MUSCLE (3.8) multiple sequence alignment

TBLA0B00480        --------------------MVIEFSRPWYGVAIPSCIIFTLTTVSYFGILQDVLTTNQT
KNAG0F02930        --------------------MPVQLKQPWHGIAIPCSLIFFIGYPAHWFILRNSLSNKRQ
KAFR0A05130        --------------------MAIQLKWPWLGIAIPTFLISFIGYSAHYFILLDHLSWKLQ
KLLA0C06204g       --------------------MAIKLKNRWLGVAIPAFLVALIGYGSHYFILSNFLSWNEQ
ACL003C            --------------------MAVLVKWPWLGVAIPCFLISFTGYFAHFFVLTNFLSFKEL
KLTH0C10978g       --------------------MPVELKWPWLGIAVPSFLIAYIGYSSHYFILQNFASTYQQ
Kwal_56.22459      --------------------MPVKLKWPWLGIAIPSSLIAFIGYGSHYFILGNFLSLGQQ
Ecym_3032          --------------------MPVKLKWPWLGIAIPCFLIAFIGYSAQLFVLQGFLSVKQQ
SAKL0E01518g       --------------------MAVKLKWPWLGIAIPLFLISFIGYCAHYFILSNFLPTKKQ
TPHA0J00390        --------------------MPVKFKWPWMGIAIPCVLISFIGYLSHYYILRQHLSLIKQ
YOL003C            --------------------MPVKLRWPWLGIAIPTFLISFIGYGAHYFILSNFLSVPKQ
Suva_15.172        MIVCWVYHTRFYTELVTDLAMAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSVSKQ
Smik_15.167        --------------------MAVKLRWPWLGIAIPTLLISFIGYGAHYFILSNFLPIAKQ
Skud_15.159        --------------------MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSISKQ
CAGL0E02497g       --------------------MPVKLKWPWLGIAIPSFLIASIGYCAHYFILLNFLSLRKQ
NDAI0C02650        --------------------MAIKLKYPWLGVAIPSFIISFIGYNSHYFILSNFLSIKKQ
NCAS0D02140        --------------------MPVKLKYPWMGVVIPCLLTSFIGYSAHIFVLANFMSWKLQ
TDEL0G04410        --------------------MPVKLKWPWLGIAIPCVLVSFIGYCGHFFILSNFLSPSKQ
ZYRO0C07546g       --------------------MPVQLKWPFLGIAIPCFLISFIGYNAHYFILSNFLSTQKQ
Kpol_1037.23       --------------------MPVKLKYPWMGIAIPCFLISFIAYTAHYFILLNFLSIGKQ
                                       * : .   : *:.:*  :       .   :*    .    

TBLA0B00480        IWYFTTAIMISYSYYLAIVTPPTPAPSTLTQSFISDVMNNENDIFPTTTCKKCKKIKLPR
KNAG0F02930        IIFQFCLTMIWISYYMAIYTNPGKPPHGSAQQ--HTDGDMNR------YCAKCNGFKPER
KAFR0A05130        LWFQFSLSMIWLSYYLAIKADPGSPSIADKNE---DIKTIRT------YCKKCDAYKPPR
KLLA0C06204g       IFYQTCQTMIWVSYYLAIYTNPGIPPKDFKPS----AEEWHN------YCKKCRVYKPER
ACL003C            LWFQVSLSMIWISYWKAIYKNPGRPTKGFRPL----RYEWQN------YCTKCETYKPER
KLTH0C10978g       LWFEFSLTLIWVSYAFAIFKNPGRPPPNFEPP----IHQWKN------YCKKCDNYKPER
Kwal_56.22459      VWFQICLSMIWISYALAIFTNPGKPPTGFQPL----PHQWKN------ICQKCKTYKPER
Ecym_3032          IWFQFSLTMIWLSYYKAIYTNPGSPVPGFQPL----KHEWKN------YCKKCQNFKPER
SAKL0E01518g       LWFEFSLGMIWISYYLAIYTNPGKPTPGFRPS----KFEWEN------FCNKCNNYKPER
TPHA0J00390        CYFEFSLTMIWVSYYMAIIINPGKPGKNFKPL----PHEWRN------FCKKCNNYKPER
YOL003C            ITFEFCLSMIWLSYYLAICTNPGRPLPNYKPP----PDIWRN------FCKKCQSYKPER
Suva_15.172        IAFESSLSMIWVSYYLAIYTNPGKPSPTYQPN----PNTWPN------YCKKCQNYKPER
Smik_15.167        IGFEFSLSMIWFSYYLAIYTNPGRPLPNYQPT----PGIWPN------FCKKCQNYKPER
Skud_15.159        LLFELSLSMIWVSYYLAIYTNAGRPLPNYRPS----PLIWPN------FCKKCQSYKPER
CAGL0E02497g       LWYQFCQTMIWLSYYLAIYTPPGKPPTNFKPS----KNEWKV------YCKKCKCYKPER
NDAI0C02650        IWFQFSLSMIWVSYLLAIFTNPGKPPKNCKPIDFNDQRKWNT------HCKKCNNYKPER
