYYAMAAMCFVLSICFKQMALYYAPIFFAYLLSRSLLFPKF-NIARLTVI
CAGL0E02629g       TVYAINNLLDEFYAPAAICFVLSICFKQMSLYYAPIFFAYLLGRSMFFPKLFNIPRFISI
TDEL0G04470        TVYAINSLFEEFYAVAAICFVLSICFKQMALYYAPIFFAYLLSKSLFSPRF-NFPRLFAI
ZYRO0C07744g       TVYAINSLMDEFYAPAAACFVLSICFKQMALYYSPIFFAYLLGRCVFKTGI-RFPRFLSI
TBLA0G00970        TVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFFGYLLSKSLVHPSC-NISRFIIV
NDAI0C02630        TVYTLNNLLDEFYAFAAVCFVLSICFKQMALYYSPIFFAYLLSKSLFHPRLFNIPRFAAI
NCAS0D02160        TVYAINNLLDEFYAMAAVCFVLSICFKQMTLYYSPIFFAYLLSKSLFTPKLFNIPRFLAI
KAFR0A05070        TVYAINNLLDDFYSVASVCFVLSICFKQMSLYYAPIFFGYLLSKSLFFPRLFNIPRLVGI
TPHA0J00350        TVYAINNLLDDMYAPAAISFVMSICFKQMSLYYAPIFFAYLLGRSLFKKQFFNVSRFLNI
Kpol_1037.27       TVYAINNLLDEFYAPAAMCFVLSICFKQMALYYAPIFFGYLLGRSLFSRKFFNISRFLSI
KLLA0D01221g       TVYTLNNLLDGFYAMGAICFVLSLCFKQMALYYSPIFFAYLLSKSTYSPGI-NLPRLFAI
SAKL0E01364g       TVYAINNLLDEYYAPAAICFVLSVCFKQMALYYAPIFFSYLLSKSLFSPLF-NLPRLLAV
KLTH0C11176g       TVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYLLSRSLFSPSF-KFSRFMSV
Kwal_56.22437      TVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSPVFFAYLLSECLISPSL-NVPRFLSV
                   .. ::*.*::  :. .:  *::*: ****:*:*:*::*  *:. .       ...*:  :

ACR004W            AVATLIAFGVLYAPLYLLG-------------NISAIFQSIHRVFPFERGLFEDKVANFW
Ecym_3027          AIATLLTFGALYAPLCLFG-------------DFRNIIQSVYRVFPFSRGIFEDKVANFW
KNAG0F02890        AFATLASLFVMFAPLYIFG-------------GVGNVLQSIHRIFPFARGIFEDKVANFW
Skud_15.163        AFATLATFSVILAPLYFLGG------------GLRNIHQCIYRIFPFSRGIFEDKVANFW
Suva_15.177        AFATLATFSLMFAPLYFLGG------------GLRNIYQCIHRMFPFARGIFEDKVANFW
YOR002W            AFATLATFAIIFAPLYFLGG------------GLKNIHQCIHRIFPFARGIFEDKVANFW
Smik_15.171        SFATLATFALMLAPLYFLGG------------GLKNIYQCIHRIFPFARGIFEDKVANFW
CAGL0E02629g       SIATLVTFTAMFSPFYIFG-------------GLDGLAQTVRRIFPFARGIFEDKVANFW
TDEL0G04470        AVATVLSFAAMYAPLYIFGG------------GLANVIQSVHRIFPFARGIFEDKVANFW
ZYRO0C07744g       AMATIATFLVMYIPLYIMGS------------GSQNVLQSVHRIFPFARGIFEDKVANFW
TBLA0G00970        AISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLIQCIRRIFPFARGIFEDKVANFW
NDAI0C02630        SFATICTFASMFGPIYFFGG---------ENGGITNLLQSIKRIFPFARGIFEDKVANFW
NCAS0D02160        AIATVCSFLLMYGPLYVFGG---------DQ-GLNNVLQSIHRIFPFARGIFEDKVANFW
KAFR0A05070        AAVTIVTFVAMYSPLYIFGG------------GLENLIQSVHRIFPFARGIFEDKVANFW
TPHA0J00350        AIATMVSFFTVFAPLYVFGG------------GKRNIIQSVHRIFPFARGIFEDKVANFW
Kpol_1037.27       AISTVFAFFSMYAPLYVFGG------------GLRNVIQSVHRIFPFARGLFEDKVANFW
KLLA0D01221g       SVSTALAFIGSFGPIYIFG-------------GYKNLVQSMHRIFPFARGIFEDKVANFW
SAKL0E01364g       AAATLISFAAMFFPLYMWG-------------GIRNVLQSIHRIFPFSRGIFEDKVANFW
KLTH0C11176g       ALSTVITFCLMFSPLYVFG-------------GMKNVLQSIHRIFPFSRGIFEDKVANFW
