MUSCLE (3.8) multiple sequence alignment

TBLA0A07170        ---------------MLIVILKEYVIKTLLLTYPNTRPNFMSEDNCEELLENIVGVVRAS
CAGL0E02585g       ----------------------------------------MSSDSGDNVLKKVMETVRAS
KNAG0M01230        ----------------------------------------MDSEEQKKLLSKAVGTVRAS
TPHA0J00370        -------------------------------------------MNADELLPLVVSSVRAA
ZYRO0C07678g       ----------------------------------------MAEESNEQLLPKVVGTVRAA
TDEL0G04440        ----------------------------------------MPPAEEDQLLRKVVDTIRAS
YOR001W            ----------------------------------------MTSENPDVLLSRVINVVRAA
Smik_15.170        MLINNIRPSENFSLVTLFMYFKDRYEERRLNNQKAPTPYVMASQNPDVLLSKVVNVIRAA
Skud_15.162        ----------------------------------------MPSENPDVLFSKIVKVVRAA
Suva_15.176        ----------------------MGHEDQTANSQDVSNKYAMASENSDVLLSKVVNVIRAA
NDAI0D00850        ---------------------MSSSSIDQTGTPPTAAGANEKQSPKDQLLPQVVQTVRAS
NCAS0H00860        -------------------------------------MSEQSQEQEKTLLPKVVNTVRAA
KAFR0G02660        ----------------------------------------MLLEEQKKLLSDVVNTVRAS
Kpol_1037.29       ----------------------------------------MSEDINKELLSSVVSTVRAA
KLTH0C11066g       -------------------------------------MAQAHGSEDGSVLNQVIATIRAS
Kwal_56.22447      -------------------------------------MAKTQEDKRSSILTQVVGTIRAS
Ecym_3030          ----------------------------------------MSSDNKDALLTKILGTVRAA
ACL001C            ----------------------------------------MASTDEDPLFKRIVSTIRAA
KLLA0D01309g       ----------------------------------------MSSEDKDTLLSSLVQTVRSS
SAKL0E01452g       ----------------------------------------MSSDKPDKLLSNLVGTVRAA
                                                                   ::   :  :*::

TBLA0A07170        TALAAQDVDFYKSLDKKVSDSLNKTANDTLDIANSLLLSIDENCSPLEEGKDRIPDFWNG
CAGL0E02585g       NALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSIDNNNEKLDGTNENLEEVCKE
KNAG0M01230        SSLVGQDVQFFSNLDANVASSVKELGNEVLEMINDILFSIDENSKPFAESAEQVGESWRD
TPHA0J00370        SALAAQDVDFYRSLDKEIASSLTNTSQKVTDMINSIISSVDENSEGLVEGKENLDESWKD
ZYRO0C07678g       AALAAQDVDFYRSLDKGVAKSLDKTSNELVSMINSTLLCIDQNSRLLEGGKEKLEDSRKD
TDEL0G04440        SALAAQDVDFHRSLSRPIGKSLDETSTRMVSLINSLLSSIDQNSEPLVEGKETLNEYWKD
YOR001W            SSLASQDVDFYKNLDRGFSKDLKSKADKLADMANEIILSIDEHHESFELKEEDISDLWNN
Smik_15.170        SSLAGQDVDFYKNLDREFGKVLKSKSDKLADMANEIILSIDEHHESFELKDEDISGLWND
Skud_15.162        SSLASQDVDFYKNLEREFSNVLKSKSDKLTDMVNEIILSIDEHHESFELKEDEISGLWKD
Suva_15.176        SSLAAQDVDFYRNLDRDFSKILQSKSSKLTEMVNGIVLSIDEHHDSLELKEEEISDLWKD
NDAI0D00850        VALAAQDVDFYRSMDKTTAKTLKETTSQLADMINSVLLAVDENSETLDGTKENLEDNWKD
NCAS0H00860        SALAAQDVDFYRSIDKDIAHSLEQSSNQIADMINSVLLSIDENSEQVDGTKENLEDIWKD
KAFR0G02660        STLAAQDVDFYRSLDSEVSHSINEVTDELNDMVNSIILSIDENYETLDEGKEELTESWKS
Kpol_1037.29       SSLAAQDVDFYRNLDKEISTSLNESSKEITNMINTLLLSINENNEELESGKEGLEQYWKD
KLTH0C11066g       SAVTAQDVSFYKNLDPSIATSVNNISARLLGLINDILLSVDENNDIIEQGSEGLESAWSN
Kwal_56.22447      SAISAQDVDFYKSLDSTISESLDETSAKLLSLINDVVISIDDNNDLIEPGRAGLENSWNN
Ecym_3030          SSLAAQDIDFCRHLDASVGELLDETSQYIVSLLNEVILSTSKANNDLEVGKDNLEAAWKD
ACL001C            AALSAQDIDFYRSLHPSVGQELDDTSATVVSLINELLLSVDENNNELKPGRDNFEDSWKE
KLLA0D01309g       SALAAQDIDFYKSLDSNINASLEDTSTNILSLINDLLLSIDPNNDVIQQGKDSFVDSWKS
SAKL0E01452g       SALSAQDLDFFKSLDSGISKSVEGSSSKLLNLINEVLLSIDENNDTIEYGKDNFQESWKD
                    :: .**:.*   :       :         : *  : . .     .      .      

TBLA0A07170        FSNIMDNLIEKSDHFIDALSK--PNNFN-GKYNETTFLDNNSRTNSNPSKR--IEKPQLL
CAGL0E02585g       FSNVMDVLFEKADRSLDILNR--KSSTN-DNKKNMQFLDDVNVAENDPSRR--ISKPQLN
KNAG0M01230        FTNLTDNLFEKSDRSMDIIAQ--GTRKNGQAGSEVQYLDDLVGNDSSSGKR--ITKPQLH
TPHA0J00370        IGNLLDSLFELADHSIDALSK--ASQKS-SNDPKMKYLNDSLNFESDNVTR--LSKPQLN
ZYRO0C07678g       FSNLMDNLFEKSDRSLDIL-R--GRAPD-RKGAALMYLDDAARSDMIPAKR--ILKPQVR
TDEL0G04440        FSNMMDNLFELSDCSADILTR--APGSR-KDGEKLKFLDNSSSNDSIPSKR--ISKPQLN
YOR001W            FGNIMDNLLEMSDHSLDKLNC--AINSK-SRGSDLQYLGEFSGKNFSPTKR--VEKPQLK
Smik_15.170        FGNIMDNLLEMSDHSLDKLNR--AVTSK-PNGADLQYLGDFSEKNLSPAKR--VEKPQLK
Skud_15.162        FGNIMDNLLEMSDHSLDKLNH--TANSK-VSGAELQYLGDFSGKDSLSTKR--LEKPQLK
Suva_15.176        FGNIMDNLLEKSDHSLDNLNR--TSNSN-NSAADLQYLGDFSGKDSQPTKR--VEKPQLK
NDAI0D00850        FSNLMDNLLEKSDRSMDMLLR--SKNTN-TNNSNMQYLDEYSGRDDTSSKRRAIGKPQLE
NCAS0H00860        FGNLMDNLFEKSDRSIDIITR--GHGGS-NGQSGMQYIDEFSGRDLTPGKQ--ILKPQLK
KAFR0G02660        LSNIVDNLFEKSDRSLDILKT--GAKKK-PTNPPFEYFENATTTENIPQKR--INKPQLK
Kpol_1037.29       FSNVMDNLFEKSDRSLDIITR--SKTSN-DNKSEFQYLSDSAQSDSNPSKR--VTKPQLQ
KLTH0C11066g       VGEVMDLLFEKSEHALAAGEK---RDNG-ELSKTVQYLDDSPSLHDGAPKK--ILKPQLL
Kwal_56.22447      IGEVMDLLFEKSEHALAAMKK---KGSN-IIGNNLQYLDDSQPLTDTTLTK--ITKPQAS
Ecym_3030          LSNIIDNLFEKSDHSLDVLQKLLSSSSS-QLDTNMQYLNVDSQRDGKLSQR--IVKPQLQ
ACL001C            LSNVMDNIFEKSDHAFDSIKH--GSSSR-NEGVNMQYLADSSHDDSTPSKR--IEKPQLL
KLLA0D01309g       ISNIMDNLFEKSDHALDNIRA--GNGGN-AGGPSLKYLNDDDRSNNKPSKR--IEKPQLS
SAKL0E01452g       IGDIMDNLFEKSDHAFDALKR---NSIN-QGNSNVQYLDDSSRSNLNPSKR--IEKPQLN
                   . :: * ::* ::                       ::            .  : ***  