NCAS0D02140        LWFQSSLTMLWISYALAIFTNPGRPAKSFKPL----KKEWTH------FCKKCQLFKPER
TDEL0G04410        LWFQCNLALIWLSYYYAIYTNPGRPRPNFEVP----KYEWKN------YCKKCQNYKPER
ZYRO0C07546g       IWFEFSLTMIWFSYYLAIYTLPGQPLPNFQPS----KNSWKS------YCKKCRNYKPER
Kpol_1037.23       IWFEISVTMIWISYYLAIYTNPGKPGSNYIPP----SNQWKN------YCKKCNAYKPER
                     :     ::  **  **   .  .                        * **   *  *

TBLA0B00480        AHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYKLYI
KNAG0F02930        SHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVIITTSQLFWYLLLRIAAIWQ
KAFR0A05130        AHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWVIVTTAFLLAQLFRRIGFIWT
KLLA0C06204g       AHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLFWVIFSTAYLLFLLIGRIYLLWS
ACL003C            THHCKRCNQCVLVMDHHCPWTMNCLGLQYLAPQHSIFCWIIATTGILLHYFVKRIKFTWV
KLTH0C10978g       THHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSYLGLLLTQRAFDHWA
Kwal_56.22459      THHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIITTSYLGFMLWKRIFMHWQ
Ecym_3032          THHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWIITTTTYLSIQFFKRTWFVWN
SAKL0E01518g       AHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIETTSFLLTYLVKRILFLWN
TPHA0J00390        SHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWIMATTGFLLFYQIKRIIYMWN
YOL003C            SHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIVTTSVLFCIQAKRIYFIWQ
Suva_15.172        SHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFWVIATTGFLFCIQLKRVSFIWQ
Smik_15.167        SHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLFWIIITTSILFCIQVKRICFIWQ
Skud_15.159        SHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWVIVTTSILFCMQVKRICFIWQ
CAGL0E02497g       SHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLAIFLTTRIHSIWV
NDAI0C02650        SHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTGFLLVHLLKRTMTMWN
NCAS0D02140        AHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVVTTGFLLYQLLKRTIYLWG
TDEL0G04410        AHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFLLYQLVSRIIVLWR
ZYRO0C07546g       AHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFWVIATTGYLLYELCLRAYFILS
Kpol_1037.23       THHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTYLLYFLISRIVFLWK
                   :**** *  *:: ******:* **:*    .    :: *::  *  *      .      

TBLA0B00480        YRNSP----FHLYQNVKYKIIILTLLIPGTIFVWLTVLLLLLKTLQNQIWNGMTQIEYWQ
KNAG0F02930        ARNMPIKGGVVSTT--TKELVSLVVLTPMDLFVLFTITALFVRCVTNQVIGGMTQIESWE
KAFR0A05130        NWYSS----SALVQ--RQEIVMLTILTPMDAFILLTITLLLIRCTMNQIFSGMSQIEKWE
KLLA0C06204g       IRHTA----FHHRS--TSEIIFICIMTPMDAFVLLTVSSLLGRCIYNQCLHGMTQIESWE
ACL003C            NRYAT----ANLVS--KQELIFLTILTPLDAFILLTISLLFVRCVKNQIVNGRTQIEAWE
KLTH0C10978g       SRNTR----KFVH---TSELCFLFVNAPLNAFILLTVSLLVFRCVKNQFLNGMTQIESWE
Kwal_56.22459      LRHTR----IYVQ---KIELVFIFINTPLNAFVWLTIILLLLRCSKNQFLCGMTQIERWE
Ecym_3032          IRHST----AQLVT--KKEIIFLTILTPANAFVLLTISILFGRCIKNQVLNGMTQIEAWE
