MUSCLE (3.8) multiple sequence alignment

ACL002C            -----MNDSDLKQRVKFV--APENDTASSYSTKETTFLQDGTVAAAITATRAIREVSSLC
Ecym_3031          -----MAQQQVFQRKIQK--ATSSLAGKNRTLETSVIFEDLNQATTIPLKPASK----LF
TPHA0M00290        ----MTSSSRLQKRNGETIVSSSAVTEEEYTIANDGVKSNKKLVKIIGRFT--RQLITIT
KLLA0D01331g       -------------MSTRK--RSVVTEETALIEETPGTKKTVRVYE-----R--R----VY
KLTH0C11044g       --------MEQGGLTQRK--PVEVELHHRMVEENSSLLKDSNLKQR--TKR--R----LY
Kwal_56.22454      --------MVEAGLTKRK--AVGIEPEGVMTEETTTLLNGSRIEER--TRR--R----LY
Kpol_1032.9        -----MVSQNIRRRSITS--TSSTVTTVQVEKDGAK--SSYSYIKR---GV--Q----LV
TDEL0G04420        ------MSDSLKKRSQCS--LTTDQTSTVTKEETSGPVKGQKTDKMSKKKR--K----LY
TBLA0E03060        ------MVTEVQRRKLTS--STEEGVELLYGDNQQQ--LNTSGSSG----K--R----LY
ZYRO0C07612g       -------MSNLKKRSSLS--TTTSDSQTNLEVNQEQ--TTIKIEPVNTQKK--L----LY
Suva_15.173        MIHIRKEAFEMSTLLERT--NSVQELKKRAAGNTAA--NPAEVAKAKKVLK--R----VY
Skud_15.160        MMLIAKEPFQMSTLLERT--KSVQELKKRAAGKTPA--NPAEVAEAKKVLK--R----LY
Smik_15.168        MMHVRKESFQMSTLLERT--KSVQELKKRAAGKTSA--NPAEVAEAKKVLK--R----LY
YOL002C            ----------MSTLLERT--KSVQELKKRAAGKTSA--NPAEVAKAKKVLR--R----LY
SAKL0E01474g       -----MEPEPNRRRLQIK--RANIVKEETMSTGTIN----------KKRVR--R----LY
KAFR0G02650        ------MISSRPKRSTRK--VTIDTAFQDVVEQNKG----ETIRSLEKIIQ-------LY
KNAG0M01240        ----------MSSRVQRQ---TVTITEPVVYEDDGG---EMKTATKKITKR-------IY
CAGL0E02519g       -------MGDVHQRKVAT--MVTTEEQPLIG--TDG---QIKLRKK-TVVR--K----LY
NDAI0F01740        ------MPKTIQKRGNTS---TTTVVEGIINNTDNG--DSIEQVKRKVVYK-------LY
NCAS0H01510        ------MTKNLQQRVALT--STSTSTKTTIDDDNVS----IKHTKKTTTIR--K----LY
                                                                             : 

ACL002C            SWDDLPDWQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFLFIALF-
Ecym_3031          SWHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYLHNESVNIYTHLIPGVCFFCVLFL-
TPHA0M00290        HWDDLPDWQKDNEHIHEGYVKETNSFINCFESLFFLHNESVNIYSHMVPGLCALFMLLI-
KLLA0D01331g       SWDEIPDWQKDNEHILHGYVRETQSWKELFHSLFYLHNESVNIYTHLIPAVALFFIMLFA
KLTH0C11044g       TWDEIPEWQRDNEHIVGGYILETKSTWECLKSLLYLHNESVNIYTHLLPGWCFLLVAVF-
Kwal_56.22454      KWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESVNIYTHLIPGWCFLLMTLF-
Kpol_1032.9        TWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNESVNIFSHLVPAFCFMTTIIF-
TDEL0G04420        TWDEIPHWQRDNEHILSGYVGETRSMFQCFLSLFYLHNESVNIYTHLLPGIAFLFVLCF-
TBLA0E03060        TWDEIPVWQHDNEYIYTGYVRETNSMKESFLSLFYIHNESVNIYTHLIPAFCFLSMLLF-