TBLA0A07170        FSKPVDNTDSRPFKPLLVEKPNALKPLKDSLVLVPESGIVPTHYLQPYEYEIDNQEYNEE
CAGL0E02585g       FKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQQPYEYEILNQEYNND
KNAG0M01230        FSRPVDNSESQPFKPLLTEKPNALKPLKESLQMVPATENIPSHYPNPYDYEISNQEYNND
TPHA0J00370        FSVPVDNSETHPFRPLLTDKPNAVVPLDEVLKIVDGTEDTPQHYPQPYETEIDKQEYNEQ
ZYRO0C07678g       FQRPIDNTETHPFKPLLENKPHALRPLSDCVRLVQADEDIPEHYPQPYEYEIENQEYNES
TDEL0G04440        FKNPVNNTEIQPFVPLLKEKPFALRPL--ISDIVPGNDAVPEHYAQPYEYEIEHQEYGES
YOR001W            FKSPIDNSESHPFIPLLKEKPNALKPLSESLRLVDDDENNPSHYPHPYEYEIDHQEYSPE
Smik_15.170        FKTPIDNSESHPFIPLLKEKPNALKPLSDSLRLIEEDDNTPSHYPHPYEYEIDHQEYGSN
Skud_15.162        FKKSIDNSESHPFIPLLKEKPNALKPLSESLRLAEAEENNPSHYLHPYAYEIDHQEYSSD
Suva_15.176        FKTPIDNSESHPFIPLLKEKPNALKPLSDSLRMIETEENSPGHYPHPYEYEIDHQEYNPN
NDAI0D00850        FDVPVDNTETHPFIPLLKSKPNALKSLDESIQLLPVDENVPEHYAQPYEYEIDNQPYNDK
NCAS0H00860        FTTPIDNTESHPFIPLLKEKPFALKPLEESMQMIPEDETSPMHYPQPYEYEIDHQEYNDL
KAFR0G02660        FVPPIDNSESHPFIPLLKEKPNALKTIDESTKLINSDENVPEHYAHPYEYEIDNQPYNDS
Kpol_1037.29       FSRPVDNSESKPFMPLLNDKPHSIKSFTDSLIIIPESEELPSHYAHPYEVEIDKQEYNAS
KLTH0C11066g       FKRPIDNSESHPFKPLLKKKPHALRSLDESLRLTAEQEDVPAHYPQPYEYEIDHQEYNES
Kwal_56.22447      FSRPVDNTESHPFKPLLVQKPNALRPLDDVLQLTVEEEGIPAHYPHPYEYEIDHQEYDES
Ecym_3030          FKIPVDNSECHPFKPLLKVKPHALKPLEEVSSLTVETECVPAHYPHPYEYEIDNQPYDDS
ACL001C            FKTPVDNTELHPFKPLLKEKPHALKPLEESLMLAPEEENVPAHYPHPYEYEIDKQPYNDS
KLLA0D01309g       FKTPVDNTELHPFKPLLEYKPHSLQPFEISLKMVPEEESIPSHYPHPYEYEIDHQKYNDS
SAKL0E01452g       FKTPIDNTESHPFKPLLENKPHALRPLSEILKQTPETENIPSHYPHPYGYEIDTQEYNES
                   *  .::*:: .** ***  ** :: .:             * *: :**  **  * *.  

TBLA0A07170        VVEIRDPTPYKPWETTSAIWIDTKESLADLLMDLRKQSEIAVDLEHHDLRSYYGITCLMQ
CAGL0E02585g       ILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLEHHDFRSYYGLVCLMQ
KNAG0M01230        ILETRAPIPSTPWHESEPVWVDSTEGLQSLLKDLKKYKELAIDLEHHDYRSYYGIVCLMQ
TPHA0J00370        VLQFSDPIPSKVWEETEAIWVDNEESLAAMLNELKTATELAVDLEHHDFRSYYGITCLMQ
ZYRO0C07678g       ILKIAEPIPSKPWDGSEPVWVDNKESLDSMLQDLKKSTEIAVDLEHHDYRSYYGIVCLMQ
TDEL0G04440        VIVKSEPIPSKPWETTEALWVDNIEVLKTMISDLKSVTEIAVDLEHHDYRSYYGIVCLMQ
YOR001W            ILQIREEIPSKSWDDSVPIWVDTSTELESMLEDLKNTKEIAVDLEHHDYRSYYGIVCLMQ
Smik_15.170        ILQIRKEIPSKSWNDSEPIWIDTMPKLESMLEELKNVQEIAVDLEHHDYRSYYGIVCLMQ
Skud_15.162        VLQIKKEIPSKSWDDSEPIWIDTKTKLGLMLEDLKNASEIAVDLEHHDYRSYYGIVCLMQ
Suva_15.176        ILQIKPEIPSKPWDASEPIWINSKATLKSMLEDLKNAHEIAVDLEHHDYRSYYGVVCLMQ
NDAI0D00850        ILQLSDPIPSQPWMETTAIWVDTPESLQSMIKDLNNCTEFAVDLEHHDYRTYYGIVCLMQ
NCAS0H00860        ILQKKDPIPSTSWTDNEPIWVDTVSQLQSIMPDLEASTEIAVDLEHHDYRTYYGITCLMQ
KAFR0G02660        ILQVREPIPSKSWSETEGVWVDNVESLNHMLNDIKKYTEIAIDLEHHDYRTYYGIVCLMQ
Kpol_1037.29       VLQVAEPLKSQPWN-SESTWVDTSEALQSMLDKLKECTEIAVDLEHHDYRSYYGIVCLMQ
KLTH0C11066g       VLQISEPVPSLPWDETEAEWVDNTDALKLMLNELLLANEIAIDLEHHDYRTYYGITCLMQ
Kwal_56.22447      VLEIRPPIPSKPWEETDATWVDNLGTLNDMIRELSKAKELAIDLEHHDYRTYYGITCLMQ
Ecym_3030          VLTIKEPIEPSNWDENEPIWVDNITALNDMLNGLKNVKEIAVDLEHHDYRSYYGLVCLMQ
ACL001C            VLEVRERIDPQPWEATEPIWVDNVESLSQMLDELKEVKELAVDLEHHDYRSYYGIVCLMQ
KLLA0D01309g       ILVATEPIPSKDWDETEAIWVDTVEGLNKMKDELSKATELAIDLEHHDYRSYYGIVCLMQ
SAKL0E01452g       ILQIRDPIPSQPWEDTDPVWVDTKESLQKLLNELRSAKEIAVDLEHHDYRSYYGIVCLMQ
                   ::          *  .   *::.   *  :   :    *:*:****** *:***:.****

TBLA0A07170        ISTREQDYIVDTISLRDDLIVLNEIFTNPNITKVFHGASMDIIWLQRDLGLYIVSLFDTF
CAGL0E02585g       ISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWLQRDLGLYIVSLFDTF
KNAG0M01230        ISTRDTDYLVDTIALRDELHILNQVFTDPMVTKVFHGAFMDIIWLQRDLGLYIVSLFDTF
TPHA0J00370        ISTRNTDYLVDTIALRDKLQVLNVVFTDPKITKILHGAFMDIIWLQRDLGLYIVSLFDTY
ZYRO0C07678g       VSTRQTDYLVDTLALRDDLVVLNEVFANPLIVKVFHGAFMDIIWLQRDLGLYIVSLFDTY
TDEL0G04440        ISTRERDYLIDTIALRDDLQILNEVFANPKILKVFHGAFMDIIWLQRDLGLYVVSLFDTF
YOR001W            ISTRERDYLVDTLKLRENLHILNEVFTNPSIVKVFHGAFMDIIWLQRDLGLYVVGLFDTY
Smik_15.170        ISTREKDYLVDTLELRETLHILNEVFTDPSIVKVFHGAFMDIIWLQRDLGLYVVGLFDTY
Skud_15.162        VSTRERDYLVDTIELRDALHILNEVFTDPLIVKVFHGAFMDIIWLQRDLGLYVVGLFDTY
Suva_15.176        VSTRERDYLVDTLELREDLHILNEVFTNPSIVKVFHGAFMDIIWLQRDLGLYVVGLFDTY
NDAI0D00850        ISTRTQDYIVDTLKLRSHLQPLNEPFTNPQITKVLHGAFMDIIWLQRDLGLYIVSLFDTF
NCAS0H00860        ISTRKNDYLIDTLALREDLQILNNVFANPMITKVFHGAFMDIIWLQRDLGLYVVGLFDTF
KAFR0G02660        ISTRETDYLVDTIALRNDLKVLNEVFTDPSVVKVLHGAFMDIIWLQRDLGLYIVSLFDTF
Kpol_1037.29       ISTRKEDFLVDTLALRDELHILNEVFADPNILKVLHGAFMDIIWLQRDLGLYVVSLFDTY
KLTH0C11066g       ISTREKDWLIDTIALRDDLWILNEVFTDPKITKVLHGAFMDIIWLQRDLGLYIVSLFDTY
Kwal_56.22447      ISTRENDWLVDTIALRDHLWVLNEIFTNPKVIKVFHGAFMDVIWLQRDLGLYLVSLFDTF
Ecym_3030          ISTRESDWLVDTIALRQDLQVLNEIFTDPSILKVFHGAFMDIIWLQRDLGLYVVSLFDTY
ACL001C            ISSRSKDWLVDTIALRDDLHVLNVILPDPTVVKVFHGAFMDMIWLQRDLGLYVVSLFDTY
KLLA0D01309g       ISDREHDWIVDTIALREELYILNDIFTDPNVTKVLHGAFMDIIWLQRDLGLYIVGLFDTY
SAKL0E01452g       ISTRERDWLVDTIALREELHVLNEIFTDPSVLKVFHGAFMDIIWLQRDLGIYVVSLFDTY
                   :* *  *:::**: **. *  **  :.:* : *::*** **:********:*:*.****:

