MUSCLE (3.8) multiple sequence alignment

NDAI0C02640        MQGSSYRDESKPDNNICQDSNINVNKTSNTSSDTPSTQSHSTPNVITDAENPKHVKITLP
NCAS0D02150        -----------------MDIGNSLLTKDGSKESTAESPMTSKI-----------QVIEVP
TBLA0A07160        ------------------------------MGPSSGEEA---------------QLVVLD
TPHA0J00380        -----------MAEHLTFKTNNIPNICNNTNHNDSDNNNDENI-----------ETIMLP
Kpol_1037.30       MKKEILSKQFKSIDNSMHRSGNQGENNNSKNVSNENKIEIENI-----------ETITLP
Suva_15.174        -------------------MESPAREHSEDTQEDQSI-----------------PKIILP
Smik_15.169        -------------------MESTVGDLSENMHEDQGI-----------------QKVILP
YOL001W            -------------------MESTSGERSENIHEDQGI-----------------PKVILP
Skud_15.161        -------------------METSVREHSEGIHEHQGI-----------------PKVILP
CAGL0E02541g       -----------------------MTPQDAQINTDEEI-----------------PTIKLP
KLLA0D01287g       ------------------------MESMNTIDPQKGSNIG--------------QIIPLP
ZYRO0C07634g       ---MYDNDRVAPSVFTAPNAVVNVGNNNVQGPPTTGIRIDNVNDV---------PTVILP
ACR001C            -------------------------MSVQTSHETSESV----------------TEMELP
Ecym_3029          -------------------MSDTGNNSNVEVENRKAQPV---------------PEFRLP
TDEL0G04430        -------------MQAIEDAEVTVAARDKPIPSESSKEGTDEI-----------STIYLP
KNAG0I01750        ------------------MAEGGVAKQANRNEETTGCEI---------------QTVSLP
SAKL0E01408g       ----------MSAEELTANGSAGSATIASTSKNSSNSTPVEQRQCLTQAPEQTSSQIMLP
KLTH0C11110g       -----------MSDKESGGASAKHPDLTEDTKPDTGEDPV--------------PEVALP
Kwal_56.22443      ---------------MSDKESGCLSAKNPGSPKSPGERLEEAPV----------PEVALP
                                                                           . : 

NDAI0C02640        IKFMECPRRDLVVLISRMLVTLIKINDTKANDNNL-------------------PSNYAT
NCAS0D02150        YEYIKCSRSDLVVLVSRMLVLLIQSNDMTSNTSNS----------------SSDSNMHLT
TBLA0A07160        QNFMKCSKIDLITLISRMLSFFIDINDSHNIHGNV--------------TNNRLSPLFLT
TPHA0J00380        TSFLKCSRSDLVVLISRMLTFLIQINDRNEILTEN--NSAMIPTQTDVNNKNNNNMINLT
Kpol_1037.30       PKFIDCSRSDLVALIARMLSFLIEMNDNDPANTNY-----------LNEEPNNRSVMNLT
Suva_15.174        SEFKKCSRTDLVVLISRMLVSLIAINENSST-KRP------------------DDQITLT
Smik_15.169        TDFNKCSRTDLVVLISRMLVSLIAINENSVS-KIP------------------ENQITLT
YOL001W            ADFNKCSRTDLVVLISRMLVSLIAINENSAT-KKS------------------DDQITLT
Skud_15.161        AEFYKCSRTDLVVLISRMLVSLIAINENSTT-KKP------------------DDQITLT
CAGL0E02541g       RDFLKCPKGDLVILIARMLQFIIQINDSNIKEN--------------------ERKYGLT
KLLA0D01287g       EEYLRCSRTHLVVIISRMLSFLIQINDANNA---------------------GNQTMELT
ZYRO0C07634g       KRFSECSRTDLVILISRMLTFLIQMNDSSST-SAL------------------DSVTNLT
ACR001C            RQFLSCSRTYLVVLISRMLTSLIGMNDAQGDKSKP---------------------IKLT
Ecym_3029          RKFLDCSRTHLVVLISRMLSSLIRLNDAYTE----------------------SNTLQLT