ZYRO0C07612g       TWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYLHNESINIYTHFLPGLCFLATCIF-
Suva_15.173        SWDEIPEWQRDNDYILHGYVKETSSFVDTFKSLFYMHNESVNIYSHLIPAVGFLTVLLL-
Skud_15.160        SWDEIPEWQRDNDYILHGYVRETCSFVETFKSLFYMHNESVNIYSHLIPALGFFTVLLL-
Smik_15.168        SWDEIPEWQRDNDFILHGYVRETSSFIETFKSLFYLHNESVNIYSHLVPALGFFTVLLL-
YOL002C            SWDEIPEWQRDNDFILHGYVKETSSFIETFKSLFYLHNESVNIYSHLIPALGFFTVLLL-
SAKL0E01474g       SWEEIPDWQKDNEHIRHGYVRETNSFLGCFDSLFYMHNESVNIYTHLLPGLCFFFVVLF-
KAFR0G02650        NWNEIPDWQKDNEHIISGYVKETNSFFSCIESLFYLHNESVNVYSHLIPAVCFLMTSLL-
KNAG0M01240        TWNEIPEWQKDNEHIIDGYVRETNSFLKCVHSLFYLHNESVNVYSHLIPALCFFSVLFL-
CAGL0E02519g       TWEEIPEWQKDNEHIHTGYVRETSSVMECIRSLFYLHNETVNIYSHLIPAIAFFSTIFF-
NDAI0F01740        RWDEIPEWQKDNEHIISGYVRETNSFKGCLHSLFYVHNESGNVYSHLLPGVFFFFTMVL-
NCAS0H01510        TWDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHNETGNVYSHLVPGVVFFLTMLF-
                    *  :* **.**:.*  **: ** *    . **:::***: *:::*::*.   :    : 

ACL002C            NKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYIGIVA
Ecym_3031          NKYVISRFKTTTWKDYAIIDTFFVGAFACLVMSGTYHCLKSHSYPVSIVGNQLDYIGIVI
TPHA0M00290        DINIIKKFPTTTFVDYFMIDLFLAGAFSCLILSSAFHTLKSHSLFVAIYGNKLDYLGIVI
KLLA0D01331g       THHVINEYPTTSAIDYFMINLFFFGCATCLTMSSMFHTIKCHSLPIATFGNKLDYLGIVV
KLTH0C11044g       NQVVIEKFETTRLIDYVMIDLFFLGGFTCLMMSSVFHCFKCHSLPVAILGNKLDYLGIVA
Kwal_56.22454      NQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNKLDYLGIVA
Kpol_1032.9        DKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKAHSPYVSSFGNKLDYLGIVV
TDEL0G04420        DKFAVTQFETTTLIDYVMIDLFSLVSFTCLTLSSIFHCLKNHSRSVATFGNKLDYLGIVV
TBLA0E03060        NTYGVKPHPTTTYGDYVAIDLFFIGAFTCLGLSSTFHCFKSHSLKISVFGNKLDYLGIVI
ZYRO0C07612g       DKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFHCFKSHSSRVSVFGNKLDYLGIVI
Suva_15.173        DKTTITVFETTTWLDHMMIDLFFTGAFACLILSSSFHCFKSHSLKIATLGNKLDYLGICI
Skud_15.160        DKSTIKVFETTTWKDHMIIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICI
Smik_15.168        DKSTIKVFETTTWKDHVVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICI
YOL002C            DKSTIKVFATTTWLDHMVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICI
SAKL0E01474g       DKVAIKVFDTTTFLDYIMVDLFFLGAFTCLILSSTFHCLKTHSLRIAILGNKLDYLGIVA
KAFR0G02650        NKTIVPKFRTTTVLDYLYIDLFFLGAFTCLILSSTFHCFKSHSLRIATFGNKLDYLGIVV
KNAG0M01240        NKYCVKSFETTSLVDYLFIDLFFLGAFTCLILSSTFHCFKSHSLKVATFGNKLDYLGIVV
CAGL0E02519g       NKYVVPTYSTTTLIDYLIIDIFFLGAFSCLILSSTFHCLKSHSLRVAVFGNKLDYLGIVF