Kwal_56.22437      AFSTVISFCIIFSPLYVFG-------------GTKNVLQSIHRIFPFSRGIFEDKVANFW
                   :  *  ::     *: . *             .   : * : *:*** **:*********

ACR004W            CVTNVLVKYKTKYTTSQLKFFSLVLTSAAMLPSLIITFLYPKKFMLPYALAACSMSFFLF
Ecym_3027          CVTNVIIKYRELYTQKQLQFYCLLTTAIAQFPAFIIIFLYPKKFLLPYALAACSMAFFLF
KNAG0F02890        CVTNVFFKYKTMFTQSELQFYSLVATVVGFFPAFMIMIFYPKKFLIPYGLAACSMAFFLF
Skud_15.163        CVTNIFVKYKDRFTIQQLQLYSLVATVIGFLPAMIMTLLHPKKHLLPYVLIACSMSFFLF
Suva_15.177        CVSNIFVKYKERFSIQQLQLYSLVATVLGFLPAMMMTLLHPKKHLLPYVLIACSMSFFLF
YOR002W            CVTNVFVKYKERFTIQQLQLYSLIATVIGFLPAMIMTLLHPKKHLLPYVLIACSMSFFLF
Smik_15.171        CVTNVFVKYKERFSVQQLQLYSLVATVIGFLPAMVMTLLHPKKHLLPYVLIACSMSFFLF
CAGL0E02629g       CVVNTIVKFKVLFTNDQLRMYSLILTVVGFAPAMILIILYPRKHLLPYALAACSMSFYLF
TDEL0G04470        CVTNVFFKYKNIFPQEQLQLYSLIATMLGFLPAVIVIFLYPKKHIICYALATCSMSFYLF
ZYRO0C07744g       CVTNIFVKYKQLFTQQQLQLYSLLATALGFLPAVVLVLLYPKKHLVPFALAACSMSFFLF
TBLA0G00970        CVTNVVIKYRELFTQEQLQFYSLVATLIGFLPSMITIFLYPRKFLIPYALAACSMSFFLF
NDAI0C02630        CVTNVIFKYKANFTQEQLQLYSLILTIIAFLPAMLVILLYPRKYLLLYALSACSMSFYLF
NCAS0D02160        CVTNVIFKYKMLFTQQELQLYSLVLTVVGFLPAMMIILFYPKKYLLPYALSACSMAFYLF
KAFR0A05070        CVTNILIKYKIKFTQDQLQLYSLAATVLGFLPALVIIVLYPKKHLLPYALAACSMSFFLF
TPHA0J00350        CVTNVIMKYKVNYTQDELQLYSLILTVVGFLPAMVTILWFPKKHLLPYSLAACAMSFFLF
Kpol_1037.27       CVTNIFIKYKILYTQKELQLYSLIATVVGFLPAVVTILFYPKKHLLPYALAACSMSFYLF
KLLA0D01221g       CVSNIFIKYRNLFTQKDLQLYSLLATVIGLLPSFIITFLYPKRHLLPYALAACSMSFFLF
SAKL0E01364g       CFSNIFIKYKVLYTQSQLQMYSLCATALGFLPAFILIFFYPKKHLIPYALTACSMSFFLF
KLTH0C11176g       CVSNVIVKYADNFTQDQLQKLSTFATAAGFLPSFALVVLYPKKHMIPYGLAACSMAFFLF
Kwal_56.22437      CVSNVLFKYAQNYTQQELQRFSIIATAAGFLPSFLVVLCYPKKHMIPFALAACSMAFFLF
                   *. * ..*:   :. .:*.  .   *  .  *:.   . .*...:: : * :*:*:*:**

ACR004W            GFQVHEKTILVPLLPITLLYTSTDWNVLSMVAWINNIALFTLWPLLKKDGLSLQYAIMFL
Ecym_3027          SFQVHEKTILVPLLPITLLHISTNWDVLSMVAWINNVALFTLWPLLKKDGLLLQYAIMFL
KNAG0F02890        SFQVHEKTILVPLLPATLLFTSTNWNNLSMVFWVNNVALFTLWPLLKKDGLWLQYCVCLV
Skud_15.163        SFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKKDGLHLQYTVSFL
Suva_15.177        SFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKKDGLHLQYVVSFL
YOR002W            SFQVHEKTILIPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKKDGLHLQYAVSFL
Smik_15.171        SFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKRDGLHLQYAVSFL
CAGL0E02629g       SFQVHEKTILVPLLPITLLFTSRDWNVLSMVSWINNVALFTLWPLLKREGLYLQYFVCFF
TDEL0G04470        SFQVHEKTILVPLLPITLLYTSSNWDVLSMANWINNVGLFTLYPLLKKDGLTLQYFVCFT
ZYRO0C07744g       SFQVHEKTILVPLLPITLLYTSTNWDVLSLVSWINNVGLFTLWPLLKKDGLALQYCVCFA
TBLA0G00970        SFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPLLRKDGLVLQYFVCYF
NDAI0C02630        SFQVHEKTILMPLLPITLLYTSTDRNVLSRVSWMNNIGLFTLWPLLKKDGLSLQYWVCLI