SAKL0E01518g       RRHMP----NYFVH--RSELIFLTILTPMDAFVLLTISLLLLRCAKNQILKGMTQIESWE
TPHA0J00390        NRNLP----SYLFE--RSEVIALFVCTPLNLFILLTITLLFCRCLFNQIINGKTQIEDWE
YOL003C            QRHLP----GYFFK--KSELIFLTISSPLNSFVLLTITILFLRCLFNQILNGRSQIESWD
Suva_15.172        QRHLP----GYLFK--KSELVFLTILTPLNFFVLLTIVILFLRCLFNQIINGRSQIESWD
Smik_15.167        RRNFP----GYLFK--KSELTFLTILSPLNFFVLLTITVLFLRCLFNQIVNGRSQIESWD
Skud_15.159        QRSLP----GYLFE--KSELIFLTILSPLDFFVLLTIAILFLRCLSNQIINGRSQIESWD
CAGL0E02497g       HRSSP----SYLYY--KSELIFLTILTPLNAFILLTISILMIRCLFNQIFNGRSQIESWE
NDAI0C02650        LRHLP----SYIFD--RNEIIFLTILIPMDAFILLTISLLFIRCFNNQIVRGMTQIEFWE
NCAS0D02140        VKDLP----SYLFE--KTEITFLIILIPMDGFVLITVALLFIRCLSNQIIGGKTQIESWE
TDEL0G04410        DRNLP----DYMFH--RSELVFLTILTPLDAFVLLTITILLCRCLANQIFNGMSQIETWE
ZYRO0C07546g       NHNSP----TYLWN--KSELIFLTILIPMDGFILLTISILFIRCLSNQIFCGRTQIETWE
Kpol_1037.23       SRNLP----SYLFN--KSEIIFLTITTPMDGFVLLTISLLFIRCTVNQLLSGRTQIETWE
                    .                ::  : :  *   *: :*:  *. .   **   * :*** *:

TBLA0B00480        FEMIENKYFQSKSSKVALQLQLLENLLNFYNKKLSTDSITKIQKLISSLQNGARWNTSFH
KNAG0F02930        MERLQNMFYSKK-----LLPIMIERVWEKFPHEQTPEHELEAEKLLEMNEQG---LLKFS
KAFR0A05130        MERLESSFYSRKEKSRDFLMILINNVFTIFSIESPEDYQEEVNGLLRQHDKR---RLAFH
KLLA0C06204g       MDRIQSLHYKNR-----LLAQVIDRLVERRPEI-LPAKQHEINKLLSK---R---YVNQE
ACL003C            MDRIENLFYHQR-----LLPQLLTNLKEIYPGS-LEGQEKEVEEFLSS---S---TCSFD
KLTH0C10978g       KDRIENLFFNER-----LVPQLIDNLKELFPEDTF--DEGAAQKLLSS---K---QLELE
Kwal_56.22459      WERIENQFNNGR-----LIPQLLENLAEIYGDDIL--NSPNAKKLINA---R---DLQLE
Ecym_3032          MDRIESMFYNRR-----LVPQLLSNLEELYPNS-LDGHKGEIDRILNN---R---KISFE
SAKL0E01518g       MDRIENMFHSGQ-----LIPRMLENLKEIRPGS-LSNQDDDIRKLLSQ---N---RLSLD
TPHA0J00390        MDRLENRFYLKK-----LLPQLILNLWELYPELKSAKHDEEAERLIEK---K---GIRYD
YOL003C            MDRLESLFNSGR-----LTQKLIDNTWRIYPESRSFQNKKDAEEHLTK---K---RPRFD
Suva_15.172        MDRLESLFDSQR-----LIKKLIENTWRIYPEARSPQLERDAEKLLTQ---H---KIRFE
Smik_15.167        MDRLESLFDSRR-----LIQKLIYNTWRIYPESKTLQHERDAEGLLKQ---Q---RSSFE
Skud_15.159        MDRLESLCDSGK-----LIPKLIDNTWRIYPEARSSQHERDADKLLTQ---RG--RARFD
CAGL0E02497g       MDRLETLARMSK-----LLPILIENVWYIFPNLRNEHVESQAEALLNK---K---RLSLD
NDAI0C02650        LERLENLFYNKK-----LLPMIIATLWEVYPNERTKVADNYADDLLSR--RK---KVRFE
NCAS0D02140        LERLENLYYRKK-----LLPQLLVNLWEIYPNEKTPENKVLAKKLQER--GR---KVRFE
TDEL0G04410        LERLQALFDSKR-----LVPLLIEAAWDIFPGTREQINESTAAELSMN---K---ELRLE
ZYRO0C07546g       YERLEGLYYSKR-----LLPHLLANFWELYPELRTRELEDEASRLSTR---R---RIGLD
Kpol_1037.23       NERLESLFYLRR-----LKPQLISNLWEFHPELKTPDNEAKAEKIVSK-------RIRFD
                    : ::      .     :   ::                                     

TBLA0B00480        SIINFPYDLGLSNNITTTMGSLNPLSWFNPWYTPLTASYN-KINEFAIWDDNETHDNIKD
KNAG0F02930        SVVNFPYDVDLLTNIHQSLGS--PMLLLWPFSTAQGNGVTFQKNDISTYEDNLS---ISD
KAFR0A05130        SIINFPYDIDILTNATCVLGP--FFSWLNPFGAPEGDGMHFELNEIAS-EKAST---LAD
KLLA0C06204g       DFTNFPYDVNPWTNINNAMGP--WYLWLWPWSKPPTIGTSFAKNELFFYDPNSS---IED