NDAI0F01740        NKYGITIYSTTSIVDYLMIDLFFFGAFCCLILSSLFHCFKSHSLKVATLGNKLDYLGIVI
NCAS0H01510        DKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKIATFGNKLDYLGIVV
                       :  . **   *:  :: *      ** :*. :* :* **  ::  **:***:**  

ACL002C            LISCSMISQMYYGFYDSTAMFSLFSTVTLSLALACAVVSLSPHFRSREWRKYRAAIFTAF
Ecym_3031          LISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVVTLDSRFRSRLWRPYRASIFVAF
TPHA0M00290        LIVTSMISILYYGFYDTPYFFHLFSTITILFGIACGTVSLANKFRSREWRPYRATLFVCF
KLLA0D01331g       LISTSMISILFYGFHDSSLLFYPFAGLTSLFGLICGYMSLKDKFRSREWRPYRATMFVLF
KLTH0C11044g       LVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGLACATVSLSNKFRSREWRPYRASLFVAF
Kwal_56.22454      LVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAALFVAF
Kpol_1032.9        LIVSSMSSILYYGFYDNSFLYFTFSAITFTFGLSCAVVSLGERFRAREWRPYRAAMFVAF
TDEL0G04420        LVVTSMVSIMYYGFFETPALFYLFSFITCTFGAACAVVSLKEGFRTREWRPYRAAMFVAF
TBLA0E03060        LISTSLISVLYFGYHDDPFIFYIFSGITLCFGIACGIASLKDKFRTREWRPYRAALFVLF
ZYRO0C07612g       LIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIASFDDTFRSREWRPYRAGLFVAF
Suva_15.173        LIVTSMVSILYYGYYDKFPAFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCF
Skud_15.160        LIVTSMTSILYYGYYEKFSLFCLFALITVSFGIACSIVTLKDKFRKREWRPYRAGLFVCF
Smik_15.168        LIVTSMVSILFYGYYEKFSLFCLFALITVSFGVACSIVSLKDKFRKREWRPYRAGLFVCF
YOL002C            LIVTSMVSILYYGYFEKFSLFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCF
SAKL0E01474g       LIVSSMISIMYYGFFDSGKFFYGFSTLTLVFGIACAIASLSDTFRSREWRPYRAALFVAF
KAFR0G02650        LISTSMISLLYYGFYDTPSLFYVFAFITLSFGLACATVSLKDKFRSRECRAYRATLFVCF
KNAG0M01240        LIVTSMISILYYGFYDSSVMFYFFSFVTLSFGTACGVVSLKDHFRSREWRPYRAGLFVAF
CAGL0E02519g       LIVASMVSILYYGFHGNPWFFGIFSLITMTFGAACAVVSLKDTFRSREWRPYRAALFVIF
NDAI0F01740        LIVTSMISIMYFGFFDNPLFFYFFSSLTFLFGGACATVSLKDHFRSREWRPYRAGLFVAF
NCAS0H01510        LIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLFVAF
                   *:  *: * :::.:.     :  *: :   :.  *   ::   ** *  * *** :*. *

ACL002C            GLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGSFDIWG
Ecym_3031          GLSSILPILASILYYGSEETWNSVQLGWIILEGVLYIFGAFIYGIRFPESMAPGSFDIWG
TPHA0M00290        GLSAVFPVLTGIWYYGLEDTFKRIQLKWIVTEGFFYIFGAFLYAMRYPERICPGAFDLWG
KLLA0D01331g       GLSAVFPIVAGFIVYGKDETWKRVQLTWVIWEGVLYIFGAFLYGVRFPERLAPGKFDIWG
KLTH0C11044g       GLSALLPVIAGALHYGLKETWTRIQLEWVLLGGVFYILGAVLYGIRFPERMAPGCFDIWG
Kwal_56.22454      GLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPERVAPGTFDIWG
Kpol_1032.9        GLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGALLYGVRFPERLKPGMFDIWG
TDEL0G04420        GLSAVLPIVTGIFYYGFSEIYLRIQVKWVLLGGIFYITGAVLYGVRFPEKYAPGKYDIWG
TBLA0E03060        GLSGVLPIIAGIMKYGIREVFERVQLKWIIWEGVLYIFGAFLYGARFPEKFMPGKVDIWG
ZYRO0C07612g       GLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIFYIFGAFLYSIRFPERLAPGAFDFVG
Suva_15.173        GLSSIVPIFSGLYYYSFSEIWNQIQLFWVLLGGALYIIGAVLYGMRFPEKVYPGRFDIWG
Skud_15.160        GLSSIVPIFSGLYCYTFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWG
Smik_15.168        GLSSIVPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWG
YOL002C            GLSSIIPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKICPGKFDIWG
SAKL0E01474g       GLSAVLPIFSGVAVYGFKETWVKVQVKWVLLGGVFYIIGALLYALRLPERISPGKFDIWG
KAFR0G02650        GLSAVLPVICGLYHYGFYNTWHRIQLKWVLLEGVFYIFGAFLYGIRFPEKYTPGKYDIWG
KNAG0M01240        GLSAILPILSGMFAYGIEEAFHRIQIKWIILEGVFYILGAFLYGIRFPEKGSPGKYDIWG
CAGL0E02519g       GLSAVLPILAGLFKYGPTETWTRIQLKWVILEGVFYIFGAFLYGIRFPEKMSPGSFDLWG
NDAI0F01740        GLSAILPILAGTFYYGIEETFIRIQLKWIILEGFFYIFGAFLYGVRFPEKYVPGSFDIWG
NCAS0H01510        GLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKYVNGTFDIWG
                   ***.:.*:. .   *        :*: *:   * :** **.:*. * **    *  *: *

ACL002C            HSHQLFHVLVVIAALCHLRALLSCYKNVHTNALFVSL----
Ecym_3031          HSHQLFHVLVVIAALCHFKAVTQSYELVHFRLNEAVQLKL-
TPHA0M00290        HSHQIFHVFVVIAAYSHFHGLLSAYEYAHEMLIK-------
KLLA0D01331g       HSHQLFHVLVVVAALCHLKALVVSYGLVHQALSQ-------
KLTH0C11044g       HSHQLFHILVVVAALCHLRALLGAYKLFHHVKVV-------
Kwal_56.22454      QSHQLFHVLVVIAASCHLRALLGAYKWVHSQMLI-------
Kpol_1032.9        HSHQLFHILVVVAALCHLRGLLGSYTIVHTRLSSLTQ----
TDEL0G04420        HSHQLFHVLVVVAALCHLYGLIKSYNLVHLKMAIAQL----
TBLA0E03060        QSHQIFHVLVVIAALCHLRGLIGSYELVHQKLDAQLQSIT-
ZYRO0C07612g       HSHQIFHVLVVIAALCHLVALMNSYELVHTNLLSNST----
Suva_15.173        HSHQLFHFLVVIASLCHMRGVLNSYELVHIKMQNGIVS---
Skud_15.160        HSHQLFHFLVVIASFCHLRGLLNSYELVHLKMEGKIVS---
Smik_15.168        HSHQLFHFLVVIASLCHLRGLLNSYELVHIKMESGIIS---
YOL002C            HSHQLFHFLVVIAALCHLRGLLNSYELVHIKMENGIVS---
SAKL0E01474g       HSHQIFHILVVIAALCHLKAVLNSYELVHKKLASI------
KAFR0G02650        HSHQLFHILVVIAALCHFKALMCSYEHVHMFVIPSMLNILR
KNAG0M01240        HSHQVFHILVVVAALCHLKGLMVSYELVHKGLSSATKA---
CAGL0E02519g       HSHQIFHILVVVAALCHLKALLGSYSLVHYRFMIDMY----
NDAI0F01740        HSHQIFHILVVVAAFCHLRGLLSSYEIVHSRL---------
NCAS0H01510        HSHQIFHLLVVVAAFCHLKALLGSYELVHMNL---------
                   :***:**.:**:*: .*: .:  .*   *            