TBLA0A07170        HASKALGLARHSLAYLLENYASFKTSKKYQLADWRRRPLTNNMLAYARSDTHFLLNIFDQ
CAGL0E02585g       HASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMAYARADTHFLLNIFDQ
KNAG0M01230        HASKALGFPKHSLAYLLETLANFKTSKKYQLADWRIRPLSKPMSVYARADTHFLLNIFDQ
TPHA0J00370        HASRALGFPRHSLAYLLERFAHFKTSKQYQLADWRTRPLSKAMNAYARADTHFLLNIFDQ
ZYRO0C07678g       HASRALGFPRHSLAYLLETFASFKTSKKYQLADWRVRPLSKAMSAYARADTHFLLNIYDQ
TDEL0G04440        HASRAIGLPRHSLAYLLEKFANFKTSKKYQLADWRLRPLSKAMNAYARADTHFLLNIYDQ
YOR001W            HASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTAYARADTHFLLNIYDQ
Smik_15.170        HASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMIAYARADTHFLLNIYDQ
Skud_15.162        HASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRARPLSKPMTAYARADTHFLLNIYDQ
Suva_15.176        HASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTAYARADTHFLLNIYDQ
NDAI0D00850        HASRALGFPKNSLAYLLEKFSNFKTSKKYQMADWRIRPLSKAMNSYARSDTHFLLNIFDQ
NCAS0H00860        HASRAMGLPKHSLAYLLEKFAQFKTSKKYQLADWRIRPLSKAMHAYARADTHFLLNIFDQ
KAFR0G02660        HASRALGFPRHSLAYLLEEFANFKTSKKYQLADWRVRPLSKAMTAYARADTHFLLNIYDQ
Kpol_1037.29       HASRALGFPRHSLAYLLEKYANFKTSKKYQLADWRVRPLSKPMHAYARADTHFLLNIYDQ
KLTH0C11066g       HASRLLGSPKHSLAYLLERYAHFKTSKKYQLSDWRVRPLPKALKAYARADTHFLLNIYDN
Kwal_56.22447      HASRLLGFPKHSLAYLLERYAHFKTSKKYQLADWRIRPLSKPLKAYARADTHFLLNIYDQ
Ecym_3030          HASRALGFPKHSLAYLLETFANFKTSKKYQLADWRIRPLSKPMKTYARADTHFLLNIYDK
ACL001C            HASRALGFPKHSLAYLLETFAKFKTSKKYQLADWRVRPLPKPLRDYARSDTHFLLSIYDD
KLLA0D01309g       HASRMLGFPKHSLAYLLERFANFKTSKKYQLADWRIRPLTKPMLAYARADTHFLLNIFDK
SAKL0E01452g       HASRSLGLPRHSLAYLLEKFAQFKTSKKYQLADWRIRPLTKPMRAYARADTHFLLNIYDQ
                   ***. :* ..:*******  : *****:**::*** ***.: :  ***:******.*:*.

TBLA0A07170        LRNTLIKQNKLAGVLHESRNVAKRRFEYLKFRPTVPLPN--LYTLIEKEAPWKSLLIQYN
CAGL0E02585g       MRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVAN--IFTPVEKESPWRTLMYQYN
KNAG0M01230        MRNQLIKDNKLAGVLGESRKVAKRRFEYSKFRPKLAQPD--VFTPIEKESPWRTLMFQYN
TPHA0J00370        LRNMLIQEDKLASMLHESRKVAKRRFEYSKYKPTLPSSA--VFSPTESDMPWRSMIYQYN
ZYRO0C07678g       LRNKLIIENKLAGVLAESRNVAKRSFQYSKYRPKVPNSS--VYSPVDRADGWKVLMNQYN
TDEL0G04440        LRNTLIEQNKLAGVLAESRNVAKRRFEYSKFRPIAPSPT--VYCPIDKPDPWKVLMFQYS
YOR001W            LRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPLTPSSE--VYSPIEKESPWKILMYQYN
Smik_15.170        LRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPRIPSSE--VYSPIEKEAPWRVLMYQYN
Skud_15.162        LRNKLIESNKLAGVLYESRNVAKRRFEYSKHRPRTPSSE--VYSPIEKENPWRVLMYQYN
Suva_15.176        LRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPITPSSK--VYSPTEKENPWRVLMYQYN
NDAI0D00850        MRNKLVQDGKLAGVLKESRNVAKRRFEYVKYRPLITSSA--VYSPIEKIDPWKTLMYQYN
NCAS0H00860        MRNSLIEQNKLAGVLKESRNVAKRRFEYSSFRPKVLQTNGLVYSPIEKDDPWKTIMFQYN
KAFR0G02660        LRNRLVETNKLVGVLNESRNVAKRRFEYSKFRPRVPSPN--VYSALEKEDPWRTLMFQYN
Kpol_1037.29       IRNQLIRENKLAEVLFESRNVAKRRFEYSRFRPKVPSPA--VFTPIEKEEPWRTLVYQYN
KLTH0C11066g       MRNSLIEQNKLSQVLHDSRNVAKRRFEFTTFRPKIVTSH--VFSPIEREDPWRTLMFQYN
Kwal_56.22447      MRNSLIEQGKLAQSLHNSRGVAKRRFEYTKFRPTVMTSE--VYSPVEREDPWRSLIFHYN
Ecym_3030          LRNSLIKEDKLSGVLHASRNVAKRRFEYTSFRPKVLSPT--VFSPIEKDDPWRTLMSQYN
ACL001C            LRNALVKAGKLAEVLNASRNVAKRRFEYTSFRPRIPDSN--VYSPIESTEPWRKLMYQYN
KLLA0D01309g       LRNSLLEQNKMSDVLHESRKVAKRRFEYSSFRPKVPSSA--VFSPIEKDEPWKNIMFQYN
SAKL0E01452g       LRNSLIEQNKLAAVLHDSRNVAKRRFEYTSFRPKIVSAD--VFSPIEKDEPWRNLMYQYN
                   :** *:  .*:   *  ** ** * *::  ..*    .   ::   :    *. :: :*.

TBLA0A07170        IQDEKEILVQKLWEWRDMIARRDDESPRYIMPTQVLISLISYTPTDSSGVISVSNMVTEH
CAGL0E02585g       IPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDPISVVSVSSVVTDH
KNAG0M01230        VTPEKEELVKALYEWRDTIARRDDESPRYIMPNQLLISLSAYTPTDPVSLVSVNSYVTDC
TPHA0J00370        IPSQKVELVKRLWEWRDTIARRDDESPRYIMPNQLIASLVEYVPTNPAGVISVNRMMTDP
ZYRO0C07678g       IPLEKEILVKNLYEWRDTIARRDDESPRYVMPNQLLAYLVDYTPLDPTGVISVSPTVTDH
TDEL0G04440        ISPNREELVKKLYDWRDTIARRDDESPRYVMPNQLLVELARQAPTEPINVISVNSIVTDH
YOR001W            IPPEREVLVRELYQWRDLIARRDDESPRFVMPNQLLAALVAYTPTDVIGVVSLTNGVTEH
Smik_15.170        ITSEKEELVKDLYQWRDVIARRDDESPRFVMPNQLLAALVAYTPIDVIGVISLTNGITEH
Skud_15.162        ITSEKEELVKDLYLWRDFIARRDDESPRFVMPNQLLAALVAYAPIDVIGVVSLTNGVTEH
Suva_15.176        IAPEREELVKDLYEWRDVIARRDDESPRFIMPNQLLAALVAYTPIDVIGVVSLSNGVTDH
NDAI0D00850        IPLAKELLLKELYQWRDKIARRDDESPRYIMPNQLLVSLVAYAPVEPAGVVSVSNMVTDH
NCAS0H00860        IPPQKEPLLKELYQWRDKIARRDDESPRFVMPNQLLVSLVAYTPIDAPGVVSVSNSVTDY
KAFR0G02660        IPSEREDLLKGLFEWRDMIARRDDESPRYIMPNQLMVTLVAYTPTDPAGVISASQVVTDY
Kpol_1037.29       VPSTKIELLKRIWEWRDMIARRDDESPRYIMPNQLMISLVEYTPIDPAGVISVSNVMTDH
KLTH0C11066g       IPQSKSLLVRRLYEWRDMVARRDDESPRYVIPNQLLVSLAVNAPTTPALIMATSTFVTEH
Kwal_56.22447      IPQSKSFLLKRLYEWRDTIARRDDESPRYVMPNQLLVALVMNAPTDTYGLLSVTSFVTEH
Ecym_3030          VPDIKEPLMRKLYKWRDMVARKDDESVRYVMPNQLLVSLVTLAPSDPSGLLTVKSYIPDH
ACL001C            LPPSKEPLLKKLYEWRDTVARRDDESVRYVMPNQLLVSLVSLSPSETAGVLSVSTYVTDY
KLLA0D01309g       IPASKELLLRRLYEWRDTIARRDDESPRYVMPNQLLVSLVAGAPTEPINVLSVSSYVSEH
SAKL0E01452g       IPLSREPLMRKLYEWRDTIARRDDESPRYVMPNQLLVSLVAIAPTDPAGVLSVSNFITDY
                   :   .  *:. :: *** :**.**** *:::*.*::  *    *     ::: .  :.: 

TBLA0A07170        VRSNSTTLANLIKKALESTKSIP-------NSSDSSSTFNMSRTDTNVA-SLISITEINN
CAGL0E02585g       VRRNSKTLANLIKKKLEEIKLGEV------KSINNRLPSSLDVSQDEL--QFLPSHKIEL
KNAG0M01230        VRSNSKVLANLIKSFVESSK----------LGPQSSYTPNTENTSTPFV---LTLSQIKD
TPHA0J00370        VRSNAKAIANLIKSTLEDMKN---------NNISTTVVSTTAKDKETSS-NDLSTSQIKF
ZYRO0C07678g       VRTNAKALANLIVKSLQQIAD---------AGSDIKVESVQHKDQHDLS-QVLTVGQIES
TDEL0G04440        VRSNSLVLAHLIKNTLASSDK---------ESDKGTFEADNNSTDAA---SLLTVPQIQK
YOR001W            VRQNAKLLANLIRDALRNIKN---------TNEEATPIPSSETKADGILLETISVPQIRD
Smik_15.170        VRQNAKVLVNLIKNSLRHIKD---------TYKEDSPVTFSESMTNEVSLEAITIPQIRD
Skud_15.162        VRQNAKVLANLIENALGNIKD---------TNKKTTSITSSESKPDGISLEVITISQIRD
Suva_15.176        VRQNAKILANLIKSALRSMKD---------THKESAEIVSSKFKSASL--EAITVSQIRD
NDAI0D00850        VRSNSKILANLIKNCLTKIKDTTDADSLILQQEQNQPGTSTTTTNVDLS-EQLSIHQLNT
NCAS0H00860        VRSNSKILANLIKNCLAKMKDNKFLD----NNVAEEGISVVPETGHDLS-QKLTIHQLQN
KAFR0G02660        VRSNSKIIANLIKNALTRAKD---------QNRQLQFVADNHTRESYRSTDKMTVSQIKE
Kpol_1037.29       VRSNSKVIANLIKKSLEDMKSVP-------AGALTAFQNIDYKIGQKFASDKLTISQIQN
KLTH0C11066g       IRQNAKSLALLIKKSLES------------SSNEFGQLLNSANTVQNSSPTKMSSEDIEK
Kwal_56.22447      VRSNAKSLSQLIKKTLASPQD---------LFTDQINHMDSNKSMVD---SKLSPGDVKA
Ecym_3030          VRANARVLCNIINKTMEEIKS---------GSHEGQSIENVTTTYVSAQDPEMSVSLIKT
ACL001C            VRSNARTLANLIKRTLETIKA---------GTASVAEFSSSERALSNPA-ATLSLHMIQN
KLLA0D01309g       LRTNSKVIANLIKRTLEDLKGNS-------NSSAIPLLESAESNGTDLA-NIITTSQIKS
SAKL0E01452g       VRSNSKMLSNLIKKTLESLKN---------GDVSTNNAGSSQLEEKDLS-QVLSISQIQN
                   :* *:  :  :*   :                                    :.   :  