TDEL0G04430        RKFSKCSRTDLAVLISRMLTFLIQINDSLAL-SKP------------------ENARGLT
KNAG0I01750        SNFSLCSRYDLIALISRMLVFLIQINDDAAQ-KKTGLADSGKGEATDAADTDGSSETKLT
SAKL0E01408g       DEFLKCSRTALVVLISRMLSSLIQMNDSMCK----------------------DKNLKLT
KLTH0C11110g       NDFSQCPRTDLVILISRMLSFLIRINDSIPK----------------------DNSSELT
Kwal_56.22443      EDFSQCSRTDLVILISRMLSFLTRINDSVPK----------------------DDAKELT
                     :  *..  *  :::***  :   *:                                *

NDAI0C02640        RFHSRVIPGISIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFNSLTAHRFILT
NCAS0D02150        RFHSRIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFTAAYPTFTFNSLTAHRFLLT
TBLA0A07160        RFHSKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLNSLTVHRYLLT
TPHA0J00380        RFHSRVPPNISVNNYLIRLTKYASLEHSVLLSSLYYIDLLSSVYPEFKINSLTVHRFLLA
Kpol_1037.30       RFHSRVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKINSLTVHRFLLT
Suva_15.174        RYHSKIPPNISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLNSLTAHRFLLT
Smik_15.169        RYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRFLLT
YOL001W            RYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLNSLTAHRFLLT
Skud_15.161        RYHSKVPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRFLLT
CAGL0E02541g       RFHSKIAPNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPAFNLNSLTAHRFLLT
KLLA0D01287g       RFHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLNSLTVHRFLLT
ZYRO0C07634g       KFHSKVPPGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPTFTLNSLTVHRFLLT
ACR001C            RFHSRVPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLDSLTVHRFLLT
Ecym_3029          RFHSRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPEFRLDSLTVHRFLLT
TDEL0G04430        RFHSRVPPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYPVFTLSSLTVHRFLLT
KNAG0I01750        RFHSSVPPPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPAFTINSLTVHRFLLT
SAKL0E01408g       RFHSRVPPGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLNSLTVHRFLLT
KLTH0C11110g       RFHSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMYTAFSLNSLTVHRFLLT
Kwal_56.22443      RFHSRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYPSFSLNSLTVHRFLLT
                   .:**   * *:: :*: **:.:. :: .**:: :*****.   :. * :.***.**::*:

NDAI0C02640        AVIVASKSLCDSCLSITHYAKYGGVQPNELLMLEAYFLKLIKYRVLPRDKNTDLCSMEYH
NCAS0D02150        AITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRIIPRSSNVTLIKLERG
TBLA0A07160        ATTIASKGLCDSFCTNSHYAKVGGIRCNELNVLETEFLERVRYRVIPRDNTIKLCKLEYK
TPHA0J00380        ATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRIIPRDDNIKLCKLEKK
Kpol_1037.30       ATTIASKGLCDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRIIPRDDNIKLCKIEHQ
Suva_15.174        ATTVAAKGLCDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRILPRDHNITLCSIEQK
Smik_15.169        ATTIATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNIMLCSIEQK
YOL001W            ATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQK
Skud_15.161        ATTVAAKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQK
CAGL0E02541g       ATTIASKGLCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRIIPRDNNITFCKMEVQ
KLLA0D01287g       ATTIASKGLCDSFCTNTHYSKVGGVQCSELNILENEFLERVRYRIIPRDDNIENCKIEQK
ZYRO0C07634g       ATTVASKGLCDSFCTNTHYAKVGGVHCSELNVLECELLRRINYRIIPRDDNIAWCNLESQ
ACR001C            ATTVASKGLCDSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRILPRDDNIRRCSLERQ
Ecym_3029          ATTVASKGLCDSFCTNTHYAKVGGVQCNELNVLENEFLTRVNYRILPRDENIKRCSREHQ
TDEL0G04430        ATTVASKGLCDSFCTNTHYAKVGGVHSSELNILECEFLKRVNYRILPRDDNIDWCKLETK
KNAG0I01750        ATTVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKKINYRVLPRDDNITWCKYEHR
SAKL0E01408g       ATTVASKGLSDSFCTNVHYAKVGGVQCSELNVLETEFLKRVNYRIIPRDDNIFNCKEEYQ
KLTH0C11110g       ATTVGSKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKRVNYRILPRDDNILNCKAERR
Kwal_56.22443      ATTVASKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKKVNYRILPRDDNISNCKAEKK
                   *  :. *.*.**  :  :*:* **:.  ** :**  :*  :.**::**. .    . *  

NDAI0C02640        FDTFALNDG--QIKESGTSFSYRQLPHSGYNVLHMYYRRIIDIIGVQRPISPSPDAVTVD
NCAS0D02150        NQVFTLDHL-DMKDPKLSFLSYDYLPDNGYSVLNIYYQNIVRITG---A--SSDLLFKRV
TBLA0A07160        YSPI--------EDINNDIHIPDELQNSGYNVLSTYYNKMVQLVG---NCKSSKNSFRNV
TPHA0J00380        SSQFTLDLG---DLLAANIQPELTHPNSGYNVLNIYYRKMVQIVG---LLKNSTDKSKKV
Kpol_1037.30       QNKFTMDFS---DLSMVGMTVQSNHQNSGFNILDIYYHKIVQLVG---SFSASSDKSRKA
Suva_15.174        QKTFVIDKN-ALGSVDLGSYSYANRSKSGYNVLDKYYQRIVQLVG---SFDASPDKSRRV
Smik_15.169        QKKFVIDKN-ALGSFDLDSYSYTDRPKSGYNVLDKYYRRIVQLVG---SFNASPDKSKKI
YOL001W            QKKFVIDKN-ALGSLDLDSYSYVNRPKSGYNVLDKYYRRIVQLVG---SFNASPDKSRKV
Skud_15.161        QKKFVADKN-APGSFDLDSYSYVSRPKSGYNVLDKYYRRIVQLVG---SFNASPDKSKKV
CAGL0E02541g       KNFFILPESIESDLAPSLRQGYSSISNAGYNVLTRYYYKIIEVVG---KYSSSPDKTKKV
KLLA0D01287g       LGSNMLIPM---------KNASQRGPDNGFNVLQNYYRKIVQLVG---NPLNSPDKTSTY
ZYRO0C07634g       HRHFVLDTQDGDDWTPILSNLSGNRNNSGYNVLDTYYNKIVQLVG---SLKSTQDKSKLV
ACR001C            ERIFSYSNI------PMDKDCALQDRNNGFGVLEKYYHRMIHLIG---DFNMSPDKSCNL
Ecym_3029          EGTFSFANI------PADAEQDQKSEENRFDVLENYYHRMIHLIG---NLDASPDKSYDL
TDEL0G04430        LQKFTLYEE---PEMGQNSRPQNSLKNSGYNVLDAYFRKIVQLVG---SYASSPDKSKVV
KNAG0I01750        AHEFTIYNK---AALTNVSKPTHTQRNSGYNVLQMYYHKIIQLVG---KFSSSLDKSKKA
SAKL0E01408g       QGVFITFPL----------ADKIKGPNNGFNVLDTYYKKMIQLVG---PSNSSPDKTSKV