FASTA FORMAT for MUSCLE Version 3.6

>ACL002C
-----MNDSDLKQRVKFV--APENDTASSYSTKETTFLQDGTVAAAITATRAIREVSSLC
SWDDLPDWQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFLFIALF-
NKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYIGIVA
LISCSMISQMYYGFYDSTAMFSLFSTVTLSLALACAVVSLSPHFRSREWRKYRAAIFTAF
GLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGSFDIWG
HSHQLFHVLVVIAALCHLRALLSCYKNVHTNALFVSL----
>Ecym_3031
-----MAQQQVFQRKIQK--ATSSLAGKNRTLETSVIFEDLNQATTIPLKPASK----LF
SWHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYLHNESVNIYTHLIPGVCFFCVLFL-
NKYVISRFKTTTWKDYAIIDTFFVGAFACLVMSGTYHCLKSHSYPVSIVGNQLDYIGIVI
LISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVVTLDSRFRSRLWRPYRASIFVAF
GLSSILPILASILYYGSEETWNSVQLGWIILEGVLYIFGAFIYGIRFPESMAPGSFDIWG
HSHQLFHVLVVIAALCHFKAVTQSYELVHFRLNEAVQLKL-
>TPHA0M00290
----MTSSSRLQKRNGETIVSSSAVTEEEYTIANDGVKSNKKLVKIIGRFT--RQLITIT
HWDDLPDWQKDNEHIHEGYVKETNSFINCFESLFFLHNESVNIYSHMVPGLCALFMLLI-
DINIIKKFPTTTFVDYFMIDLFLAGAFSCLILSSAFHTLKSHSLFVAIYGNKLDYLGIVI
LIVTSMISILYYGFYDTPYFFHLFSTITILFGIACGTVSLANKFRSREWRPYRATLFVCF
GLSAVFPVLTGIWYYGLEDTFKRIQLKWIVTEGFFYIFGAFLYAMRYPERICPGAFDLWG
HSHQIFHVFVVIAAYSHFHGLLSAYEYAHEMLIK-------
>KLLA0D01331g
-------------MSTRK--RSVVTEETALIEETPGTKKTVRVYE-----R--R----VY
SWDEIPDWQKDNEHILHGYVRETQSWKELFHSLFYLHNESVNIYTHLIPAVALFFIMLFA
THHVINEYPTTSAIDYFMINLFFFGCATCLTMSSMFHTIKCHSLPIATFGNKLDYLGIVV
LISTSMISILFYGFHDSSLLFYPFAGLTSLFGLICGYMSLKDKFRSREWRPYRATMFVLF
GLSAVFPIVAGFIVYGKDETWKRVQLTWVIWEGVLYIFGAFLYGVRFPERLAPGKFDIWG
HSHQLFHVLVVVAALCHLKALVVSYGLVHQALSQ-------
>KLTH0C11044g
--------MEQGGLTQRK--PVEVELHHRMVEENSSLLKDSNLKQR--TKR--R----LY
TWDEIPEWQRDNEHIVGGYILETKSTWECLKSLLYLHNESVNIYTHLLPGWCFLLVAVF-
NQVVIEKFETTRLIDYVMIDLFFLGGFTCLMMSSVFHCFKCHSLPVAILGNKLDYLGIVA
LVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGLACATVSLSNKFRSREWRPYRASLFVAF
GLSALLPVIAGALHYGLKETWTRIQLEWVLLGGVFYILGAVLYGIRFPERMAPGCFDIWG
HSHQLFHILVVVAALCHLRALLGAYKLFHHVKVV-------
>Kwal_56.22454
--------MVEAGLTKRK--AVGIEPEGVMTEETTTLLNGSRIEER--TRR--R----LY
KWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESVNIYTHLIPGWCFLLMTLF-
NQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNKLDYLGIVA
LVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAALFVAF
GLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPERVAPGTFDIWG
QSHQLFHVLVVIAASCHLRALLGAYKWVHSQMLI-------
>Kpol_1032.9
-----MVSQNIRRRSITS--TSSTVTTVQVEKDGAK--SSYSYIKR---GV--Q----LV
TWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNESVNIFSHLVPAFCFMTTIIF-
DKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKAHSPYVSSFGNKLDYLGIVV