NCAS0D02160        SFQVHEKTILMPLLPITLLYTSTDRNVLSRVSWMNNIGLFTLWPLLKKDGLTLQYWVCLL
KAFR0A05070        SFQVHEKTILVPLLPITLLYTSTDWNVLSMVCWINNVALFTLWPLLKKDGLILQYAVCFA
TPHA0J00350        SFQVHEKTILVPLLPITLLYTSTDWNVLSLVSWINNVALFTLWPLLKKDGVVLQYGVCFI
Kpol_1037.27       SFQVHEKTILVPLLPITLLYTSTDWNVLSFVSWVNNVGLFTLWPLLKKDGLTLQYGVCFF
KLLA0D01221g       SFQVHEKTILLPLLPITLLYTSRDWNVLSLVCWINNVALFTLWPLLKKDNLVLQYGVMFM
SAKL0E01364g       SFQVHEKTILVPLLPITLLYTSTDWNVLSMVSWINNMAFFTLWPLLKKDGLVLQYATLLL
KLTH0C11176g       GFQVHEKSILVPLLPISLLFCSTDWNVLAIVSWINNVALFTLWPLLKKDKLALQYGIMML
Kwal_56.22437      SFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLLKKDHLTLQYGILML
                   .******:**:**:* :**. * :.: *: . *:**:.:***:***..: : ***     

ACR004W            LSNWLIGNFSFITPTFLPKVLTPGPSVSDVADGYRRRSLLPSNIIWRIIIVVSYICVGAI
Ecym_3027          LSNWLLGNFSFVTPTFLPKFLTPGPSVSDVADDYRRRSLLPKNIFWRIIIVSSYVCMAFI
KNAG0F02890        MYNWLLGNFSFITPRFLPKILTPGPSISNIAENYRRRSLLPHNIIWKIIILVSYLCMLMI
Skud_15.163        LSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYIAMGVY
Suva_15.177        LTNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYIAMGLY
YOR002W            LSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYIAMGFY
Smik_15.171        LSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYIAMGLY
CAGL0E02629g       LSNWLIGNFSFITPRFLPKFITPGPSISSVSDNYRRRSLLPHSIFWKLIIVSSYIGMTAY
TDEL0G04470        LSNWLLGNFSFVTPKFLPKFLTPGPSVSSVDINYRRRSFLPSNVIWKIIIVSSYTAMGVL
ZYRO0C07744g       FCNWLIGNFSFVTPTFLPKFLTPGPSVSSVDSNYRRRSLLPKSIIWKLIIVGSYISMGAI
TBLA0G00970        LSNWLIGNFSFITPKFLPSFLTPGPSISNIDDDYRRGSLLPHNILWKIIIISSYIVMGAV
NDAI0C02630        LSNWLIGNFSFITPRFLPKVLTPGPSIIQLGENYRRPTLLPSNWIWKVIIVLSYVMMGVI
NCAS0D02160        LSNWLIGNFSFITPNFLPKVLTPGPSVSMIGENYHYRSLLPRNIFWKVIIVLSYIAMGAI
KAFR0A05070        LSNWLLGNFSFVTPKFLPKMLTPGPSISAIHENYHRRSLLPHNILWKVVIVSSYLSMAVF
TPHA0J00350        LSNWLIGNFSFFTPRFLPKILTPGPPIQNVNTHYRRRSLLPNNIIWKIIIVLSYIVMVAI
Kpol_1037.27       LSNWLIGNFSFITPKFLPKMLTPGPPVQNTEDTYHRRSLLPHNILWKIIIVSSYIVMLLI
KLLA0D01221g       FSNWLIGNFSFVTPRFLPKFLTPGPSISDIDVDYRRASLLPKSLIWRLIIVGSYIAMGII
SAKL0E01364g       LSNWLIGNFSFVTPRFLPKFLTPGPSTSDVSENYRRRSLLPDNIFWKLIIVASYISMGIL
KLTH0C11176g       LSNWLIGNFSFVTPRFLPGFITPGPSMSNVAETYRRRSFLPNNIVWKILIITSYIVMAVI
Kwal_56.22437      LSNWLIGNFSFVTPRFLPKFITPGPSISVVSETYRRRSFLPDNNFWKLIIVASYLIMAAI
                   : ***:*****.** ***  :****.       *.  ::** . .*. .*: :*  :   

ACR004W            HIAELWYPPSQRLPDIWVLANCLVGCSSFALFWMWNNYKMFAMRNSTISDL
Ecym_3027          HLLDLYVQPPRNYPDIWVLATCALGFACFTAFWLWNYYQLYRMRNSSLNEL
KNAG0F02890        HVLEYTIAAPSQYPDLWVQLNCTVGFGCFVLFWMWTYYKLITLRNKTIQEL
Skud_15.163        HLLDLFVVPPSKYPDLWVLLNCAVGFTCFSIFWIWSYYKIFTSGNKSVKDL
Suva_15.177        HFLDLFVAPPKKYPDLWVLLNCAVGFICFSIFWIWSYYKIFTSGNKSMKDL