KLTH0C11110g       EGLFVTATY----------AKENRGPNNGFNVLDTYYQKIIEIVG---SYDSSPDKTKRA
Kwal_56.22443      AGLFVTPTY----------SKSCRGPNNGFNVLDTYYRKIIEIVG---SFDSSPDKTKRA
                                                :.:*  *: .:: : *       :       

NDAI0C02640        YFLMRPRRISSASSIESAAATPLPKPNPPPQLTSVGESNYDNNNDSIGERSNAVTFALSS
NCAS0D02150        IYTFPN---------------NSALTQKLNNLPPQIRAQLIKRTISKKRSRTSSSIALNH
TBLA0A07160        NYIF--------------------------------------------------------
TPHA0J00380        NYII----------------------------------------QTNYNDTNISDIDDNR
Kpol_1037.30       NYTL-----------------------------------LLSGNNMEKEVSNNIKENSNG
Suva_15.174        NYAL--------------------------------------------------------
Smik_15.169        DYVL--------------------------------------------------------
YOL001W            DYVL--------------------------------------------------------
Skud_15.161        DYVL--------------------------------------------------------
CAGL0E02541g       NYDI----------------------------DMPAKTLHEHQQNDAVKNCSNNNSNYQT
KLLA0D01287g       FFKM-----------------------VDPMNPGIGGTLVPPSTTIKNNLKDKGNGRLNT
ZYRO0C07634g       NYTFAN------------------TLKPTNIHNNEGLNLNPSPSGNNDKMTTTCNNGIDN
ACR001C            SFTL----------------------------AESPTNSIQKTLPGGNDFQTAYPGNIDD
Ecym_3029          NFTL----------------------------EEPELVIDPITFTLNKANDNNNSSYYSN
TDEL0G04430        NYVL-----------------------------RPSSPIKDGSRDSTHDHALSSQTSLES
KNAG0I01750        NYVF--------------------------------------------------------
SAKL0E01408g       SYVL--------------------------------------------------------
KLTH0C11110g       HYVM--------------------------------------------------------
Kwal_56.22443      HYVM--------------------------------------------------------
                    : :                                                        

NDAI0C02640        TISNDSMSNSSYGDQPNLGSNIQKESSAVDNVQNNTTTISGNNSEHRMKSQHKALSPTVA
NCAS0D02150        LLPSSSASSGISDQSPVQSYLGGAANTGVSYNNDDEEEKEDDEEAYYDEDDSKGGSVEIH
TBLA0A07160        -------------------------SINQDEIYNSMPELEKPNHIIPTQQANKNLILSH-
TPHA0J00380        KVIQIYAQHITPQKRNYDDHVNILTKGEQIQQTDKSVMSKPEDGLPKVPKYSPEYAPKYN
Kpol_1037.30       QNIGESEQAISSKLSRDPPPKRNFETINNERQTTYTNNTTNETESSKRLQKYSITRTDSI
Suva_15.174        --------PSNFDEDNEGSARLQQPKAATEVSPKSHYSQKRISEAKDTNKYHKRSKPD--
Smik_15.169        --------PSNIDKDNESGPQINEQRGSL----PNHYSQKRNSEAKDANTYHKRSKPD--
YOL001W            --------PPNIDIVSESGSQTT--QLKGSSSPNSHSSQKRYSEAKDAHIYNKRSKPD--
Skud_15.161        --------PSNIDKDTESGPQIQQQKGTLS--PNSHYSQKRNSEAKDTNIYRKRSKPD--
CAGL0E02541g       ASNNIPIPQTIPQNRPKRNFDTVEERHNIYIEEKSKMNTNGLAEKLTSSSYKKQITEDKK
KLLA0D01287g       NIISTTGRIVSPSITEGDSFNLSEHRKTRSRETSVNENSDSPPITIPQKRNMKEDDPTNM
ZYRO0C07634g       DNNDGSNSNSNSQIGLEQGTSSRKRNLDTDVYESGNESYGKDITGCENTLRNGDRGTSGN