TBLA0A07170        ICLKFNSLSKHYN----TSKFLTSGIEVSSLLFSNI-MTSSPK----ISDYS--KDKTTS
CAGL0E02585g       MTGAFKEIENQLT-----QATKSKQAMTSSVVLSEI-LLHPEH----AVKYH--NGSACS
KNAG0M01230        IGMRFTKLTENFQ-----SSSCQKISPLQRSSFFGD-LSKGKV----TVSYN--DAKTTP
TPHA0J00370        IVSQFENILEKYSSNNSNLNDVTSKEGKDSLVFSKI-FNSRDD----IITYD--KGTKHL
ZYRO0C07678g       QVSQFHDLSKAFK---GLSQGTNSSNSSSSIIFGNI-LHAPCG----FVGYG--RSLKKP
TDEL0G04440        LAACFAGVSRAFT-----ILQNEYKDGRSSSIFTDI-LTSEDD----AVNYV--GNNMDH
YOR001W            VMERFSVLCNSNI-----SKSRAKPVTNSSILLGKI-LPREEH----DIAYS-KDGLPNK
Smik_15.170        IMERFSVLSNSNV-----SNCRAKNGATPSILLGRI-LPLEEN----DIAYK-NNGLPNR
Skud_15.162        IMERFSLLSNSGV----INNRTKTGDSTSSILLGKT-LPFEEC----GISYG-KKGTPNK
Suva_15.176        IMDRFSVFSSNSV-----TEDRSMDSTASSILFGKI-LPYEEG----DIVYE-DSGLPHK
NDAI0D00850        LKSQFLSLYSKVNHIEGVTNNARNAEKKNSFLLCTDHMSFNDEDGKNFIKYSVSPDKKDK
NCAS0H00860        LKSKFQLLSDKFN----NSVKTRLSNHDQLYLFDGI-SFADDV----TIKYF--ADGKIQ
KAFR0G02660        TASVFIQIAEKLG---TCNNDQQQSKSFARSNYFGS-LSKKLD----IIEYK--NGEKHS
Kpol_1037.29       MTALFKEIASNPS-----IIEKDVSKKIDPILFSNI-FLSKNE----IVLYD--HDKRHV
KLTH0C11066g       NSRMFEKFLEDFS----YEKAADCGISLGSSLFQKK-FVPCEE----YVSYQ--ESRASL
Kwal_56.22447      NHQNFDQYTRKSR----ELVIHGPTVVRGCSLFPGK-PLPNEA----YVSYQ--GTQVHH
Ecym_3030          MDRHFKFLLDEVQ----SHAVEPSSVCEDSLLFKGF-LFDKPK----AVAYN--SVGKRL
ACL001C            LDDHFRSLLMEAQ----KQSGSICSQHSSSLLFNSD-LATGPS----AVEYT--NGQKHV
KLLA0D01309g       IQNIFHSLASEIN----SQKLNNEQNSEKSVLFNGISNLDVNT----AVRYT--PKTRTL
SAKL0E01452g       MCLQFNSLASKVK----KANSATNSMPKVSILFDGDHIFSNDR----AVLYS--KNSKIV
                       *                                             *         

TBLA0A07170        FKSEDMIARHIRLSEGLKGLSANN-SFIYQPPVEDIK-------SIEITTENPIPTLEPK
CAGL0E02585g       VEESELKDRYLSYIKATLLA---A-SKNINMVLETSNSN---------APLETEETHNKK
KNAG0M01230        VSQSVLESRSKQFNEYMKAF---G-DIEYKIPSIVEPVM-----DLPIPSGTTSTESADS
TPHA0J00370        ITEQQLSDRQKEVDAAMKQA---E-EIAFSMEVQDTHKE-----SMKQPFPEPEEVISQS
ZYRO0C07678g       VTDKQIEKRKLELSEALEFI---DAETATTIQEEDRGSEL----THEPADDKKVSENDES
TDEL0G04440        ITKKELGKRAAKALQSMEQF---DEATSYYMPIPEIAKE-----SNTMEEIRPPAPEEVK
YOR001W            VKTEDIRIRAQNFKSALANL---E-DIIFEIEKPLVV-------PVKLEEIKTVDPASAP
Smik_15.170        VKFEDIRARAQSFNSALSNL---E-DCMLEVEKPHIL-------PTNVKKIERINTEDVP
Skud_15.162        VKVEDIKARAQKFNSALAGL---E-NIMFELEKPVTV-------PASVEKGEAVEIESAP
Suva_15.176        VKVEDMRDRAQRFNSALVGL---E-DIKFEVEK-----------PVNVEKSEMVKIETTP
NDAI0D00850        ITTEELLKREEMFDQAMEQL---Q-QVEYSIPIPENEIV-----VVESEQQEPSIPAANA
NCAS0H00860        TTAEQYKERSEQFDDAMKQL---E-EVEYCIPVIEENKQ-----TQDQDNIPPITVATNA
KAFR0G02660        VKQQQLVSRFNTYTKQVNEL---T-NVRYELPVH----------KEPPQLQKDDVEEVKK
Kpol_1037.29       VTNEQLAGRAEEVEGFMNEA---N-NTTLAINIESSAEMHVEEPEAKEKNALFSPPISNV
KLTH0C11066g       VDHNSLENRRHQVSKKYEA------ERDIARPQVHIRA------ASSHAVCDKEAGAEDN
Kwal_56.22447      IEPTVLDDRRELVAQNITTT---A-NVTEKLQVAVEK-------TPAPEVSDELDEGEAK
Ecym_3030          VNDRELLDRKSDLSQKFSKVFKAA-GIAIGSHIEKLSSN-----SELPADTTSNVESPSK
ACL001C            IGDNVLQTRKHALLQKFTSQ---PVEPVTDIEAPSHQSS-----SENPQVSEDISPSEPQ
KLLA0D01309g       IPQHELLKRQHEITRTLEQEYTDRQAQSIVLPSNE---------DEAPTQVSNDENRNEV
SAKL0E01452g       IDENQLQERKLEVSEKLKEV---Q-EPDFRLHVNVTTKE-----TDEVSKDVSEKDDVNR
                           *                                                   

TBLA0A07170        STQKKTTKEINE-DNEEIIVLKKVNRK--YQKGKKDA---DKDSTVVVDYSKAKKIFQKK
CAGL0E02585g       SDQIQVIPEKQE-DMDEIVVLKKKKIH--SNDQKAKH-DDGDIVEEPVDYSKA-NILASD
KNAG0M01230        KTVEKPPKNIKE-DMDEIVVLKKVKRE--LPKPKGND---EDAEREIVDYSKEDKVLVQR
TPHA0J00370        HLPAFEDKEEQE-DLDEIIVLKDTKDR--RNRQHRGRGRSADSDHTVIDYSKGDKILSQD
ZYRO0C07678g       KKEEAKETEPEE-DKNEIITLKKVKDR--GKKSKRSN---ESEPEEPIDYKKSKKILETE
TDEL0G04440        ESPSPP----KE-DMDEIITLKKIKKQ--KSQSPKEL-GISEREIPAVDYTKTKKVLATN
YOR001W            NHSPEI-----D-NLDDLVVLKKKNIQ--KKQPAKEK---GVTEKDAVDYSKIPNILSNK
Smik_15.170        KHSATI-----E-NPDDIVVLKKKNIH--RTQSMNAK---DTMGEKAIDYSKIPNVLSSK
Skud_15.162        ELPSKA-----E-SFDDIIVLKKKKMH--KKQPAKGK---DMTVKEAVDYSKMPSVLSSK
Suva_15.176        EPPTKI-----E-DPDEVVVLKKKRIH--KKQVAKRS---DVAAEEAVDYSKIPNVLSSK
NDAI0D00850        EITTAVASRKKE-DLDEIIVLKKTNRNKGKKRERKHSDDDDEGEIEVIDYSKMEKVLDNS
NCAS0H00860        EGQVNEMIEKPE-DLDEVIVLRKTNKN--KSIKNKPK-NREEPELEIIDYFKTAKVLTND
KAFR0G02660        TIIADSIPAKPEIDLDEVVVLKKVNRQ--PNKTKLEE----NEKIDFIDYSKSEKILKGD
Kpol_1037.29       ENASSSNTDGFE-DMNDIIVLKDVKKR--TNIKDHKK-KQGMPNKEVIDYSKLDTILSKE
KLTH0C11066g       ESAEEENKARKE-EMDEVIVLKQRKTL--ADKEQRAV-DKATPSIEPLDLQSARKILEAP
Kwal_56.22447      ELSDDTVSQLKE-DKDEIVVLKRRKAL--PQSSSPPK-NAEGNPKEILDFKNNKKIMTAT
Ecym_3030          EESKNNSDDLKE-DKHEIIVLKRKRDY--GSNTKSTS---KQPKKEHVDYNNVNSILDNT
ACL001C            ESQNEVQKDEPDFEKSEIVVLRKKKKA--HAQKPKGT---SSSPTETVDYSNAKEVLGKG
KLLA0D01309g       ITSDPSQEEIEE-NKDEVITLRKRQSQ--SNNKRKTI--SPPASHEIMDYAAGSDLLNST
SAKL0E01452g       ASETDP---LET-NKDEIIVLKKKKRH--EPQDRKKV--GNSTDVEPMDYKNAEKLLGNS
                                .  :::.*.  .                      :*      ::   