ACL003C            EVINFPYDINPWVNLLNCMGS--PLNWLNPFGGPKADGMVFQKNEISDYDEATS---IQD
KLTH0C10978g       DIINFPYDVDILENMKSSMGP--IYSWCLPCGRPRDEGTRFVTNDLSDYDIKAS---IED
Kwal_56.22459      EIVNFPYDLNIVANTRHAIGN--LLTCILPWSSPVGNGLKFTKNDLSSYDTCHT---IED
Ecym_3032          DLVNFPYDSDPWRNLINCMGP--MLTWLNPFGKPNGNGMVFEKNELSAYEHGST---LTD
SAKL0E01518g       EIVNFPYDLNPWANAVNSLGD--MYSWILPWGTAKGNGMIFEKNELSVYEPEIP---IED
TPHA0J00390        SIVNFPYDLGIFKNITALVGQ--PLYWLWPFGGPSGNGMNFEKNEIALFDPDSS---LPV
YOL003C            ELVNFPYDFDLYTNALLYLGP--IHLWLWPYGVPTGDGNNFPKNGISKYEANSS---LED
Suva_15.172        EVVNFPYNIDLFTNATIYLGP--LHLWLWPCGAPAGDGNSFQKNDISKYEVNSS---LED
Smik_15.167        GLVNFPYNFDLHTNAILYLGP--VHLWLWPYGIPTGNGNNFPKNDISNYEVDSP---LED
Skud_15.159        ELVSFPYNFNPCTNAILYLGP--IRLWLWPYGTPAGDGNSFPKNDISQYEVNSP---LED
CAGL0E02497g       ELVNFPYDLGPFRNAIQLLGT--PPLWLYPFSGPQDDGLHFQKNEESMIEDPNS---LND
NDAI0C02650        NIVNFPYDIDIWTNMNTVMGS--AFNWIWIFGVPDRNGLKFEKNEISLYEPGSS---VED
NCAS0D02140        NIVTFPYDLDIWSNALTVLGS--PVQWLWLFGGPDSDGMHFKKNELALYEEGAA---IED
TDEL0G04410        DVVNFPYDLDPWSNAEQLLGN--PLLWLWPFGRPKGDGMSFVKNEISEYSSRAS---YED
ZYRO0C07546g       HLVNFPYDIDPWSNTIEFLGS--PLFWLWPFGKPKGDGMFFPKNDISEFEETN----LTD
Kpol_1037.23       LLVSFPYDLGLINNITTVLGS--PVTWLWFYGEPSGDGMLFKKNEYSLFEEDSI---LED
                    . .***: .   *    :*             .   .     *     .          

TBLA0B00480        MLLCLPWPLNYS--------------NNSTFQDGELVVKS--------------------
KNAG0F02930        LLLCLSWPPDGGRRIPHPQREDGAHMIDQTVEDGEFMIRKRN-----------SPIESRT
KAFR0A05130        LLLSLPWPPDTCTSKYGKSIDEGTKYVETHIEGGECVLRNRTVSPSFDLPTANENQLSRK
KLLA0C06204g       MLMSLPWPPDGLTHHSRALGSGSS--IETIVSGGEQVIRDKSVDL--------RDRLGRN
ACL003C            KLLALPWPPDDTRHGIAFPSVSH---VEKDTQGGEQVVRRRHV-P--------IAVPPRN
KLTH0C10978g       KLLSLPWPPDGGRQKSQRSADIAST-LETFSSGGEATLRNRSFDS--------RISVPRT
Kwal_56.22459      KLLSLPWPPDGGRQQPTGDSQVSSR-IEMHSSRGEPVLRKRLRDP--------RINMQRT
Ecym_3032          KLLSLPWPPDGER--APNSSNSRLK-VESSTRNGEHIIRKRSPEP--------RLNLSRT
SAKL0E01518g       KLLSLPWPPDGGRHKVPGGGANDVNIVESSTRDGERVVRKRWVDP--------RTTMPRK
TPHA0J00390        FTLALPWPPDKGRHNNSKTLNTDSN-VEFITTDGEQVVRNRTHAK--------NPILSRE
YOL003C            HILSLPWPPDGGKTNT-VFNHGSST-IEMRNESGEQLIRTRLPQN--------GRHASRE
Suva_15.172        IMLSLPWPPDGGKIKT-ASNHSNLA-IETCNEGGEQVVRSRIAQH--------GRSATRE
Smik_15.167        IILSLPWPPDGGETTT-VSNPKTST-IETCNEGGEQVVRSRVAQN--------GRSASRE
Skud_15.159        IILSLPWPPDGNKTKA-VSNHNNST-IETYNEGGEQIVRSRNAQH--------GSDAIRE
CAGL0E02497g       IILCLPWPPDSTKHLN-STSEHTSN-VQIISEEGEQVIRIRTP----------EKKLSRS
NDAI0C02650        LLLSLPWPPDKGRNFI---SNKDTS-VESLVYDGEQVVRNRASNDT--NISTINKDISRE
NCAS0D02140        LLLSLPWPPDGGRNFI---QQKGTN-VESITENGEQVIRQRNFE---------NDNSYRK
TDEL0G04410        LLLSLPWPPDGGRTRA-GPGSLSSS-IESITKQGEQLIRRRPNDT--------SDLIGRR
ZYRO0C07546g       MLLALPWPPDGGKDKV-ISIDGPNA-VETTVRDGEQVIRKRLVDP--------RDPSSRT
Kpol_1037.23       QILSLPWPPDGGKHGFNIENSSTNS-IETSTKDGEHVIRKRSPVS--------KLLESRT
                     :.*.** :                 :     **  :.                     