LIVSSMSSILYYGFYDNSFLYFTFSAITFTFGLSCAVVSLGERFRAREWRPYRAAMFVAF
GLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGALLYGVRFPERLKPGMFDIWG
HSHQLFHILVVVAALCHLRGLLGSYTIVHTRLSSLTQ----
>TDEL0G04420
------MSDSLKKRSQCS--LTTDQTSTVTKEETSGPVKGQKTDKMSKKKR--K----LY
TWDEIPHWQRDNEHILSGYVGETRSMFQCFLSLFYLHNESVNIYTHLLPGIAFLFVLCF-
DKFAVTQFETTTLIDYVMIDLFSLVSFTCLTLSSIFHCLKNHSRSVATFGNKLDYLGIVV
LVVTSMVSIMYYGFFETPALFYLFSFITCTFGAACAVVSLKEGFRTREWRPYRAAMFVAF
GLSAVLPIVTGIFYYGFSEIYLRIQVKWVLLGGIFYITGAVLYGVRFPEKYAPGKYDIWG
HSHQLFHVLVVVAALCHLYGLIKSYNLVHLKMAIAQL----
>TBLA0E03060
------MVTEVQRRKLTS--STEEGVELLYGDNQQQ--LNTSGSSG----K--R----LY
TWDEIPVWQHDNEYIYTGYVRETNSMKESFLSLFYIHNESVNIYTHLIPAFCFLSMLLF-
NTYGVKPHPTTTYGDYVAIDLFFIGAFTCLGLSSTFHCFKSHSLKISVFGNKLDYLGIVI
LISTSLISVLYFGYHDDPFIFYIFSGITLCFGIACGIASLKDKFRTREWRPYRAALFVLF
GLSGVLPIIAGIMKYGIREVFERVQLKWIIWEGVLYIFGAFLYGARFPEKFMPGKVDIWG
QSHQIFHVLVVIAALCHLRGLIGSYELVHQKLDAQLQSIT-
>ZYRO0C07612g
-------MSNLKKRSSLS--TTTSDSQTNLEVNQEQ--TTIKIEPVNTQKK--L----LY
TWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYLHNESINIYTHFLPGLCFLATCIF-
DKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFHCFKSHSSRVSVFGNKLDYLGIVI
LIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIASFDDTFRSREWRPYRAGLFVAF
GLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIFYIFGAFLYSIRFPERLAPGAFDFVG
HSHQIFHVLVVIAALCHLVALMNSYELVHTNLLSNST----
>Suva_15.173
MIHIRKEAFEMSTLLERT--NSVQELKKRAAGNTAA--NPAEVAKAKKVLK--R----VY
SWDEIPEWQRDNDYILHGYVKETSSFVDTFKSLFYMHNESVNIYSHLIPAVGFLTVLLL-
DKTTITVFETTTWLDHMMIDLFFTGAFACLILSSSFHCFKSHSLKIATLGNKLDYLGICI
LIVTSMVSILYYGYYDKFPAFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCF
GLSSIVPIFSGLYYYSFSEIWNQIQLFWVLLGGALYIIGAVLYGMRFPEKVYPGRFDIWG
HSHQLFHFLVVIASLCHMRGVLNSYELVHIKMQNGIVS---
>Skud_15.160
MMLIAKEPFQMSTLLERT--KSVQELKKRAAGKTPA--NPAEVAEAKKVLK--R----LY
SWDEIPEWQRDNDYILHGYVRETCSFVETFKSLFYMHNESVNIYSHLIPALGFFTVLLL-
DKSTIKVFETTTWKDHMIIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICI
LIVTSMTSILYYGYYEKFSLFCLFALITVSFGIACSIVTLKDKFRKREWRPYRAGLFVCF
GLSSIVPIFSGLYCYTFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWG
HSHQLFHFLVVIASFCHLRGLLNSYELVHLKMEGKIVS---
>Smik_15.168
MMHVRKESFQMSTLLERT--KSVQELKKRAAGKTSA--NPAEVAEAKKVLK--R----LY
SWDEIPEWQRDNDFILHGYVRETSSFIETFKSLFYLHNESVNIYSHLVPALGFFTVLLL-
DKSTIKVFETTTWKDHVVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICI
LIVTSMVSILFYGYYEKFSLFCLFALITVSFGVACSIVSLKDKFRKREWRPYRAGLFVCF
GLSSIVPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWG
HSHQLFHFLVVIASLCHLRGLLNSYELVHIKMESGIIS---
>YOL002C
----------MSTLLERT--KSVQELKKRAAGKTSA--NPAEVAKAKKVLR--R----LY