TBLA0A07170        D-----ETINGNSKKRKSFDPYNNDGDTDKVPRALKKRQTNTRGKNISYKR
CAGL0E02585g       N-----REVKKKDKKRV-FDPYSSTG---EGPKAAKKRRLVTKGKKISFKK
KNAG0M01230        Q---FDKKKKNNNNKKR-FDPFSAIS---EGPKAPKKRKAVTKGKNASFKR
TPHA0J00370        N-------RRRTPNKRK-YDPFSADNNE-NALQGAKRRRPTAKNRNVSFKR
ZYRO0C07678g       K-------KSKSTKKRA-FDPYAASNDAGNAPK-PKKKRRMARGKSASFKR
TDEL0G04440        Q------DKNKDKKKRK-FDPYAASNHSSDAPRAPKKRKPVNRERNVSFKR
YOR001W            P-----GQNNRQQKKRR-FDPSSSDS---NGPRAAKKRRPAAKGKNLSFKR
Smik_15.170        S-----DQNRRQQKKRR-SDPLFNDS---DGPRAAKKKRPATRGRNVSFKR
Skud_15.162        P-----GQNRKQQRKRR-FDPSSNDS---EGPRAAKKKRPAPRGKNMSFKR
Suva_15.176        P-----GQNNKQQRKRR-FDPSFNDS---EGPRAPKKKRPTTRGKNVSFKR
NDAI0D00850        NTKRNQNKNNNGNKRKR-FDPYNVNN---EGPRAPKKRKAMTRGKNVSFKR
NCAS0H00860        K-NSRGGRNNNGNKRKR-FDPYSAAN---EGPAAPKKRKNVTRGKNVSFKR
KAFR0G02660        K-----QRKKRESKKRQ-FDPFAASN---EGPKAARKRKSGTRGRNLSYK-
Kpol_1037.29       K--------RENSKKRK-GDPFGEENGL-EGPKAAKKRKQINRGKNVSFKR
KLTH0C11066g       S-------NNVRRPKKR-FDPYATLA---AGPPSVKKRKK-TKGLQKSFRG
Kwal_56.22447      A-------SVPRKSTKR-FDPYAIQA---SGPDGVKRRKK-TRGIQKSFK-
Ecym_3030          S-QQDKPNSGRHVDKRK-FHSDLQGS---IGAAAIKKPR--SKGKTVSYKK
ACL001C            TSSTAKRGDKDRPRKRK-FDPYGQDN---NAPSGVKKKNKPSKGKSISFK-
KLLA0D01309g       K----NNTNSQKHKKRR-FDPYSVEH---VGPQPIKKKSKPAKGKNVSFKR
SAKL0E01452g       K-----KSSKQKTTKRR-FDPYTSEN---VGPQSAKKRKKPTPGKNMSFKN
                                  .    .              ..          *:. 