TBLA0B00480        ---NDYGETLQDFGVDYDD--------
KNAG0F02930        TWENQWGETLEGFGVDPMNE-------
KAFR0A05130        SWTNEWGENLQAFGVDIEGE-------
KLLA0C06204g       SWYNDWGEDLSDFGVDTELE-------
ACL003C            EWYNDWGESLEHFGVDVEVE-------
KLTH0C10978g       EWHNDWGENLSDFGVDVDAET------
Kwal_56.22459      EWYNDWGENLSDFGVDVESETVPDANK
Ecym_3032          EWYNDWGENLAHFGVDVDADD------
SAKL0E01518g       KWYNDWGENLADFGVDLDEE-------
TPHA0J00390        EWFNEWGENLEDFGVDVEMEN------
YOL003C            KWYNDWGESLDDFGVDVDME-------
Suva_15.172        KWYNDWGESLDDFGVDVDME-------
Smik_15.167        KWFNDWGESLDDFGVDVDME-------
Skud_15.159        KWYNDWGESLDDFGVDVDME-------
CAGL0E02497g       EWLNDWGESLEDFGVDVDVE-------
NDAI0C02650        EWNNDWGESLVDFGVDIEAEVE-----
NCAS0D02140        TWNNDWGENLEDFGVDVDVE-------
TDEL0G04410        QWQNDWGENLEDFGVDVDTEQAS----
ZYRO0C07546g       QWQNTWGENLEDFGVDVDAE-------
Kpol_1037.23       QWYNDWGENLEDFGVDIDVE-------
                      * :** *  ****           

FASTA FORMAT for MUSCLE Version 3.6

>TBLA0B00480
--------------------MVIEFSRPWYGVAIPSCIIFTLTTVSYFGILQDVLTTNQT
IWYFTTAIMISYSYYLAIVTPPTPAPSTLTQSFISDVMNNENDIFPTTTCKKCKKIKLPR
AHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYKLYI
YRNSP----FHLYQNVKYKIIILTLLIPGTIFVWLTVLLLLLKTLQNQIWNGMTQIEYWQ
FEMIENKYFQSKSSKVALQLQLLENLLNFYNKKLSTDSITKIQKLISSLQNGARWNTSFH
SIINFPYDLGLSNNITTTMGSLNPLSWFNPWYTPLTASYN-KINEFAIWDDNETHDNIKD
MLLCLPWPLNYS--------------NNSTFQDGELVVKS--------------------
---NDYGETLQDFGVDYDD--------
>KNAG0F02930
--------------------MPVQLKQPWHGIAIPCSLIFFIGYPAHWFILRNSLSNKRQ
IIFQFCLTMIWISYYMAIYTNPGKPPHGSAQQ--HTDGDMNR------YCAKCNGFKPER
SHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVIITTSQLFWYLLLRIAAIWQ
ARNMPIKGGVVSTT--TKELVSLVVLTPMDLFVLFTITALFVRCVTNQVIGGMTQIESWE
MERLQNMFYSKK-----LLPIMIERVWEKFPHEQTPEHELEAEKLLEMNEQG---LLKFS
SVVNFPYDVDLLTNIHQSLGS--PMLLLWPFSTAQGNGVTFQKNDISTYEDNLS---ISD
LLLCLSWPPDGGRRIPHPQREDGAHMIDQTVEDGEFMIRKRN-----------SPIESRT
TWENQWGETLEGFGVDPMNE-------
>KAFR0A05130
--------------------MAIQLKWPWLGIAIPTFLISFIGYSAHYFILLDHLSWKLQ
LWFQFSLSMIWLSYYLAIKADPGSPSIADKNE---DIKTIRT------YCKKCDAYKPPR
AHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWVIVTTAFLLAQLFRRIGFIWT
NWYSS----SALVQ--RQEIVMLTILTPMDAFILLTITLLLIRCTMNQIFSGMSQIEKWE
MERLESSFYSRKEKSRDFLMILINNVFTIFSIESPEDYQEEVNGLLRQHDKR---RLAFH
SIINFPYDIDILTNATCVLGP--FFSWLNPFGAPEGDGMHFELNEIAS-EKAST---LAD
LLLSLPWPPDTCTSKYGKSIDEGTKYVETHIEGGECVLRNRTVSPSFDLPTANENQLSRK
SWTNEWGENLQAFGVDIEGE-------
>KLLA0C06204g
--------------------MAIKLKNRWLGVAIPAFLVALIGYGSHYFILSNFLSWNEQ
IFYQTCQTMIWVSYYLAIYTNPGIPPKDFKPS----AEEWHN------YCKKCRVYKPER
AHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLFWVIFSTAYLLFLLIGRIYLLWS