YOR002W            HFLDQFVAPPSKYPDLWVLLNCAVGFICFSIFWLWSYYKIFTSGSKSMKDL
Smik_15.171        HFLDLFVAPPSKYPDLWVLLNCTVGFTCFSIFWVWSYYKIFTSGSKSMKDL
CAGL0E02629g       HFLDLFIEAPPRFPDLWVILNCTIGFVSFSLFWLWTYYKFCTLLKKNIQDL
TDEL0G04470        HVVDFVMGPPVSYPDLWVLLNCALGFGCFTLFWLWSYYMLFTMPRKTLQQL
ZYRO0C07744g       HVLDMFVAPPLNYPDLWVILNCTLGFGCFMLFWLWNYYKLFSLAGQSLQQL
TBLA0G00970        QILDLFFQPPTNYPDLWIILNCTVGFGCFMLFWLWNNYKIIQMRNKTLNDL
NDAI0C02630        HFVDYFIEPPSAYPDLWVILNCTLGFGCFVLFWLWNYYKLFSMTKKNIHQL
NCAS0D02160        HVLDAFVNPPVAYPDLWVILNCTLGFGCFFLFWIWNYYKLFSMIKKSLHHL
KAFR0A05070        HYLDFFVEPPTNYPDIWITLNCVIGFGSFVFFWMWTYYMLFTLRNKTLMDL
TPHA0J00350        QGLELFVEPPPQYPDIFVLLNCTLGFCCFTSFWLWNYYKLFTLTSKNLQYL
Kpol_1037.27       HLGEIFVSPPPEYPDIWVLMNCCLGFGCFVLFWLWNYYKIFTLANKTLQYL
KLLA0D01221g       HFLDYYVSPPSKYPDLWVLANCSLGFSCFVTFWIWNNYKLFEMRNSTLQDL
SAKL0E01364g       HLLDFYVQPPAKYPDLWVLLNCSLGFFSFFLFWVWNYYKMFTLRNKTLYDF
KLTH0C11176g       HILDLFVQPPAKLPDLWVLMNCALGFTCFSVFWLWNNYKLFTMRNKSILDL
Kwal_56.22437      HILDFFVPTPEGLPDLWVLLNCALGFFCFTIFWLWMHYKLFTMRNTNLQDF
                   :  :    ..   **:::  .* :*  .*  **:*  * :      .:  :

FASTA FORMAT for MUSCLE Version 3.6

>ACR004W
-----MNQGRLRDKPRMEG------APPSKEPGQKGIATD-AKKPGLKEAFFASPLYDFL
YPLRPVTNQWAAKYIIVIFALIIRLAVGLGGYSGMGKPPMFGDFEAQRHWMEVTQHIPVS
KWYFHQLQYWGLDYPPLTAYHSYLLGKLGSYISPEWFSLHASRGYESE--DLKSYMRLTV
ILSELCFYIPAVLYFTRWIGRRRQQSPIGQYIAGAAILFQPALILIDHGHFQYNCVMLGL
TVCAINNLLDQYYALAAVNFVFSLGFKQMALYYAPVMFVYLLSRSIYYPRL-NIPRFVAV
AVATLIAFGVLYAPLYLLG-------------NISAIFQSIHRVFPFERGLFEDKVANFW
CVTNVLVKYKTKYTTSQLKFFSLVLTSAAMLPSLIITFLYPKKFMLPYALAACSMSFFLF
GFQVHEKTILVPLLPITLLYTSTDWNVLSMVAWINNIALFTLWPLLKKDGLSLQYAIMFL
LSNWLIGNFSFITPTFLPKVLTPGPSVSDVADGYRRRSLLPSNIIWRIIIVVSYICVGAI
HIAELWYPPSQRLPDIWVLANCLVGCSSFALFWMWNNYKMFAMRNSTISDL
>Ecym_3027
----------------MSG------SSGAVASEKGQDTRR----SCVEESFFASPLYDFL
YPLRPVANQWSAKYIILIFALIVRLAVGLGGYSGKGKGPLFGDFEAQRHWMEITTCLPIS
RWYFYDLEYWGLDYPPLTAYHSYILGRLGSFVNATWFKLNTSRGFESI--DLKSFMRITV
LLSELVCYIPAVMYFTRWIGRHRNQSPIGQYVACAAILFQPSLILIDHGHFQYNCVMLGL
VVYTINNLLDEFYGFAAICFVLSLGFKQMALYYSPVIFAYLFSRSAYYPRF-NFPRFAGI
AIATLLTFGALYAPLCLFG-------------DFRNIIQSVYRVFPFSRGIFEDKVANFW
CVTNVIIKYRELYTQKQLQFYCLLTTAIAQFPAFIIIFLYPKKFLLPYALAACSMAFFLF
SFQVHEKTILVPLLPITLLHISTNWDVLSMVAWINNVALFTLWPLLKKDGLLLQYAIMFL
LSNWLLGNFSFVTPTFLPKFLTPGPSVSDVADDYRRRSLLPKNIFWRIIIVSSYVCMAFI
HLLDLYVQPPRNYPDIWVLATCALGFACFTAFWLWNYYQLYRMRNSSLNEL
>KNAG0F02890
-------MSSEKKEPQGED------ASSKTKSLSKLQRNKDEAAPEVEECFYASPIYDFL
YPFRSPGSQWVTEYIIVVFLLIIKSAIGLGSYSGFQTPPMFGDFEAQRHWMEITQHLPVS
QWYWFDLQYWGLDYPPFTAYHSYLLGKIGTFIYPPWFELDASRGMETD--GIKSYMRFTV
LLSECIFYIPAIVYFTKWVGRRKKQSPIGQFVAAAAILFQPTLMLIDHGHFQYNCVMLGL
TVYAINNLLDGFYAMAAVCFVLSICFKQMALYYAPIFFAVLLSKSLFFPRLFNIPRFLSV
AFATLASLFVMFAPLYIFG-------------GVGNVLQSIHRIFPFARGIFEDKVANFW