FASTA FORMAT for MUSCLE Version 3.6

>TBLA0A07170
---------------MLIVILKEYVIKTLLLTYPNTRPNFMSEDNCEELLENIVGVVRAS
TALAAQDVDFYKSLDKKVSDSLNKTANDTLDIANSLLLSIDENCSPLEEGKDRIPDFWNG
FSNIMDNLIEKSDHFIDALSK--PNNFN-GKYNETTFLDNNSRTNSNPSKR--IEKPQLL
FSKPVDNTDSRPFKPLLVEKPNALKPLKDSLVLVPESGIVPTHYLQPYEYEIDNQEYNEE
VVEIRDPTPYKPWETTSAIWIDTKESLADLLMDLRKQSEIAVDLEHHDLRSYYGITCLMQ
ISTREQDYIVDTISLRDDLIVLNEIFTNPNITKVFHGASMDIIWLQRDLGLYIVSLFDTF
HASKALGLARHSLAYLLENYASFKTSKKYQLADWRRRPLTNNMLAYARSDTHFLLNIFDQ
LRNTLIKQNKLAGVLHESRNVAKRRFEYLKFRPTVPLPN--LYTLIEKEAPWKSLLIQYN
IQDEKEILVQKLWEWRDMIARRDDESPRYIMPTQVLISLISYTPTDSSGVISVSNMVTEH
VRSNSTTLANLIKKALESTKSIP-------NSSDSSSTFNMSRTDTNVA-SLISITEINN
ICLKFNSLSKHYN----TSKFLTSGIEVSSLLFSNI-MTSSPK----ISDYS--KDKTTS
FKSEDMIARHIRLSEGLKGLSANN-SFIYQPPVEDIK-------SIEITTENPIPTLEPK
STQKKTTKEINE-DNEEIIVLKKVNRK--YQKGKKDA---DKDSTVVVDYSKAKKIFQKK
D-----ETINGNSKKRKSFDPYNNDGDTDKVPRALKKRQTNTRGKNISYKR
>CAGL0E02585g
----------------------------------------MSSDSGDNVLKKVMETVRAS
NALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSIDNNNEKLDGTNENLEEVCKE
FSNVMDVLFEKADRSLDILNR--KSSTN-DNKKNMQFLDDVNVAENDPSRR--ISKPQLN
FKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQQPYEYEILNQEYNND
ILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLEHHDFRSYYGLVCLMQ
ISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWLQRDLGLYIVSLFDTF
HASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMAYARADTHFLLNIFDQ
MRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVAN--IFTPVEKESPWRTLMYQYN
IPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDPISVVSVSSVVTDH
VRRNSKTLANLIKKKLEEIKLGEV------KSINNRLPSSLDVSQDEL--QFLPSHKIEL
MTGAFKEIENQLT-----QATKSKQAMTSSVVLSEI-LLHPEH----AVKYH--NGSACS
VEESELKDRYLSYIKATLLA---A-SKNINMVLETSNSN---------APLETEETHNKK
SDQIQVIPEKQE-DMDEIVVLKKKKIH--SNDQKAKH-DDGDIVEEPVDYSKA-NILASD
N-----REVKKKDKKRV-FDPYSSTG---EGPKAAKKRRLVTKGKKISFKK
>KNAG0M01230
----------------------------------------MDSEEQKKLLSKAVGTVRAS
SSLVGQDVQFFSNLDANVASSVKELGNEVLEMINDILFSIDENSKPFAESAEQVGESWRD
FTNLTDNLFEKSDRSMDIIAQ--GTRKNGQAGSEVQYLDDLVGNDSSSGKR--ITKPQLH
FSRPVDNSESQPFKPLLTEKPNALKPLKESLQMVPATENIPSHYPNPYDYEISNQEYNND
ILETRAPIPSTPWHESEPVWVDSTEGLQSLLKDLKKYKELAIDLEHHDYRSYYGIVCLMQ
ISTRDTDYLVDTIALRDELHILNQVFTDPMVTKVFHGAFMDIIWLQRDLGLYIVSLFDTF
HASKALGFPKHSLAYLLETLANFKTSKKYQLADWRIRPLSKPMSVYARADTHFLLNIFDQ
MRNQLIKDNKLAGVLGESRKVAKRRFEYSKFRPKLAQPD--VFTPIEKESPWRTLMFQYN
VTPEKEELVKALYEWRDTIARRDDESPRYIMPNQLLISLSAYTPTDPVSLVSVNSYVTDC
VRSNSKVLANLIKSFVESSK----------LGPQSSYTPNTENTSTPFV---LTLSQIKD
IGMRFTKLTENFQ-----SSSCQKISPLQRSSFFGD-LSKGKV----TVSYN--DAKTTP
VSQSVLESRSKQFNEYMKAF---G-DIEYKIPSIVEPVM-----DLPIPSGTTSTESADS
KTVEKPPKNIKE-DMDEIVVLKKVKRE--LPKPKGND---EDAEREIVDYSKEDKVLVQR
Q---FDKKKKNNNNKKR-FDPFSAIS---EGPKAPKKRKAVTKGKNASFKR
>TPHA0J00370
-------------------------------------------MNADELLPLVVSSVRAA
SALAAQDVDFYRSLDKEIASSLTNTSQKVTDMINSIISSVDENSEGLVEGKENLDESWKD
IGNLLDSLFELADHSIDALSK--ASQKS-SNDPKMKYLNDSLNFESDNVTR--LSKPQLN
FSVPVDNSETHPFRPLLTDKPNAVVPLDEVLKIVDGTEDTPQHYPQPYETEIDKQEYNEQ
VLQFSDPIPSKVWEETEAIWVDNEESLAAMLNELKTATELAVDLEHHDFRSYYGITCLMQ
ISTRNTDYLVDTIALRDKLQVLNVVFTDPKITKILHGAFMDIIWLQRDLGLYIVSLFDTY
HASRALGFPRHSLAYLLERFAHFKTSKQYQLADWRTRPLSKAMNAYARADTHFLLNIFDQ
LRNMLIQEDKLASMLHESRKVAKRRFEYSKYKPTLPSSA--VFSPTESDMPWRSMIYQYN
IPSQKVELVKRLWEWRDTIARRDDESPRYIMPNQLIASLVEYVPTNPAGVISVNRMMTDP
VRSNAKAIANLIKSTLEDMKN---------NNISTTVVSTTAKDKETSS-NDLSTSQIKF
IVSQFENILEKYSSNNSNLNDVTSKEGKDSLVFSKI-FNSRDD----IITYD--KGTKHL
ITEQQLSDRQKEVDAAMKQA---E-EIAFSMEVQDTHKE-----SMKQPFPEPEEVISQS
HLPAFEDKEEQE-DLDEIIVLKDTKDR--RNRQHRGRGRSADSDHTVIDYSKGDKILSQD
N-------RRRTPNKRK-YDPFSADNNE-NALQGAKRRRPTAKNRNVSFKR
>ZYRO0C07678g
----------------------------------------MAEESNEQLLPKVVGTVRAA
AALAAQDVDFYRSLDKGVAKSLDKTSNELVSMINSTLLCIDQNSRLLEGGKEKLEDSRKD
FSNLMDNLFEKSDRSLDIL-R--GRAPD-RKGAALMYLDDAARSDMIPAKR--ILKPQVR
FQRPIDNTETHPFKPLLENKPHALRPLSDCVRLVQADEDIPEHYPQPYEYEIENQEYNES
ILKIAEPIPSKPWDGSEPVWVDNKESLDSMLQDLKKSTEIAVDLEHHDYRSYYGIVCLMQ
VSTRQTDYLVDTLALRDDLVVLNEVFANPLIVKVFHGAFMDIIWLQRDLGLYIVSLFDTY
HASRALGFPRHSLAYLLETFASFKTSKKYQLADWRVRPLSKAMSAYARADTHFLLNIYDQ
LRNKLIIENKLAGVLAESRNVAKRSFQYSKYRPKVPNSS--VYSPVDRADGWKVLMNQYN
IPLEKEILVKNLYEWRDTIARRDDESPRYVMPNQLLAYLVDYTPLDPTGVISVSPTVTDH
VRTNAKALANLIVKSLQQIAD---------AGSDIKVESVQHKDQHDLS-QVLTVGQIES
QVSQFHDLSKAFK---GLSQGTNSSNSSSSIIFGNI-LHAPCG----FVGYG--RSLKKP
VTDKQIEKRKLELSEALEFI---DAETATTIQEEDRGSEL----THEPADDKKVSENDES
KKEEAKETEPEE-DKNEIITLKKVKDR--GKKSKRSN---ESEPEEPIDYKKSKKILETE
K-------KSKSTKKRA-FDPYAASNDAGNAPK-PKKKRRMARGKSASFKR
>TDEL0G04440
----------------------------------------MPPAEEDQLLRKVVDTIRAS
SALAAQDVDFHRSLSRPIGKSLDETSTRMVSLINSLLSSIDQNSEPLVEGKETLNEYWKD
FSNMMDNLFELSDCSADILTR--APGSR-KDGEKLKFLDNSSSNDSIPSKR--ISKPQLN
FKNPVNNTEIQPFVPLLKEKPFALRPL--ISDIVPGNDAVPEHYAQPYEYEIEHQEYGES
VIVKSEPIPSKPWETTEALWVDNIEVLKTMISDLKSVTEIAVDLEHHDYRSYYGIVCLMQ
ISTRERDYLIDTIALRDDLQILNEVFANPKILKVFHGAFMDIIWLQRDLGLYVVSLFDTF
HASRAIGLPRHSLAYLLEKFANFKTSKKYQLADWRLRPLSKAMNAYARADTHFLLNIYDQ
LRNTLIEQNKLAGVLAESRNVAKRRFEYSKFRPIAPSPT--VYCPIDKPDPWKVLMFQYS
ISPNREELVKKLYDWRDTIARRDDESPRYVMPNQLLVELARQAPTEPINVISVNSIVTDH
VRSNSLVLAHLIKNTLASSDK---------ESDKGTFEADNNSTDAA---SLLTVPQIQK
LAACFAGVSRAFT-----ILQNEYKDGRSSSIFTDI-LTSEDD----AVNYV--GNNMDH
ITKKELGKRAAKALQSMEQF---DEATSYYMPIPEIAKE-----SNTMEEIRPPAPEEVK
ESPSPP----KE-DMDEIITLKKIKKQ--KSQSPKEL-GISEREIPAVDYTKTKKVLATN
Q------DKNKDKKKRK-FDPYAASNHSSDAPRAPKKRKPVNRERNVSFKR
>YOR001W
----------------------------------------MTSENPDVLLSRVINVVRAA
SSLASQDVDFYKNLDRGFSKDLKSKADKLADMANEIILSIDEHHESFELKEEDISDLWNN
FGNIMDNLLEMSDHSLDKLNC--AINSK-SRGSDLQYLGEFSGKNFSPTKR--VEKPQLK
FKSPIDNSESHPFIPLLKEKPNALKPLSESLRLVDDDENNPSHYPHPYEYEIDHQEYSPE
ILQIREEIPSKSWDDSVPIWVDTSTELESMLEDLKNTKEIAVDLEHHDYRSYYGIVCLMQ
ISTRERDYLVDTLKLRENLHILNEVFTNPSIVKVFHGAFMDIIWLQRDLGLYVVGLFDTY
HASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTAYARADTHFLLNIYDQ
LRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPLTPSSE--VYSPIEKESPWKILMYQYN