IRHTA----FHHRS--TSEIIFICIMTPMDAFVLLTVSSLLGRCIYNQCLHGMTQIESWE
MDRIQSLHYKNR-----LLAQVIDRLVERRPEI-LPAKQHEINKLLSK---R---YVNQE
DFTNFPYDVNPWTNINNAMGP--WYLWLWPWSKPPTIGTSFAKNELFFYDPNSS---IED
MLMSLPWPPDGLTHHSRALGSGSS--IETIVSGGEQVIRDKSVDL--------RDRLGRN
SWYNDWGEDLSDFGVDTELE-------
>ACL003C
--------------------MAVLVKWPWLGVAIPCFLISFTGYFAHFFVLTNFLSFKEL
LWFQVSLSMIWISYWKAIYKNPGRPTKGFRPL----RYEWQN------YCTKCETYKPER
THHCKRCNQCVLVMDHHCPWTMNCLGLQYLAPQHSIFCWIIATTGILLHYFVKRIKFTWV
NRYAT----ANLVS--KQELIFLTILTPLDAFILLTISLLFVRCVKNQIVNGRTQIEAWE
MDRIENLFYHQR-----LLPQLLTNLKEIYPGS-LEGQEKEVEEFLSS---S---TCSFD
EVINFPYDINPWVNLLNCMGS--PLNWLNPFGGPKADGMVFQKNEISDYDEATS---IQD
KLLALPWPPDDTRHGIAFPSVSH---VEKDTQGGEQVVRRRHV-P--------IAVPPRN
EWYNDWGESLEHFGVDVEVE-------
>KLTH0C10978g
--------------------MPVELKWPWLGIAVPSFLIAYIGYSSHYFILQNFASTYQQ
LWFEFSLTLIWVSYAFAIFKNPGRPPPNFEPP----IHQWKN------YCKKCDNYKPER
THHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSYLGLLLTQRAFDHWA
SRNTR----KFVH---TSELCFLFVNAPLNAFILLTVSLLVFRCVKNQFLNGMTQIESWE
KDRIENLFFNER-----LVPQLIDNLKELFPEDTF--DEGAAQKLLSS---K---QLELE
DIINFPYDVDILENMKSSMGP--IYSWCLPCGRPRDEGTRFVTNDLSDYDIKAS---IED
KLLSLPWPPDGGRQKSQRSADIAST-LETFSSGGEATLRNRSFDS--------RISVPRT
EWHNDWGENLSDFGVDVDAET------
>Kwal_56.22459
--------------------MPVKLKWPWLGIAIPSSLIAFIGYGSHYFILGNFLSLGQQ
VWFQICLSMIWISYALAIFTNPGKPPTGFQPL----PHQWKN------ICQKCKTYKPER
THHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIITTSYLGFMLWKRIFMHWQ
LRHTR----IYVQ---KIELVFIFINTPLNAFVWLTIILLLLRCSKNQFLCGMTQIERWE
WERIENQFNNGR-----LIPQLLENLAEIYGDDIL--NSPNAKKLINA---R---DLQLE
EIVNFPYDLNIVANTRHAIGN--LLTCILPWSSPVGNGLKFTKNDLSSYDTCHT---IED
KLLSLPWPPDGGRQQPTGDSQVSSR-IEMHSSRGEPVLRKRLRDP--------RINMQRT
EWYNDWGENLSDFGVDVESETVPDANK
>Ecym_3032
--------------------MPVKLKWPWLGIAIPCFLIAFIGYSAQLFVLQGFLSVKQQ
IWFQFSLTMIWLSYYKAIYTNPGSPVPGFQPL----KHEWKN------YCKKCQNFKPER
THHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWIITTTTYLSIQFFKRTWFVWN
IRHST----AQLVT--KKEIIFLTILTPANAFVLLTISILFGRCIKNQVLNGMTQIEAWE
MDRIESMFYNRR-----LVPQLLSNLEELYPNS-LDGHKGEIDRILNN---R---KISFE
DLVNFPYDSDPWRNLINCMGP--MLTWLNPFGKPNGNGMVFEKNELSAYEHGST---LTD
KLLSLPWPPDGER--APNSSNSRLK-VESSTRNGEHIIRKRSPEP--------RLNLSRT
EWYNDWGENLAHFGVDVDADD------
>SAKL0E01518g
--------------------MAVKLKWPWLGIAIPLFLISFIGYCAHYFILSNFLPTKKQ
LWFEFSLGMIWISYYLAIYTNPGKPTPGFRPS----KFEWEN------FCNKCNNYKPER
AHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIETTSFLLTYLVKRILFLWN
RRHMP----NYFVH--RSELIFLTILTPMDAFVLLTISLLLLRCAKNQILKGMTQIESWE
MDRIENMFHSGQ-----LIPRMLENLKEIRPGS-LSNQDDDIRKLLSQ---N---RLSLD
EIVNFPYDLNPWANAVNSLGD--MYSWILPWGTAKGNGMIFEKNELSVYEPEIP---IED
KLLSLPWPPDGGRHKVPGGGANDVNIVESSTRDGERVVRKRWVDP--------RTTMPRK
KWYNDWGENLADFGVDLDEE-------