CVTNVFFKYKTMFTQSELQFYSLVATVVGFFPAFMIMIFYPKKFLIPYGLAACSMAFFLF
SFQVHEKTILVPLLPATLLFTSTNWNNLSMVFWVNNVALFTLWPLLKKDGLWLQYCVCLV
MYNWLLGNFSFITPRFLPKILTPGPSISNIAENYRRRSLLPHNIIWKIIILVSYLCMLMI
HVLEYTIAAPSQYPDLWVQLNCTVGFGCFVLFWMWTYYKLITLRNKTIQEL
>Skud_15.163
-----------------------------MAIGKRLLVNK-----PAEESFYASPMYDFL
YPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSGKDSPPLHGDFEAQRHWMEITQHLPLS
KWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFNPSWFALDKSRGFESPDNGLKTYMRSTV
IISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAILFQPSLMLIDHGHFQYNSVMLGL
TAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFAYLLSRSLLFPKF-NIARLTVI
AFATLATFSVILAPLYFLGG------------GLRNIHQCIYRIFPFSRGIFEDKVANFW
CVTNIFVKYKDRFTIQQLQLYSLVATVIGFLPAMIMTLLHPKKHLLPYVLIACSMSFFLF
SFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKKDGLHLQYTVSFL
LSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYIAMGVY
HLLDLFVVPPSKYPDLWVLLNCAVGFTCFSIFWIWSYYKIFTSGNKSVKDL
>Suva_15.177
-----------------------------MAIGKRLLVNK-----PAEESFYASPMYDFL
YPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSGKATPPLHGDFEAQRHWMEITQHLPLS
KWYWYDLQYWGLDYPPLTAFHSYLLGLIGTFFNPSWFALDKSRGFESPDNGLKTYMRSTV
IISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAILFQPSLMLIDHGHFQYNSVMLGL
TAYAINNLLDEYYAMAAMCFVLSICFKQMALYYAPIFFAYLLSRSLFFPKF-NIARLTVI
AFATLATFSLMFAPLYFLGG------------GLRNIYQCIHRMFPFARGIFEDKVANFW
CVSNIFVKYKERFSIQQLQLYSLVATVLGFLPAMMMTLLHPKKHLLPYVLIACSMSFFLF
SFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKKDGLHLQYVVSFL
LTNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYIAMGLY
HFLDLFVAPPKKYPDLWVLLNCAVGFICFSIFWIWSYYKIFTSGNKSMKDL
>YOR002W
-----------------------------MAIGKRLLVNK-----PAEESFYASPMYDFL
YPFRPVGNQWLPEYIIFVCAVILRCTIGLGPYSGKGSPPLYGDFEAQRHWMEITQHLPLS
KWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWFALEKSRGFESPDNGLKTYMRSTV
IISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASAILFQPSLMLIDHGHFQYNSVMLGL
TAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFAYLLSRSLLFPKF-NIARLTVI
AFATLATFAIIFAPLYFLGG------------GLKNIHQCIHRIFPFARGIFEDKVANFW
CVTNVFVKYKERFTIQQLQLYSLIATVIGFLPAMIMTLLHPKKHLLPYVLIACSMSFFLF
SFQVHEKTILIPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKKDGLHLQYAVSFL
LSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYIAMGFY
HFLDQFVAPPSKYPDLWVLLNCAVGFICFSIFWLWSYYKIFTSGSKSMKDL
>Smik_15.171
-----------------------------MAIGKRLLVNK-----PAEESFYASPMYDFL
YPFRPVGNQWLPEYIIFVCAVIVRCTIGLGPYSGKGSPPLHGDFEAQRHWMEITQHLPLS
KWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWFALDKSRGFESPDNGLKTYMRSTV
IISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASAILFQPSLMLIDHGHFQYNSVMLGL
TAYAINNLLDEYYAMAAMCFVLSICFKQMALYYAPIFFAYLLSRSLLFPKF-NIARLTVI
SFATLATFALMLAPLYFLGG------------GLKNIYQCIHRIFPFARGIFEDKVANFW
CVTNVFVKYKERFSVQQLQLYSLVATVIGFLPAMVMTLLHPKKHLLPYVLIACSMSFFLF
SFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKRDGLHLQYAVSFL
LSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYIAMGLY
HFLDLFVAPPSKYPDLWVLLNCTVGFTCFSIFWVWSYYKIFTSGSKSMKDL
>CAGL0E02629g
--------------------------MSSEKKDKKAVSKF--ESEQGEESFYASPLYDFL
FPFRPAGSQWLTEWIIIMFAMIIRCAIGLGPYSGYKDGPMHGDFEAQRHWMEITQHLPIS
KWYYYDLKYWGLDYPPLTAFHSYLLGKLGTFCNPDWFALDSSRGIETQ--GLKNYMRFTV
LLSEAIFYMPAVVYFTKWLGRRRNQSPIGQFIAAAAILFQPSLMLIDHGHFQYNSIMLGF
TVYAINNLLDEFYAPAAICFVLSICFKQMSLYYAPIFFAYLLGRSMFFPKLFNIPRFISI
SIATLVTFTAMFSPFYIFG-------------GLDGLAQTVRRIFPFARGIFEDKVANFW
CVVNTIVKFKVLFTNDQLRMYSLILTVVGFAPAMILIILYPRKHLLPYALAACSMSFYLF
SFQVHEKTILVPLLPITLLFTSRDWNVLSMVSWINNVALFTLWPLLKREGLYLQYFVCFF
LSNWLIGNFSFITPRFLPKFITPGPSISSVSDNYRRRSLLPHSIFWKLIIVSSYIGMTAY
HFLDLFIEAPPRFPDLWVILNCTIGFVSFSLFWLWTYYKFCTLLKKNIQDL
>TDEL0G04470
-----------------------------MAPKNKEAKRN-----TVEESFYASPLYDFL
YPFRPAGSQWLTEYVIVLFALIIGCAVGHGSYSGQFSPPMFGDFEAQRHWMEITQHLAPS
QWYWFDLEYWGLDYPPLTAYHSYVLGKIGSFIKPEWFELNESRGIETP--DLKTFMRFTV
LLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFISAAAILFQPSLMLIDHGHFQYNCVMLGL
TVYAINSLFEEFYAVAAICFVLSICFKQMALYYAPIFFAYLLSKSLFSPRF-NFPRLFAI
AVATVLSFAAMYAPLYIFGG------------GLANVIQSVHRIFPFARGIFEDKVANFW
CVTNVFFKYKNIFPQEQLQLYSLIATMLGFLPAVIVIFLYPKKHIICYALATCSMSFYLF
SFQVHEKTILVPLLPITLLYTSSNWDVLSMANWINNVGLFTLYPLLKKDGLTLQYFVCFT
LSNWLLGNFSFVTPKFLPKFLTPGPSVSSVDINYRRRSFLPSNVIWKIIIVSSYTAMGVL
HVVDFVMGPPVSYPDLWVLLNCALGFGCFTLFWLWSYYMLFTMPRKTLQQL
>ZYRO0C07744g
---------------------------MPSKTSKKVEKAQ--ADNTAEESFYASPLYDFL
YPFKPVGSQWLPEYIIILFAVIIRCAIGLGPYSGQSVKPMHGDFEAQRHWLEITQHLPIS
QWYYFDLEYWGLDYPPLTAYHSYILGKLGSLINPDWFALNVSRGLESN--DLKTYMRFTV
ILSEVIFYIPAVVYFTKWVGRHRGLSPVGQFIAAAAILFQPALMLIDHGHFQYNCVMLGF
TVYAINSLMDEFYAPAAACFVLSICFKQMALYYSPIFFAYLLGRCVFKTGI-RFPRFLSI
AMATIATFLVMYIPLYIMGS------------GSQNVLQSVHRIFPFARGIFEDKVANFW
CVTNIFVKYKQLFTQQQLQLYSLLATALGFLPAVVLVLLYPKKHLVPFALAACSMSFFLF
SFQVHEKTILVPLLPITLLYTSTNWDVLSLVSWINNVGLFTLWPLLKKDGLALQYCVCFA
FCNWLIGNFSFVTPTFLPKFLTPGPSVSSVDSNYRRRSLLPKSIIWKLIIVGSYISMGAI
HVLDMFVAPPLNYPDLWVILNCTLGFGCFMLFWLWNYYKLFSLAGQSLQQL
>TBLA0G00970
-----------------------------MSSKKKLLKKQ--QKPGEEEAFYASPLFDFL
YPFRPVGSQWLTEYVIIIFAIIIRCAISLGSYSGKGTPPMFGDFEAQRHWMEITQHLPIS
KWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSSRGYESDDNGLKTYMRFTV
ILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAILFQPSLMLIDHGHFQYNSVMLGL
TVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFFGYLLSKSLVHPSC-NISRFIIV
AISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLIQCIRRIFPFARGIFEDKVANFW
CVTNVVIKYRELFTQEQLQFYSLVATLIGFLPSMITIFLYPRKFLIPYALAACSMSFFLF
SFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPLLRKDGLVLQYFVCYF
LSNWLIGNFSFITPKFLPSFLTPGPSISNIDDDYRRGSLLPHNILWKIIIISSYIVMGAV
QILDLFFQPPTNYPDLWIILNCTVGFGCFMLFWLWNNYKIIQMRNKTLNDL
>NDAI0C02630
MVPKKKTLMKNGSTSTVTSSSSQKSKVEDTKKSKKMNNNQPLETETSKESFYASPLYDFL