IPPEREVLVRELYQWRDLIARRDDESPRFVMPNQLLAALVAYTPTDVIGVVSLTNGVTEH
VRQNAKLLANLIRDALRNIKN---------TNEEATPIPSSETKADGILLETISVPQIRD
VMERFSVLCNSNI-----SKSRAKPVTNSSILLGKI-LPREEH----DIAYS-KDGLPNK
VKTEDIRIRAQNFKSALANL---E-DIIFEIEKPLVV-------PVKLEEIKTVDPASAP
NHSPEI-----D-NLDDLVVLKKKNIQ--KKQPAKEK---GVTEKDAVDYSKIPNILSNK
P-----GQNNRQQKKRR-FDPSSSDS---NGPRAAKKRRPAAKGKNLSFKR
>Smik_15.170
MLINNIRPSENFSLVTLFMYFKDRYEERRLNNQKAPTPYVMASQNPDVLLSKVVNVIRAA
SSLAGQDVDFYKNLDREFGKVLKSKSDKLADMANEIILSIDEHHESFELKDEDISGLWND
FGNIMDNLLEMSDHSLDKLNR--AVTSK-PNGADLQYLGDFSEKNLSPAKR--VEKPQLK
FKTPIDNSESHPFIPLLKEKPNALKPLSDSLRLIEEDDNTPSHYPHPYEYEIDHQEYGSN
ILQIRKEIPSKSWNDSEPIWIDTMPKLESMLEELKNVQEIAVDLEHHDYRSYYGIVCLMQ
ISTREKDYLVDTLELRETLHILNEVFTDPSIVKVFHGAFMDIIWLQRDLGLYVVGLFDTY
HASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMIAYARADTHFLLNIYDQ
LRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPRIPSSE--VYSPIEKEAPWRVLMYQYN
ITSEKEELVKDLYQWRDVIARRDDESPRFVMPNQLLAALVAYTPIDVIGVISLTNGITEH
VRQNAKVLVNLIKNSLRHIKD---------TYKEDSPVTFSESMTNEVSLEAITIPQIRD
IMERFSVLSNSNV-----SNCRAKNGATPSILLGRI-LPLEEN----DIAYK-NNGLPNR
VKFEDIRARAQSFNSALSNL---E-DCMLEVEKPHIL-------PTNVKKIERINTEDVP
KHSATI-----E-NPDDIVVLKKKNIH--RTQSMNAK---DTMGEKAIDYSKIPNVLSSK
S-----DQNRRQQKKRR-SDPLFNDS---DGPRAAKKKRPATRGRNVSFKR
>Skud_15.162
----------------------------------------MPSENPDVLFSKIVKVVRAA
SSLASQDVDFYKNLEREFSNVLKSKSDKLTDMVNEIILSIDEHHESFELKEDEISGLWKD
FGNIMDNLLEMSDHSLDKLNH--TANSK-VSGAELQYLGDFSGKDSLSTKR--LEKPQLK
FKKSIDNSESHPFIPLLKEKPNALKPLSESLRLAEAEENNPSHYLHPYAYEIDHQEYSSD
VLQIKKEIPSKSWDDSEPIWIDTKTKLGLMLEDLKNASEIAVDLEHHDYRSYYGIVCLMQ
VSTRERDYLVDTIELRDALHILNEVFTDPLIVKVFHGAFMDIIWLQRDLGLYVVGLFDTY
HASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRARPLSKPMTAYARADTHFLLNIYDQ
LRNKLIESNKLAGVLYESRNVAKRRFEYSKHRPRTPSSE--VYSPIEKENPWRVLMYQYN
ITSEKEELVKDLYLWRDFIARRDDESPRFVMPNQLLAALVAYAPIDVIGVVSLTNGVTEH
VRQNAKVLANLIENALGNIKD---------TNKKTTSITSSESKPDGISLEVITISQIRD
IMERFSLLSNSGV----INNRTKTGDSTSSILLGKT-LPFEEC----GISYG-KKGTPNK
VKVEDIKARAQKFNSALAGL---E-NIMFELEKPVTV-------PASVEKGEAVEIESAP
ELPSKA-----E-SFDDIIVLKKKKMH--KKQPAKGK---DMTVKEAVDYSKMPSVLSSK
P-----GQNRKQQRKRR-FDPSSNDS---EGPRAAKKKRPAPRGKNMSFKR
>Suva_15.176
----------------------MGHEDQTANSQDVSNKYAMASENSDVLLSKVVNVIRAA
SSLAAQDVDFYRNLDRDFSKILQSKSSKLTEMVNGIVLSIDEHHDSLELKEEEISDLWKD
FGNIMDNLLEKSDHSLDNLNR--TSNSN-NSAADLQYLGDFSGKDSQPTKR--VEKPQLK
FKTPIDNSESHPFIPLLKEKPNALKPLSDSLRMIETEENSPGHYPHPYEYEIDHQEYNPN
ILQIKPEIPSKPWDASEPIWINSKATLKSMLEDLKNAHEIAVDLEHHDYRSYYGVVCLMQ
VSTRERDYLVDTLELREDLHILNEVFTNPSIVKVFHGAFMDIIWLQRDLGLYVVGLFDTY
HASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTAYARADTHFLLNIYDQ
LRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPITPSSK--VYSPTEKENPWRVLMYQYN
IAPEREELVKDLYEWRDVIARRDDESPRFIMPNQLLAALVAYTPIDVIGVVSLSNGVTDH
VRQNAKILANLIKSALRSMKD---------THKESAEIVSSKFKSASL--EAITVSQIRD
IMDRFSVFSSNSV-----TEDRSMDSTASSILFGKI-LPYEEG----DIVYE-DSGLPHK
VKVEDMRDRAQRFNSALVGL---E-DIKFEVEK-----------PVNVEKSEMVKIETTP
EPPTKI-----E-DPDEVVVLKKKRIH--KKQVAKRS---DVAAEEAVDYSKIPNVLSSK
P-----GQNNKQQRKRR-FDPSFNDS---EGPRAPKKKRPTTRGKNVSFKR
>NDAI0D00850
---------------------MSSSSIDQTGTPPTAAGANEKQSPKDQLLPQVVQTVRAS
VALAAQDVDFYRSMDKTTAKTLKETTSQLADMINSVLLAVDENSETLDGTKENLEDNWKD
FSNLMDNLLEKSDRSMDMLLR--SKNTN-TNNSNMQYLDEYSGRDDTSSKRRAIGKPQLE
FDVPVDNTETHPFIPLLKSKPNALKSLDESIQLLPVDENVPEHYAQPYEYEIDNQPYNDK
ILQLSDPIPSQPWMETTAIWVDTPESLQSMIKDLNNCTEFAVDLEHHDYRTYYGIVCLMQ
ISTRTQDYIVDTLKLRSHLQPLNEPFTNPQITKVLHGAFMDIIWLQRDLGLYIVSLFDTF
HASRALGFPKNSLAYLLEKFSNFKTSKKYQMADWRIRPLSKAMNSYARSDTHFLLNIFDQ
MRNKLVQDGKLAGVLKESRNVAKRRFEYVKYRPLITSSA--VYSPIEKIDPWKTLMYQYN
IPLAKELLLKELYQWRDKIARRDDESPRYIMPNQLLVSLVAYAPVEPAGVVSVSNMVTDH
VRSNSKILANLIKNCLTKIKDTTDADSLILQQEQNQPGTSTTTTNVDLS-EQLSIHQLNT
LKSQFLSLYSKVNHIEGVTNNARNAEKKNSFLLCTDHMSFNDEDGKNFIKYSVSPDKKDK
ITTEELLKREEMFDQAMEQL---Q-QVEYSIPIPENEIV-----VVESEQQEPSIPAANA
EITTAVASRKKE-DLDEIIVLKKTNRNKGKKRERKHSDDDDEGEIEVIDYSKMEKVLDNS
NTKRNQNKNNNGNKRKR-FDPYNVNN---EGPRAPKKRKAMTRGKNVSFKR
>NCAS0H00860
-------------------------------------MSEQSQEQEKTLLPKVVNTVRAA
SALAAQDVDFYRSIDKDIAHSLEQSSNQIADMINSVLLSIDENSEQVDGTKENLEDIWKD
FGNLMDNLFEKSDRSIDIITR--GHGGS-NGQSGMQYIDEFSGRDLTPGKQ--ILKPQLK
FTTPIDNTESHPFIPLLKEKPFALKPLEESMQMIPEDETSPMHYPQPYEYEIDHQEYNDL
ILQKKDPIPSTSWTDNEPIWVDTVSQLQSIMPDLEASTEIAVDLEHHDYRTYYGITCLMQ
ISTRKNDYLIDTLALREDLQILNNVFANPMITKVFHGAFMDIIWLQRDLGLYVVGLFDTF
HASRAMGLPKHSLAYLLEKFAQFKTSKKYQLADWRIRPLSKAMHAYARADTHFLLNIFDQ
MRNSLIEQNKLAGVLKESRNVAKRRFEYSSFRPKVLQTNGLVYSPIEKDDPWKTIMFQYN
IPPQKEPLLKELYQWRDKIARRDDESPRFVMPNQLLVSLVAYTPIDAPGVVSVSNSVTDY
VRSNSKILANLIKNCLAKMKDNKFLD----NNVAEEGISVVPETGHDLS-QKLTIHQLQN
LKSKFQLLSDKFN----NSVKTRLSNHDQLYLFDGI-SFADDV----TIKYF--ADGKIQ
TTAEQYKERSEQFDDAMKQL---E-EVEYCIPVIEENKQ-----TQDQDNIPPITVATNA
EGQVNEMIEKPE-DLDEVIVLRKTNKN--KSIKNKPK-NREEPELEIIDYFKTAKVLTND
K-NSRGGRNNNGNKRKR-FDPYSAAN---EGPAAPKKRKNVTRGKNVSFKR
>KAFR0G02660
----------------------------------------MLLEEQKKLLSDVVNTVRAS
STLAAQDVDFYRSLDSEVSHSINEVTDELNDMVNSIILSIDENYETLDEGKEELTESWKS
LSNIVDNLFEKSDRSLDILKT--GAKKK-PTNPPFEYFENATTTENIPQKR--INKPQLK
FVPPIDNSESHPFIPLLKEKPNALKTIDESTKLINSDENVPEHYAHPYEYEIDNQPYNDS
ILQVREPIPSKSWSETEGVWVDNVESLNHMLNDIKKYTEIAIDLEHHDYRTYYGIVCLMQ
ISTRETDYLVDTIALRNDLKVLNEVFTDPSVVKVLHGAFMDIIWLQRDLGLYIVSLFDTF
HASRALGFPRHSLAYLLEEFANFKTSKKYQLADWRVRPLSKAMTAYARADTHFLLNIYDQ
LRNRLVETNKLVGVLNESRNVAKRRFEYSKFRPRVPSPN--VYSALEKEDPWRTLMFQYN
IPSEREDLLKGLFEWRDMIARRDDESPRYIMPNQLMVTLVAYTPTDPAGVISASQVVTDY
VRSNSKIIANLIKNALTRAKD---------QNRQLQFVADNHTRESYRSTDKMTVSQIKE
TASVFIQIAEKLG---TCNNDQQQSKSFARSNYFGS-LSKKLD----IIEYK--NGEKHS
VKQQQLVSRFNTYTKQVNEL---T-NVRYELPVH----------KEPPQLQKDDVEEVKK
TIIADSIPAKPEIDLDEVVVLKKVNRQ--PNKTKLEE----NEKIDFIDYSKSEKILKGD
K-----QRKKRESKKRQ-FDPFAASN---EGPKAARKRKSGTRGRNLSYK-
>Kpol_1037.29
----------------------------------------MSEDINKELLSSVVSTVRAA
SSLAAQDVDFYRNLDKEISTSLNESSKEITNMINTLLLSINENNEELESGKEGLEQYWKD
FSNVMDNLFEKSDRSLDIITR--SKTSN-DNKSEFQYLSDSAQSDSNPSKR--VTKPQLQ