>TPHA0J00390
--------------------MPVKFKWPWMGIAIPCVLISFIGYLSHYYILRQHLSLIKQ
CYFEFSLTMIWVSYYMAIIINPGKPGKNFKPL----PHEWRN------FCKKCNNYKPER
SHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWIMATTGFLLFYQIKRIIYMWN
NRNLP----SYLFE--RSEVIALFVCTPLNLFILLTITLLFCRCLFNQIINGKTQIEDWE
MDRLENRFYLKK-----LLPQLILNLWELYPELKSAKHDEEAERLIEK---K---GIRYD
SIVNFPYDLGIFKNITALVGQ--PLYWLWPFGGPSGNGMNFEKNEIALFDPDSS---LPV
FTLALPWPPDKGRHNNSKTLNTDSN-VEFITTDGEQVVRNRTHAK--------NPILSRE
EWFNEWGENLEDFGVDVEMEN------
>YOL003C
--------------------MPVKLRWPWLGIAIPTFLISFIGYGAHYFILSNFLSVPKQ
ITFEFCLSMIWLSYYLAICTNPGRPLPNYKPP----PDIWRN------FCKKCQSYKPER
SHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIVTTSVLFCIQAKRIYFIWQ
QRHLP----GYFFK--KSELIFLTISSPLNSFVLLTITILFLRCLFNQILNGRSQIESWD
MDRLESLFNSGR-----LTQKLIDNTWRIYPESRSFQNKKDAEEHLTK---K---RPRFD
ELVNFPYDFDLYTNALLYLGP--IHLWLWPYGVPTGDGNNFPKNGISKYEANSS---LED
HILSLPWPPDGGKTNT-VFNHGSST-IEMRNESGEQLIRTRLPQN--------GRHASRE
KWYNDWGESLDDFGVDVDME-------
>Suva_15.172
MIVCWVYHTRFYTELVTDLAMAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSVSKQ
IAFESSLSMIWVSYYLAIYTNPGKPSPTYQPN----PNTWPN------YCKKCQNYKPER
SHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFWVIATTGFLFCIQLKRVSFIWQ
QRHLP----GYLFK--KSELVFLTILTPLNFFVLLTIVILFLRCLFNQIINGRSQIESWD
MDRLESLFDSQR-----LIKKLIENTWRIYPEARSPQLERDAEKLLTQ---H---KIRFE
EVVNFPYNIDLFTNATIYLGP--LHLWLWPCGAPAGDGNSFQKNDISKYEVNSS---LED
IMLSLPWPPDGGKIKT-ASNHSNLA-IETCNEGGEQVVRSRIAQH--------GRSATRE
KWYNDWGESLDDFGVDVDME-------
>Smik_15.167
--------------------MAVKLRWPWLGIAIPTLLISFIGYGAHYFILSNFLPIAKQ
IGFEFSLSMIWFSYYLAIYTNPGRPLPNYQPT----PGIWPN------FCKKCQNYKPER
SHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLFWIIITTSILFCIQVKRICFIWQ
RRNFP----GYLFK--KSELTFLTILSPLNFFVLLTITVLFLRCLFNQIVNGRSQIESWD
MDRLESLFDSRR-----LIQKLIYNTWRIYPESKTLQHERDAEGLLKQ---Q---RSSFE
GLVNFPYNFDLHTNAILYLGP--VHLWLWPYGIPTGNGNNFPKNDISNYEVDSP---LED
IILSLPWPPDGGETTT-VSNPKTST-IETCNEGGEQVVRSRVAQN--------GRSASRE
KWFNDWGESLDDFGVDVDME-------
>Skud_15.159
--------------------MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSISKQ
LLFELSLSMIWVSYYLAIYTNAGRPLPNYRPS----PLIWPN------FCKKCQSYKPER
SHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWVIVTTSILFCMQVKRICFIWQ
QRSLP----GYLFE--KSELIFLTILSPLDFFVLLTIAILFLRCLSNQIINGRSQIESWD
MDRLESLCDSGK-----LIPKLIDNTWRIYPEARSSQHERDADKLLTQ---RG--RARFD
ELVSFPYNFNPCTNAILYLGP--IRLWLWPYGTPAGDGNSFPKNDISQYEVNSP---LED
IILSLPWPPDGNKTKA-VSNHNNST-IETYNEGGEQIVRSRNAQH--------GSDAIRE
KWYNDWGESLDDFGVDVDME-------
>CAGL0E02497g
--------------------MPVKLKWPWLGIAIPSFLIASIGYCAHYFILLNFLSLRKQ
LWYQFCQTMIWLSYYLAIYTPPGKPPTNFKPS----KNEWKV------YCKKCKCYKPER
SHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLAIFLTTRIHSIWV
HRSSP----SYLYY--KSELIFLTILTPLNAFILLTISILMIRCLFNQIFNGRSQIESWE
MDRLETLARMSK-----LLPILIENVWYIFPNLRNEHVESQAEALLNK---K---RLSLD
ELVNFPYDLGPFRNAIQLLGT--PPLWLYPFSGPQDDGLHFQKNEESMIEDPNS---LND
IILCLPWPPDSTKHLN-STSEHTSN-VQIISEEGEQVIRIRTP----------EKKLSRS
EWLNDWGESLEDFGVDVDVE-------
>NDAI0C02650
--------------------MAIKLKYPWLGVAIPSFIISFIGYNSHYFILSNFLSIKKQ
IWFQFSLSMIWVSYLLAIFTNPGKPPKNCKPIDFNDQRKWNT------HCKKCNNYKPER
SHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTGFLLVHLLKRTMTMWN
LRHLP----SYIFD--RNEIIFLTILIPMDAFILLTISLLFIRCFNNQIVRGMTQIEFWE
LERLENLFYNKK-----LLPMIIATLWEVYPNERTKVADNYADDLLSR--RK---KVRFE
NIVNFPYDIDIWTNMNTVMGS--AFNWIWIFGVPDRNGLKFEKNEISLYEPGSS---VED
LLLSLPWPPDKGRNFI---SNKDTS-VESLVYDGEQVVRNRASNDT--NISTINKDISRE
EWNNDWGESLVDFGVDIEAEVE-----
>NCAS0D02140
--------------------MPVKLKYPWMGVVIPCLLTSFIGYSAHIFVLANFMSWKLQ
LWFQSSLTMLWISYALAIFTNPGRPAKSFKPL----KKEWTH------FCKKCQLFKPER
AHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVVTTGFLLYQLLKRTIYLWG
VKDLP----SYLFE--KTEITFLIILIPMDGFVLITVALLFIRCLSNQIIGGKTQIESWE
LERLENLYYRKK-----LLPQLLVNLWEIYPNEKTPENKVLAKKLQER--GR---KVRFE
NIVTFPYDLDIWSNALTVLGS--PVQWLWLFGGPDSDGMHFKKNELALYEEGAA---IED
LLLSLPWPPDGGRNFI---QQKGTN-VESITENGEQVIRQRNFE---------NDNSYRK
TWNNDWGENLEDFGVDVDVE-------
>TDEL0G04410
--------------------MPVKLKWPWLGIAIPCVLVSFIGYCGHFFILSNFLSPSKQ
LWFQCNLALIWLSYYYAIYTNPGRPRPNFEVP----KYEWKN------YCKKCQNYKPER
AHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFLLYQLVSRIIVLWR
DRNLP----DYMFH--RSELVFLTILTPLDAFVLLTITILLCRCLANQIFNGMSQIETWE
LERLQALFDSKR-----LVPLLIEAAWDIFPGTREQINESTAAELSMN---K---ELRLE
DVVNFPYDLDPWSNAEQLLGN--PLLWLWPFGRPKGDGMSFVKNEISEYSSRAS---YED
LLLSLPWPPDGGRTRA-GPGSLSSS-IESITKQGEQLIRRRPNDT--------SDLIGRR
QWQNDWGENLEDFGVDVDTEQAS----
>ZYRO0C07546g
--------------------MPVQLKWPFLGIAIPCFLISFIGYNAHYFILSNFLSTQKQ
IWFEFSLTMIWFSYYLAIYTLPGQPLPNFQPS----KNSWKS------YCKKCRNYKPER
AHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFWVIATTGYLLYELCLRAYFILS
NHNSP----TYLWN--KSELIFLTILIPMDGFILLTISILFIRCLSNQIFCGRTQIETWE
YERLEGLYYSKR-----LLPHLLANFWELYPELRTRELEDEASRLSTR---R---RIGLD
HLVNFPYDIDPWSNTIEFLGS--PLFWLWPFGKPKGDGMFFPKNDISEFEETN----LTD
MLLALPWPPDGGKDKV-ISIDGPNA-VETTVRDGEQVIRKRLVDP--------RDPSSRT
QWQNTWGENLEDFGVDVDAE-------
>Kpol_1037.23
--------------------MPVKLKYPWMGIAIPCFLISFIAYTAHYFILLNFLSIGKQ
IWFEISVTMIWISYYLAIYTNPGKPGSNYIPP----SNQWKN------YCKKCNAYKPER
THHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTYLLYFLISRIVFLWK
SRNLP----SYLFN--KSEIIFLTITTPMDGFVLLTISLLFIRCTVNQLLSGRTQIETWE
NERLESLFYLRR-----LKPQLISNLWEFHPELKTPDNEAKAEKIVSK-------RIRFD
LLVSFPYDLGLINNITTVLGS--PVTWLWFYGEPSGDGMLFKKNEYSLFEEDSI---LED
QILSLPWPPDGGKHGFNIENSSTNS-IETSTKDGEHVIRKRSPVS--------KLLESRT
QWYNDWGENLEDFGVDIDVE-------