YPFRPAGSQWMTEYIIVLFAIIIRCAVGLGPYSGFNTPPMFGDFEAQRHWMEITQYLPIS
QWYWFDLQYWGLDYPPLTAFHSYLCGKIGSFFQPNWFTLGDSRGYEGQ--DLKTFMRLTV
LASESLCYIPAVVYFTKWLGKRRNQSPIGQFIAVAAILFQPSLILIDHGHFQFNSVMLGL
TVYTLNNLLDEFYAFAAVCFVLSICFKQMALYYSPIFFAYLLSKSLFHPRLFNIPRFAAI
SFATICTFASMFGPIYFFGG---------ENGGITNLLQSIKRIFPFARGIFEDKVANFW
CVTNVIFKYKANFTQEQLQLYSLILTIIAFLPAMLVILLYPRKYLLLYALSACSMSFYLF
SFQVHEKTILMPLLPITLLYTSTDRNVLSRVSWMNNIGLFTLWPLLKKDGLSLQYWVCLI
LSNWLIGNFSFITPRFLPKVLTPGPSIIQLGENYRRPTLLPSNWIWKVIIVLSYVMMGVI
HFVDYFIEPPSAYPDLWVILNCTLGFGCFVLFWLWNYYKLFSMTKKNIHQL
>NCAS0D02160
--------MAGKNKIPKKD------LSSQKKSGKTKETSK--KHDIPEESFYASPLYDLL
YPFRPAGSQWMTEYTIVLFSLIIRCAVGLGPFSGYGVPPMFGDFEAQRHWMEITQHLPIH
KWYWFDLKYWGLDYPPLTAYHSYICGKIGSFFNPNWFALDSSRGYEAQ--DLKTFMRLTV
LVSEALFYIPGVVYFVKWLGKHRRQSPIGQFIAAAAILLQPSLILIDHGHFQYNSVALGL
TVYAINNLLDEFYAMAAVCFVLSICFKQMTLYYSPIFFAYLLSKSLFTPKLFNIPRFLAI
AIATVCSFLLMYGPLYVFGG---------DQ-GLNNVLQSIHRIFPFARGIFEDKVANFW
CVTNVIFKYKMLFTQQELQLYSLVLTVVGFLPAMMIILFYPKKYLLPYALSACSMAFYLF
SFQVHEKTILMPLLPITLLYTSTDRNVLSRVSWMNNIGLFTLWPLLKKDGLTLQYWVCLL
LSNWLIGNFSFITPNFLPKVLTPGPSVSMIGENYHYRSLLPRNIFWKVIIVLSYIAMGAI
HVLDAFVNPPVAYPDLWVILNCTLGFGCFFLFWIWNYYKLFSMIKKSLHHL
>KAFR0A05070
-----MRSPEPKKKSPKTK------LKAKSKSNPKKASKL--NNEAIEEVFYASPLYDFL
YPFRPAGNQWLAQYIIVTFALIIRCAIGLGSYSGMGHSPMFGDFEAQRHWMEITQHLPIS
KWYWFDLQYWGLDYPPLTAYHSYILGKIGSFIYPKWFTLNDSRGIEME--GIKSYMRTTV
LISEAVFYFPAIIYFSKWFGKHRNQSPIGQYIAATAILFQPSLMLIDHGHFQYNSVMLGL
TVYAINNLLDDFYSVASVCFVLSICFKQMSLYYAPIFFGYLLSKSLFFPRLFNIPRLVGI
AAVTIVTFVAMYSPLYIFGG------------GLENLIQSVHRIFPFARGIFEDKVANFW
CVTNILIKYKIKFTQDQLQLYSLAATVLGFLPALVIIVLYPKKHLLPYALAACSMSFFLF
SFQVHEKTILVPLLPITLLYTSTDWNVLSMVCWINNVALFTLWPLLKKDGLILQYAVCFA
LSNWLLGNFSFVTPKFLPKMLTPGPSISAIHENYHRRSLLPHNILWKVVIVSSYLSMAVF
HYLDFFVEPPTNYPDIWITLNCVIGFGSFVFFWMWTYYMLFTLRNKTLMDL
>TPHA0J00350
----------MGKSGKHNS------KKFVKQTHKNDISSL--DETLDTEPFYASPLYTFL
SPFKSTTNQWLSVYIIVLFALIIRCAIGLGPYSGMNEAPMFGDFEAQRHWMEITQHLPIS
QWYFYDLQYWGLDYPPLTAYHSYICGLIGKFFNPAWFELETSRGMEMK--ELKTFMRLTA
IVSEVIFYIPAIIYFTTWVGKQRKQSPMGQYIAAAAILFQPCLMLIDHGHFQYNSVMLGL
TVYAINNLLDDMYAPAAISFVMSICFKQMSLYYAPIFFAYLLGRSLFKKQFFNVSRFLNI
AIATMVSFFTVFAPLYVFGG------------GKRNIIQSVHRIFPFARGIFEDKVANFW
CVTNVIMKYKVNYTQDELQLYSLILTVVGFLPAMVTILWFPKKHLLPYSLAACAMSFFLF
SFQVHEKTILVPLLPITLLYTSTDWNVLSLVSWINNVALFTLWPLLKKDGVVLQYGVCFI
LSNWLIGNFSFFTPRFLPKILTPGPPIQNVNTHYRRRSLLPNNIIWKIIIVLSYIVMVAI
QGLELFVEPPPQYPDIFVLLNCTLGFCCFTSFWLWNYYKLFTLTSKNLQYL
>Kpol_1037.27
------------------------------MASKKKISRI---NKPVEESFFASPLYDFL
SPFRPVSNQWLTEYIIVIFALIVRCAIGLGSYSGMGNPPMFGDFEAQRHWMEITQHLPIS
KWYFFDLEYWGLDYPPLTAYHSYVLGVIGSFLNKSWFALNDSRGYESENNDLKTYMRTTV
IISEIIFYIPGVIYFTKWVGRHRQQSLIGQYIAAAAILFQPSLMLIDHGHFQYNSVMLGL
TVYAINNLLDEFYAPAAMCFVLSICFKQMALYYAPIFFGYLLGRSLFSRKFFNISRFLSI
AISTVFAFFSMYAPLYVFGG------------GLRNVIQSVHRIFPFARGLFEDKVANFW
CVTNIFIKYKILYTQKELQLYSLIATVVGFLPAVVTILFYPKKHLLPYALAACSMSFYLF