FSRPVDNSESKPFMPLLNDKPHSIKSFTDSLIIIPESEELPSHYAHPYEVEIDKQEYNAS
VLQVAEPLKSQPWN-SESTWVDTSEALQSMLDKLKECTEIAVDLEHHDYRSYYGIVCLMQ
ISTRKEDFLVDTLALRDELHILNEVFADPNILKVLHGAFMDIIWLQRDLGLYVVSLFDTY
HASRALGFPRHSLAYLLEKYANFKTSKKYQLADWRVRPLSKPMHAYARADTHFLLNIYDQ
IRNQLIRENKLAEVLFESRNVAKRRFEYSRFRPKVPSPA--VFTPIEKEEPWRTLVYQYN
VPSTKIELLKRIWEWRDMIARRDDESPRYIMPNQLMISLVEYTPIDPAGVISVSNVMTDH
VRSNSKVIANLIKKSLEDMKSVP-------AGALTAFQNIDYKIGQKFASDKLTISQIQN
MTALFKEIASNPS-----IIEKDVSKKIDPILFSNI-FLSKNE----IVLYD--HDKRHV
VTNEQLAGRAEEVEGFMNEA---N-NTTLAINIESSAEMHVEEPEAKEKNALFSPPISNV
ENASSSNTDGFE-DMNDIIVLKDVKKR--TNIKDHKK-KQGMPNKEVIDYSKLDTILSKE
K--------RENSKKRK-GDPFGEENGL-EGPKAAKKRKQINRGKNVSFKR
>KLTH0C11066g
-------------------------------------MAQAHGSEDGSVLNQVIATIRAS
SAVTAQDVSFYKNLDPSIATSVNNISARLLGLINDILLSVDENNDIIEQGSEGLESAWSN
VGEVMDLLFEKSEHALAAGEK---RDNG-ELSKTVQYLDDSPSLHDGAPKK--ILKPQLL
FKRPIDNSESHPFKPLLKKKPHALRSLDESLRLTAEQEDVPAHYPQPYEYEIDHQEYNES
VLQISEPVPSLPWDETEAEWVDNTDALKLMLNELLLANEIAIDLEHHDYRTYYGITCLMQ
ISTREKDWLIDTIALRDDLWILNEVFTDPKITKVLHGAFMDIIWLQRDLGLYIVSLFDTY
HASRLLGSPKHSLAYLLERYAHFKTSKKYQLSDWRVRPLPKALKAYARADTHFLLNIYDN
MRNSLIEQNKLSQVLHDSRNVAKRRFEFTTFRPKIVTSH--VFSPIEREDPWRTLMFQYN
IPQSKSLLVRRLYEWRDMVARRDDESPRYVIPNQLLVSLAVNAPTTPALIMATSTFVTEH
IRQNAKSLALLIKKSLES------------SSNEFGQLLNSANTVQNSSPTKMSSEDIEK
NSRMFEKFLEDFS----YEKAADCGISLGSSLFQKK-FVPCEE----YVSYQ--ESRASL
VDHNSLENRRHQVSKKYEA------ERDIARPQVHIRA------ASSHAVCDKEAGAEDN
ESAEEENKARKE-EMDEVIVLKQRKTL--ADKEQRAV-DKATPSIEPLDLQSARKILEAP
S-------NNVRRPKKR-FDPYATLA---AGPPSVKKRKK-TKGLQKSFRG
>Kwal_56.22447
-------------------------------------MAKTQEDKRSSILTQVVGTIRAS
SAISAQDVDFYKSLDSTISESLDETSAKLLSLINDVVISIDDNNDLIEPGRAGLENSWNN
IGEVMDLLFEKSEHALAAMKK---KGSN-IIGNNLQYLDDSQPLTDTTLTK--ITKPQAS
FSRPVDNTESHPFKPLLVQKPNALRPLDDVLQLTVEEEGIPAHYPHPYEYEIDHQEYDES
VLEIRPPIPSKPWEETDATWVDNLGTLNDMIRELSKAKELAIDLEHHDYRTYYGITCLMQ
ISTRENDWLVDTIALRDHLWVLNEIFTNPKVIKVFHGAFMDVIWLQRDLGLYLVSLFDTF
HASRLLGFPKHSLAYLLERYAHFKTSKKYQLADWRIRPLSKPLKAYARADTHFLLNIYDQ
MRNSLIEQGKLAQSLHNSRGVAKRRFEYTKFRPTVMTSE--VYSPVEREDPWRSLIFHYN
IPQSKSFLLKRLYEWRDTIARRDDESPRYVMPNQLLVALVMNAPTDTYGLLSVTSFVTEH
VRSNAKSLSQLIKKTLASPQD---------LFTDQINHMDSNKSMVD---SKLSPGDVKA
NHQNFDQYTRKSR----ELVIHGPTVVRGCSLFPGK-PLPNEA----YVSYQ--GTQVHH
IEPTVLDDRRELVAQNITTT---A-NVTEKLQVAVEK-------TPAPEVSDELDEGEAK
ELSDDTVSQLKE-DKDEIVVLKRRKAL--PQSSSPPK-NAEGNPKEILDFKNNKKIMTAT
A-------SVPRKSTKR-FDPYAIQA---SGPDGVKRRKK-TRGIQKSFK-
>Ecym_3030
----------------------------------------MSSDNKDALLTKILGTVRAA
SSLAAQDIDFCRHLDASVGELLDETSQYIVSLLNEVILSTSKANNDLEVGKDNLEAAWKD
LSNIIDNLFEKSDHSLDVLQKLLSSSSS-QLDTNMQYLNVDSQRDGKLSQR--IVKPQLQ
FKIPVDNSECHPFKPLLKVKPHALKPLEEVSSLTVETECVPAHYPHPYEYEIDNQPYDDS
VLTIKEPIEPSNWDENEPIWVDNITALNDMLNGLKNVKEIAVDLEHHDYRSYYGLVCLMQ
ISTRESDWLVDTIALRQDLQVLNEIFTDPSILKVFHGAFMDIIWLQRDLGLYVVSLFDTY
HASRALGFPKHSLAYLLETFANFKTSKKYQLADWRIRPLSKPMKTYARADTHFLLNIYDK
LRNSLIKEDKLSGVLHASRNVAKRRFEYTSFRPKVLSPT--VFSPIEKDDPWRTLMSQYN
VPDIKEPLMRKLYKWRDMVARKDDESVRYVMPNQLLVSLVTLAPSDPSGLLTVKSYIPDH
VRANARVLCNIINKTMEEIKS---------GSHEGQSIENVTTTYVSAQDPEMSVSLIKT
MDRHFKFLLDEVQ----SHAVEPSSVCEDSLLFKGF-LFDKPK----AVAYN--SVGKRL
VNDRELLDRKSDLSQKFSKVFKAA-GIAIGSHIEKLSSN-----SELPADTTSNVESPSK
EESKNNSDDLKE-DKHEIIVLKRKRDY--GSNTKSTS---KQPKKEHVDYNNVNSILDNT
S-QQDKPNSGRHVDKRK-FHSDLQGS---IGAAAIKKPR--SKGKTVSYKK
>ACL001C
----------------------------------------MASTDEDPLFKRIVSTIRAA
AALSAQDIDFYRSLHPSVGQELDDTSATVVSLINELLLSVDENNNELKPGRDNFEDSWKE
LSNVMDNIFEKSDHAFDSIKH--GSSSR-NEGVNMQYLADSSHDDSTPSKR--IEKPQLL
FKTPVDNTELHPFKPLLKEKPHALKPLEESLMLAPEEENVPAHYPHPYEYEIDKQPYNDS
VLEVRERIDPQPWEATEPIWVDNVESLSQMLDELKEVKELAVDLEHHDYRSYYGIVCLMQ
ISSRSKDWLVDTIALRDDLHVLNVILPDPTVVKVFHGAFMDMIWLQRDLGLYVVSLFDTY
HASRALGFPKHSLAYLLETFAKFKTSKKYQLADWRVRPLPKPLRDYARSDTHFLLSIYDD
LRNALVKAGKLAEVLNASRNVAKRRFEYTSFRPRIPDSN--VYSPIESTEPWRKLMYQYN
LPPSKEPLLKKLYEWRDTVARRDDESVRYVMPNQLLVSLVSLSPSETAGVLSVSTYVTDY
VRSNARTLANLIKRTLETIKA---------GTASVAEFSSSERALSNPA-ATLSLHMIQN
LDDHFRSLLMEAQ----KQSGSICSQHSSSLLFNSD-LATGPS----AVEYT--NGQKHV
IGDNVLQTRKHALLQKFTSQ---PVEPVTDIEAPSHQSS-----SENPQVSEDISPSEPQ
ESQNEVQKDEPDFEKSEIVVLRKKKKA--HAQKPKGT---SSSPTETVDYSNAKEVLGKG
TSSTAKRGDKDRPRKRK-FDPYGQDN---NAPSGVKKKNKPSKGKSISFK-
>KLLA0D01309g
----------------------------------------MSSEDKDTLLSSLVQTVRSS
SALAAQDIDFYKSLDSNINASLEDTSTNILSLINDLLLSIDPNNDVIQQGKDSFVDSWKS
ISNIMDNLFEKSDHALDNIRA--GNGGN-AGGPSLKYLNDDDRSNNKPSKR--IEKPQLS
FKTPVDNTELHPFKPLLEYKPHSLQPFEISLKMVPEEESIPSHYPHPYEYEIDHQKYNDS
ILVATEPIPSKDWDETEAIWVDTVEGLNKMKDELSKATELAIDLEHHDYRSYYGIVCLMQ
ISDREHDWIVDTIALREELYILNDIFTDPNVTKVLHGAFMDIIWLQRDLGLYIVGLFDTY
HASRMLGFPKHSLAYLLERFANFKTSKKYQLADWRIRPLTKPMLAYARADTHFLLNIFDK
LRNSLLEQNKMSDVLHESRKVAKRRFEYSSFRPKVPSSA--VFSPIEKDEPWKNIMFQYN
IPASKELLLRRLYEWRDTIARRDDESPRYVMPNQLLVSLVAGAPTEPINVLSVSSYVSEH
LRTNSKVIANLIKRTLEDLKGNS-------NSSAIPLLESAESNGTDLA-NIITTSQIKS
IQNIFHSLASEIN----SQKLNNEQNSEKSVLFNGISNLDVNT----AVRYT--PKTRTL
IPQHELLKRQHEITRTLEQEYTDRQAQSIVLPSNE---------DEAPTQVSNDENRNEV
ITSDPSQEEIEE-NKDEVITLRKRQSQ--SNNKRKTI--SPPASHEIMDYAAGSDLLNST
K----NNTNSQKHKKRR-FDPYSVEH---VGPQPIKKKSKPAKGKNVSFKR
>SAKL0E01452g
----------------------------------------MSSDKPDKLLSNLVGTVRAA
SALSAQDLDFFKSLDSGISKSVEGSSSKLLNLINEVLLSIDENNDTIEYGKDNFQESWKD
IGDIMDNLFEKSDHAFDALKR---NSIN-QGNSNVQYLDDSSRSNLNPSKR--IEKPQLN
FKTPIDNTESHPFKPLLENKPHALRPLSEILKQTPETENIPSHYPHPYGYEIDTQEYNES
ILQIRDPIPSQPWEDTDPVWVDTKESLQKLLNELRSAKEIAVDLEHHDYRSYYGIVCLMQ
ISTRERDWLVDTIALREELHVLNEIFTDPSVLKVFHGAFMDIIWLQRDLGIYVVSLFDTY
HASRSLGLPRHSLAYLLEKFAQFKTSKKYQLADWRIRPLTKPMRAYARADTHFLLNIYDQ
LRNSLIEQNKLAAVLHDSRNVAKRRFEYTSFRPKIVSAD--VFSPIEKDEPWRNLMYQYN
IPLSREPLMRKLYEWRDTIARRDDESPRYVMPNQLLVSLVAIAPTDPAGVLSVSNFITDY
VRSNSKMLSNLIKKTLESLKN---------GDVSTNNAGSSQLEEKDLS-QVLSISQIQN
MCLQFNSLASKVK----KANSATNSMPKVSILFDGDHIFSNDR----AVLYS--KNSKIV
IDENQLQERKLEVSEKLKEV---Q-EPDFRLHVNVTTKE-----TDEVSKDVSEKDDVNR
ASETDP---LET-NKDEIIVLKKKKRH--EPQDRKKV--GNSTDVEPMDYKNAEKLLGNS
K-----KSSKQKTTKRR-FDPYTSEN---VGPQSAKKRKKPTPGKNMSFKN