SWDEIPEWQRDNDFILHGYVKETSSFIETFKSLFYLHNESVNIYSHLIPALGFFTVLLL-
DKSTIKVFATTTWLDHMVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICI
LIVTSMVSILYYGYFEKFSLFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCF
GLSSIIPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKICPGKFDIWG
HSHQLFHFLVVIAALCHLRGLLNSYELVHIKMENGIVS---
>SAKL0E01474g
-----MEPEPNRRRLQIK--RANIVKEETMSTGTIN----------KKRVR--R----LY
SWEEIPDWQKDNEHIRHGYVRETNSFLGCFDSLFYMHNESVNIYTHLLPGLCFFFVVLF-
DKVAIKVFDTTTFLDYIMVDLFFLGAFTCLILSSTFHCLKTHSLRIAILGNKLDYLGIVA
LIVSSMISIMYYGFFDSGKFFYGFSTLTLVFGIACAIASLSDTFRSREWRPYRAALFVAF
GLSAVLPIFSGVAVYGFKETWVKVQVKWVLLGGVFYIIGALLYALRLPERISPGKFDIWG
HSHQIFHILVVIAALCHLKAVLNSYELVHKKLASI------
>KAFR0G02650
------MISSRPKRSTRK--VTIDTAFQDVVEQNKG----ETIRSLEKIIQ-------LY
NWNEIPDWQKDNEHIISGYVKETNSFFSCIESLFYLHNESVNVYSHLIPAVCFLMTSLL-
NKTIVPKFRTTTVLDYLYIDLFFLGAFTCLILSSTFHCFKSHSLRIATFGNKLDYLGIVV
LISTSMISLLYYGFYDTPSLFYVFAFITLSFGLACATVSLKDKFRSRECRAYRATLFVCF
GLSAVLPVICGLYHYGFYNTWHRIQLKWVLLEGVFYIFGAFLYGIRFPEKYTPGKYDIWG
HSHQLFHILVVIAALCHFKALMCSYEHVHMFVIPSMLNILR
>KNAG0M01240
----------MSSRVQRQ---TVTITEPVVYEDDGG---EMKTATKKITKR-------IY
TWNEIPEWQKDNEHIIDGYVRETNSFLKCVHSLFYLHNESVNVYSHLIPALCFFSVLFL-
NKYCVKSFETTSLVDYLFIDLFFLGAFTCLILSSTFHCFKSHSLKVATFGNKLDYLGIVV
LIVTSMISILYYGFYDSSVMFYFFSFVTLSFGTACGVVSLKDHFRSREWRPYRAGLFVAF
GLSAILPILSGMFAYGIEEAFHRIQIKWIILEGVFYILGAFLYGIRFPEKGSPGKYDIWG
HSHQVFHILVVVAALCHLKGLMVSYELVHKGLSSATKA---
>CAGL0E02519g
-------MGDVHQRKVAT--MVTTEEQPLIG--TDG---QIKLRKK-TVVR--K----LY
TWEEIPEWQKDNEHIHTGYVRETSSVMECIRSLFYLHNETVNIYSHLIPAIAFFSTIFF-
NKYVVPTYSTTTLIDYLIIDIFFLGAFSCLILSSTFHCLKSHSLRVAVFGNKLDYLGIVF
LIVASMVSILYYGFHGNPWFFGIFSLITMTFGAACAVVSLKDTFRSREWRPYRAALFVIF
GLSAVLPILAGLFKYGPTETWTRIQLKWVILEGVFYIFGAFLYGIRFPEKMSPGSFDLWG
HSHQIFHILVVVAALCHLKALLGSYSLVHYRFMIDMY----
>NDAI0F01740
------MPKTIQKRGNTS---TTTVVEGIINNTDNG--DSIEQVKRKVVYK-------LY
RWDEIPEWQKDNEHIISGYVRETNSFKGCLHSLFYVHNESGNVYSHLLPGVFFFFTMVL-
NKYGITIYSTTSIVDYLMIDLFFFGAFCCLILSSLFHCFKSHSLKVATLGNKLDYLGIVI
LIVTSMISIMYFGFFDNPLFFYFFSSLTFLFGGACATVSLKDHFRSREWRPYRAGLFVAF
GLSAILPILAGTFYYGIEETFIRIQLKWIILEGFFYIFGAFLYGVRFPEKYVPGSFDIWG
HSHQIFHILVVVAAFCHLRGLLSSYEIVHSRL---------
>NCAS0H01510
------MTKNLQQRVALT--STSTSTKTTIDDDNVS----IKHTKKTTTIR--K----LY
TWDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHNETGNVYSHLVPGVVFFLTMLF-
DKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKIATFGNKLDYLGIVV
LIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLFVAF
GLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKYVNGTFDIWG
HSHQIFHLLVVVAAFCHLKALLGSYELVHMNL---------