ACR001C            GSKSCPNITSNNGSECQLASKEESRSLRSAHMDNNSSVNNSSPQSFSRKRNYSDSSINHL
Ecym_3029          NYSNNTDNGGNIRNINNDNDDKRLTLDTKDRNPAISEADISPQTSK--KRNYSDSNPNCI
TDEL0G04430        ISTRTINSDSKPKSHEDEEPSARKRNLDSEAHPNGKDKVPSPGESKLKKMTNNQRTPNIN
KNAG0I01750        --ENVPGMSSALSTEKKPALKRHLDHNDQKNQPDFILAVKKSSTSPYTFKKHVTEELKFQ
SAKL0E01408g       ------------EPSEQQESQTRKRHYGQVHEDKQLNSTDIENRKKHSNLQRQRAGTPPR
KLTH0C11110g       --------KTPPAPREAEAPKKKRAHEESESAGSQASSSCKKPA----------------
Kwal_56.22443      -------INSNTRKDVELLQKKRTHEETDVPPCSSSPSSKRPA-----------------
                                                                               

NDAI0C02640        YTPLMLTQESRTLSALTSKKRRLSGSES
NCAS0D02150        PRKKQFSKIEEKNT--------------
TBLA0A07160        ----------------------------
TPHA0J00380        ILNSNE----------------------
Kpol_1037.30       EYDKSKRNNA------------------
Suva_15.174        ----------------------------
Smik_15.169        ----------------------------
YOL001W            ----------------------------
Skud_15.161        ----------------------------
CAGL0E02541g       NQILDNSIYPSSI---------------
KLLA0D01287g       DRKSTLLRNGKKLSSHFNS---------
ZYRO0C07634g       LNKRHFNRQKKDSD--------------
ACR001C            GMCTQLILSKKHSNSQNSHSPREIV---
Ecym_3029          GLCNQIPITKKRSNGQTKHPSPSEIV--
TDEL0G04430        HHSYS-----------------------
KNAG0I01750        KD--------------------------
SAKL0E01408g       ----------------------------
KLTH0C11110g       ----------------------------
Kwal_56.22443      ----------------------------
                                               

FASTA FORMAT for MUSCLE Version 3.6

>NDAI0C02640
MQGSSYRDESKPDNNICQDSNINVNKTSNTSSDTPSTQSHSTPNVITDAENPKHVKITLP
IKFMECPRRDLVVLISRMLVTLIKINDTKANDNNL-------------------PSNYAT
RFHSRVIPGISIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFNSLTAHRFILT
AVIVASKSLCDSCLSITHYAKYGGVQPNELLMLEAYFLKLIKYRVLPRDKNTDLCSMEYH
FDTFALNDG--QIKESGTSFSYRQLPHSGYNVLHMYYRRIIDIIGVQRPISPSPDAVTVD
YFLMRPRRISSASSIESAAATPLPKPNPPPQLTSVGESNYDNNNDSIGERSNAVTFALSS
TISNDSMSNSSYGDQPNLGSNIQKESSAVDNVQNNTTTISGNNSEHRMKSQHKALSPTVA
YTPLMLTQESRTLSALTSKKRRLSGSES
>NCAS0D02150
-----------------MDIGNSLLTKDGSKESTAESPMTSKI-----------QVIEVP
YEYIKCSRSDLVVLVSRMLVLLIQSNDMTSNTSNS----------------SSDSNMHLT
RFHSRIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFTAAYPTFTFNSLTAHRFLLT
AITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRIIPRSSNVTLIKLERG
NQVFTLDHL-DMKDPKLSFLSYDYLPDNGYSVLNIYYQNIVRITG---A--SSDLLFKRV
IYTFPN---------------NSALTQKLNNLPPQIRAQLIKRTISKKRSRTSSSIALNH
LLPSSSASSGISDQSPVQSYLGGAANTGVSYNNDDEEEKEDDEEAYYDEDDSKGGSVEIH
PRKKQFSKIEEKNT--------------
>TBLA0A07160
------------------------------MGPSSGEEA---------------QLVVLD