SFQVHEKTILVPLLPITLLYTSTDWNVLSFVSWVNNVGLFTLWPLLKKDGLTLQYGVCFF
LSNWLIGNFSFITPKFLPKMLTPGPPVQNTEDTYHRRSLLPHNILWKIIIVSSYIVMLLI
HLGEIFVSPPPEYPDIWVLMNCCLGFGCFVLFWLWNYYKIFTLANKTLQYL
>KLLA0D01221g
-----MGLKKKQTPKNAVKKTVSSLPANAETTTSTAIMKK----VESVEAFFASPMYDFL
TPFRPVGNQWCAKYVIVIFALIIRCAVGLGGYSGMNTPPMFGDFEAQRHWMEITQHLPVR
EWYWYDLQYWGLDYPPLTAYHSYLLGKLGSFFREGWFDLESSRGYESL--NLKSYMRFTV
IISELLLYIPAVIYFTKWVGKYRSQSPIGQYIAAAAILFQPALILVDHGHFQYNCVMLGM
TVYTLNNLLDGFYAMGAICFVLSLCFKQMALYYSPIFFAYLLSKSTYSPGI-NLPRLFAI
SVSTALAFIGSFGPIYIFG-------------GYKNLVQSMHRIFPFARGIFEDKVANFW
CVSNIFIKYRNLFTQKDLQLYSLLATVIGLLPSFIITFLYPKRHLLPYALAACSMSFFLF
SFQVHEKTILLPLLPITLLYTSRDWNVLSLVCWINNVALFTLWPLLKKDNLVLQYGVMFM
FSNWLIGNFSFVTPRFLPKFLTPGPSISDIDVDYRRASLLPKSLIWRLIIVGSYIAMGII
HFLDYYVSPPSKYPDLWVLANCSLGFSCFVTFWIWNNYKLFEMRNSTLQDL
>SAKL0E01364g
-----------------------------MSSKRKPYSRK-----IVKESFFASPLFDFL
SPFRPVANQWCAKYIIVLFALIIRCGVGLGSFSGMNVPPMHGDFEAQRHWMELTTNLPLS
QWYWYDLPYWGLDYPPLTAYHSYILGKLGDIFDPTWFQLGVSRGQESM--DLKSYMRFTV
LLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAAAAILFQPSLILIDHGHFQYNSVMLGL
TVYAINNLLDEYYAPAAICFVLSVCFKQMALYYAPIFFSYLLSKSLFSPLF-NLPRLLAV
AAATLISFAAMFFPLYMWG-------------GIRNVLQSIHRIFPFSRGIFEDKVANFW
CFSNIFIKYKVLYTQSQLQMYSLCATALGFLPAFILIFFYPKKHLIPYALTACSMSFFLF
SFQVHEKTILVPLLPITLLYTSTDWNVLSMVSWINNMAFFTLWPLLKKDGLVLQYATLLL
LSNWLIGNFSFVTPRFLPKFLTPGPSTSDVSENYRRRSLLPDNIFWKLIIVASYISMGIL
HLLDFYVQPPAKYPDLWVLLNCSLGFFSFFLFWVWNYYKMFTLRNKTLYDF
>KLTH0C11176g
------------------------------MDARKSLPK---------ESFFASPLYDFL
SPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGEATVPMHGDFEAQRHWMELTTNLPLS
QWYWFDLQYWGLDYPPLTAYHSYALGKLGSVLNPEWFALGSSRGNETP--ELKAYMRFTV
ILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSLILIDHGHFQYNSVMLGL
TVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYLLSRSLFSPSF-KFSRFMSV
ALSTVITFCLMFSPLYVFG-------------GMKNVLQSIHRIFPFSRGIFEDKVANFW
CVSNVIVKYADNFTQDQLQKLSTFATAAGFLPSFALVVLYPKKHMIPYGLAACSMAFFLF
GFQVHEKSILVPLLPISLLFCSTDWNVLAIVSWINNVALFTLWPLLKKDKLALQYGIMML
LSNWLIGNFSFVTPRFLPGFITPGPSMSNVAETYRRRSFLPNNIVWKILIITSYIVMAVI
HILDLFVQPPAKLPDLWVLMNCALGFTCFSVFWLWNNYKLFTMRNKSILDL
>Kwal_56.22437
------------------------------MAGKKVSKN---------EPFFASPLYDFL
SPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGENSGPIHGDFEAQRHWMELTNHLPLS
QWYWYDLQYWGLDYPPLTAYHSYVLGKLGSLLNSEWFALLSSRGIENP--DIKAYMRFTV
ILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSLILIDHGHFQYNSVMLGL
TVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSPVFFAYLLSECLISPSL-NVPRFLSV
AFSTVISFCIIFSPLYVFG-------------GTKNVLQSIHRIFPFSRGIFEDKVANFW
CVSNVLFKYAQNYTQQELQRFSIIATAAGFLPSFLVVLCYPKKHMIPFALAACSMAFFLF
SFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLLKKDHLTLQYGILML
LSNWLIGNFSFVTPRFLPKFITPGPSISVVSETYRRRSFLPDNNFWKLIIVASYLIMAAI
HILDFFVPTPEGLPDLWVLLNCALGFFCFTIFWLWMHYKLFTMRNTNLQDF