QNFMKCSKIDLITLISRMLSFFIDINDSHNIHGNV--------------TNNRLSPLFLT
RFHSKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLNSLTVHRYLLT
ATTIASKGLCDSFCTNSHYAKVGGIRCNELNVLETEFLERVRYRVIPRDNTIKLCKLEYK
YSPI--------EDINNDIHIPDELQNSGYNVLSTYYNKMVQLVG---NCKSSKNSFRNV
NYIF--------------------------------------------------------
-------------------------SINQDEIYNSMPELEKPNHIIPTQQANKNLILSH-
----------------------------
>TPHA0J00380
-----------MAEHLTFKTNNIPNICNNTNHNDSDNNNDENI-----------ETIMLP
TSFLKCSRSDLVVLISRMLTFLIQINDRNEILTEN--NSAMIPTQTDVNNKNNNNMINLT
RFHSRVPPNISVNNYLIRLTKYASLEHSVLLSSLYYIDLLSSVYPEFKINSLTVHRFLLA
ATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRIIPRDDNIKLCKLEKK
SSQFTLDLG---DLLAANIQPELTHPNSGYNVLNIYYRKMVQIVG---LLKNSTDKSKKV
NYII----------------------------------------QTNYNDTNISDIDDNR
KVIQIYAQHITPQKRNYDDHVNILTKGEQIQQTDKSVMSKPEDGLPKVPKYSPEYAPKYN
ILNSNE----------------------
>Kpol_1037.30
MKKEILSKQFKSIDNSMHRSGNQGENNNSKNVSNENKIEIENI-----------ETITLP
PKFIDCSRSDLVALIARMLSFLIEMNDNDPANTNY-----------LNEEPNNRSVMNLT
RFHSRVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKINSLTVHRFLLT
ATTIASKGLCDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRIIPRDDNIKLCKIEHQ
QNKFTMDFS---DLSMVGMTVQSNHQNSGFNILDIYYHKIVQLVG---SFSASSDKSRKA
NYTL-----------------------------------LLSGNNMEKEVSNNIKENSNG
QNIGESEQAISSKLSRDPPPKRNFETINNERQTTYTNNTTNETESSKRLQKYSITRTDSI
EYDKSKRNNA------------------
>Suva_15.174
-------------------MESPAREHSEDTQEDQSI-----------------PKIILP
SEFKKCSRTDLVVLISRMLVSLIAINENSST-KRP------------------DDQITLT
RYHSKIPPNISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLNSLTAHRFLLT
ATTVAAKGLCDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRILPRDHNITLCSIEQK
QKTFVIDKN-ALGSVDLGSYSYANRSKSGYNVLDKYYQRIVQLVG---SFDASPDKSRRV
NYAL--------------------------------------------------------
--------PSNFDEDNEGSARLQQPKAATEVSPKSHYSQKRISEAKDTNKYHKRSKPD--
----------------------------
>Smik_15.169
-------------------MESTVGDLSENMHEDQGI-----------------QKVILP
TDFNKCSRTDLVVLISRMLVSLIAINENSVS-KIP------------------ENQITLT
RYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRFLLT
ATTIATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNIMLCSIEQK
QKKFVIDKN-ALGSFDLDSYSYTDRPKSGYNVLDKYYRRIVQLVG---SFNASPDKSKKI
DYVL--------------------------------------------------------
--------PSNIDKDNESGPQINEQRGSL----PNHYSQKRNSEAKDANTYHKRSKPD--
----------------------------
>YOL001W
-------------------MESTSGERSENIHEDQGI-----------------PKVILP
ADFNKCSRTDLVVLISRMLVSLIAINENSAT-KKS------------------DDQITLT
RYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLNSLTAHRFLLT
ATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQK
QKKFVIDKN-ALGSLDLDSYSYVNRPKSGYNVLDKYYRRIVQLVG---SFNASPDKSRKV
DYVL--------------------------------------------------------
--------PPNIDIVSESGSQTT--QLKGSSSPNSHSSQKRYSEAKDAHIYNKRSKPD--
----------------------------
>Skud_15.161
-------------------METSVREHSEGIHEHQGI-----------------PKVILP
AEFYKCSRTDLVVLISRMLVSLIAINENSTT-KKP------------------DDQITLT
RYHSKVPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRFLLT
ATTVAAKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQK
QKKFVADKN-APGSFDLDSYSYVSRPKSGYNVLDKYYRRIVQLVG---SFNASPDKSKKV
DYVL--------------------------------------------------------
--------PSNIDKDTESGPQIQQQKGTLS--PNSHYSQKRNSEAKDTNIYRKRSKPD--
----------------------------
>CAGL0E02541g
-----------------------MTPQDAQINTDEEI-----------------PTIKLP
RDFLKCPKGDLVILIARMLQFIIQINDSNIKEN--------------------ERKYGLT
RFHSKIAPNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPAFNLNSLTAHRFLLT
ATTIASKGLCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRIIPRDNNITFCKMEVQ
KNFFILPESIESDLAPSLRQGYSSISNAGYNVLTRYYYKIIEVVG---KYSSSPDKTKKV
NYDI----------------------------DMPAKTLHEHQQNDAVKNCSNNNSNYQT
ASNNIPIPQTIPQNRPKRNFDTVEERHNIYIEEKSKMNTNGLAEKLTSSSYKKQITEDKK
NQILDNSIYPSSI---------------
>KLLA0D01287g
------------------------MESMNTIDPQKGSNIG--------------QIIPLP
EEYLRCSRTHLVVIISRMLSFLIQINDANNA---------------------GNQTMELT
RFHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLNSLTVHRFLLT
ATTIASKGLCDSFCTNTHYSKVGGVQCSELNILENEFLERVRYRIIPRDDNIENCKIEQK
LGSNMLIPM---------KNASQRGPDNGFNVLQNYYRKIVQLVG---NPLNSPDKTSTY
FFKM-----------------------VDPMNPGIGGTLVPPSTTIKNNLKDKGNGRLNT
NIISTTGRIVSPSITEGDSFNLSEHRKTRSRETSVNENSDSPPITIPQKRNMKEDDPTNM
DRKSTLLRNGKKLSSHFNS---------
>ZYRO0C07634g
---MYDNDRVAPSVFTAPNAVVNVGNNNVQGPPTTGIRIDNVNDV---------PTVILP
KRFSECSRTDLVILISRMLTFLIQMNDSSST-SAL------------------DSVTNLT
KFHSKVPPGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPTFTLNSLTVHRFLLT
ATTVASKGLCDSFCTNTHYAKVGGVHCSELNVLECELLRRINYRIIPRDDNIAWCNLESQ
HRHFVLDTQDGDDWTPILSNLSGNRNNSGYNVLDTYYNKIVQLVG---SLKSTQDKSKLV
NYTFAN------------------TLKPTNIHNNEGLNLNPSPSGNNDKMTTTCNNGIDN
DNNDGSNSNSNSQIGLEQGTSSRKRNLDTDVYESGNESYGKDITGCENTLRNGDRGTSGN
LNKRHFNRQKKDSD--------------
>ACR001C
-------------------------MSVQTSHETSESV----------------TEMELP
RQFLSCSRTYLVVLISRMLTSLIGMNDAQGDKSKP---------------------IKLT
RFHSRVPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLDSLTVHRFLLT
ATTVASKGLCDSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRILPRDDNIRRCSLERQ
ERIFSYSNI------PMDKDCALQDRNNGFGVLEKYYHRMIHLIG---DFNMSPDKSCNL
SFTL----------------------------AESPTNSIQKTLPGGNDFQTAYPGNIDD
GSKSCPNITSNNGSECQLASKEESRSLRSAHMDNNSSVNNSSPQSFSRKRNYSDSSINHL
GMCTQLILSKKHSNSQNSHSPREIV---
>Ecym_3029
-------------------MSDTGNNSNVEVENRKAQPV---------------PEFRLP
RKFLDCSRTHLVVLISRMLSSLIRLNDAYTE----------------------SNTLQLT
RFHSRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPEFRLDSLTVHRFLLT
ATTVASKGLCDSFCTNTHYAKVGGVQCNELNVLENEFLTRVNYRILPRDENIKRCSREHQ
EGTFSFANI------PADAEQDQKSEENRFDVLENYYHRMIHLIG---NLDASPDKSYDL
NFTL----------------------------EEPELVIDPITFTLNKANDNNNSSYYSN
NYSNNTDNGGNIRNINNDNDDKRLTLDTKDRNPAISEADISPQTSK--KRNYSDSNPNCI
GLCNQIPITKKRSNGQTKHPSPSEIV--
>TDEL0G04430
-------------MQAIEDAEVTVAARDKPIPSESSKEGTDEI-----------STIYLP
RKFSKCSRTDLAVLISRMLTFLIQINDSLAL-SKP------------------ENARGLT
RFHSRVPPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYPVFTLSSLTVHRFLLT
ATTVASKGLCDSFCTNTHYAKVGGVHSSELNILECEFLKRVNYRILPRDDNIDWCKLETK
LQKFTLYEE---PEMGQNSRPQNSLKNSGYNVLDAYFRKIVQLVG---SYASSPDKSKVV
NYVL-----------------------------RPSSPIKDGSRDSTHDHALSSQTSLES
ISTRTINSDSKPKSHEDEEPSARKRNLDSEAHPNGKDKVPSPGESKLKKMTNNQRTPNIN
HHSYS-----------------------
>KNAG0I01750
------------------MAEGGVAKQANRNEETTGCEI---------------QTVSLP
SNFSLCSRYDLIALISRMLVFLIQINDDAAQ-KKTGLADSGKGEATDAADTDGSSETKLT
RFHSSVPPPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPAFTINSLTVHRFLLT
ATTVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKKINYRVLPRDDNITWCKYEHR
AHEFTIYNK---AALTNVSKPTHTQRNSGYNVLQMYYHKIIQLVG---KFSSSLDKSKKA
NYVF--------------------------------------------------------
--ENVPGMSSALSTEKKPALKRHLDHNDQKNQPDFILAVKKSSTSPYTFKKHVTEELKFQ
KD--------------------------
>SAKL0E01408g
----------MSAEELTANGSAGSATIASTSKNSSNSTPVEQRQCLTQAPEQTSSQIMLP
DEFLKCSRTALVVLISRMLSSLIQMNDSMCK----------------------DKNLKLT
RFHSRVPPGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLNSLTVHRFLLT
ATTVASKGLSDSFCTNVHYAKVGGVQCSELNVLETEFLKRVNYRIIPRDDNIFNCKEEYQ
QGVFITFPL----------ADKIKGPNNGFNVLDTYYKKMIQLVG---PSNSSPDKTSKV
SYVL--------------------------------------------------------
------------EPSEQQESQTRKRHYGQVHEDKQLNSTDIENRKKHSNLQRQRAGTPPR
----------------------------
>KLTH0C11110g
-----------MSDKESGGASAKHPDLTEDTKPDTGEDPV--------------PEVALP
NDFSQCPRTDLVILISRMLSFLIRINDSIPK----------------------DNSSELT
RFHSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMYTAFSLNSLTVHRFLLT
ATTVGSKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKRVNYRILPRDDNILNCKAERR
EGLFVTATY----------AKENRGPNNGFNVLDTYYQKIIEIVG---SYDSSPDKTKRA
HYVM--------------------------------------------------------
--------KTPPAPREAEAPKKKRAHEESESAGSQASSSCKKPA----------------
----------------------------
>Kwal_56.22443
---------------MSDKESGCLSAKNPGSPKSPGERLEEAPV----------PEVALP
EDFSQCSRTDLVILISRMLSFLTRINDSVPK----------------------DDAKELT
RFHSRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYPSFSLNSLTVHRFLLT
ATTVASKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKKVNYRILPRDDNISNCKAEKK
AGLFVTPTY----------SKSCRGPNNGFNVLDTYYRKIIEIVG---SFDSSPDKTKRA
HYVM--------------------------------------------------------
-------INSNTRKDVELLQKKRTHEETDVPPCSSSPSSKRPA-----------------
----------------------------