MUSCLE (3.8) multiple sequence alignment

CAGL0J11594g       ------------------------------------------------------------
TBLA0E03160        --------MSTNNNTNIESSNRNGSGNASISAAVNAT-----TSATTSNSDPASTNSITT
CAGL0E02475g       --------MSNQQGSVNHAIGSGAAETVNVT-----------QNATSNVGINDNQKIDGN
KNAG0F02920        --------MSYHWNQNQQERSMDRRELLESRPAGDGVKKDVLGVSGDSKSVSPTSHYNIS
NDAI0C02660        --------MSGIWNNPSTQDNTGSANVDRNNNRS--------NNSTEKRGLPGSASSDKE
KAFR0A05120        --------MNQGNSSTNIPQGTATNNPASAASTSSVTPPVAPGSQHQLASIQAPTTIVNA
Skud_15.158        --------MSQVWHNSNSQPN---------------------DVATSNDAAASNERSDKE
Suva_15.171        --------MNALGRT---------------------------EDRKSFNGLPEEEKANQP
Smik_15.166        --------MSQVWHNPNSQSNDVA------------------TSNDAAGSNERNERNEKE
YOL004W            --------MSQVWHNSNSQSN---------------------DVATSNDATGSNERNEKE
KLLA0C06182g       --------MSAPWNQQPDGPQQQQQQQQQQIP----------PSTGMINGVQGQSENSPN
NCAS0D02130        --------MSNAWNQHQTESETHNVDSVNLNQV---------DQTAERDHIPQETNFANQ
KLTH0C10956g       --------MPPSWTNQPASQTGTKSSVESPSL----------SEQQPVSGGMQGQAANST
Kwal_56.22462      MWQLSLPNHFVKFVNFPSFFMEFVDVYLHDRRDCRSFMKTPFLVKMKKNLSLVTSSTHKQ
SAKL0E01540g       --------MSQGWNHPSVQSTGNSTDSTHFLDQQPQQLQQSQTVLPPTSSLDHKIGGSTG
ACL004W            --------MSQSWSQHHQVDHAGSGRPV--------------GQAGPGPAGGTPQMGGGA
Ecym_3033          --------MSQSWNQHHQVDHVGGSGSVSGAGGQQPQ-----GKQHSDQGQQGQLAVGGG
TPHA0J00400        --------MSQVWNQSQ-------------------------NSNGSANGSATPGPATNA
Kpol_1037.22       --------MSQIWNQN--------------------------GTSNTSNNENQQQQ----
ZYRO0C07524g       --------MSQTWDRSPPTGSNSAHDTDTNNMNNNNSNANSQNATNNNQGSNKGSEVDSD
TDEL0G04400        ------MSGTQGWSQQASSLSAGAGAASASASGGNATT----ETHNNENGMNQAVETSTV
                                                                               

CAGL0J11594g       ---------------------------------------MVTLEF--NNVTDSVVKSYN-
TBLA0E03160        NLNTSNVPSVATTNDLASNVLKQQPS----------QQPFRLPSI--SDLNVESNVMVN-
CAGL0E02475g       AESSNSINNTSNNNNN--------------------NERIILPSF--SSLKTEDNRIDT-
KNAG0F02920        NSVSGSQHDTATKAAAAAVTETGTGTGTGT------SKHVTLPSL--SALSHELRNSPGK
NDAI0C02660        IQDSASNR----------------------------NEQITLPSINSQSFAHVVSNTNN-
KAFR0A05120        NTIPPSHVNTGEN-----------------------KNAVVLPSL--STLNNSTEQKEQ-
Skud_15.158        PPLQGRQPSFPGQQQQ--------------------QQRITLPSL--SALNANDEDRRD-
Suva_15.171        VQDHKRAPAA--------------------------VQPADAAEV--SNVYADTKDEIN-
Smik_15.166        PLLQGNQSSFVQQ-----------------------QQRITLPSL--SALNNKEENGRD-
YOL004W            PSLQGNKPGFVQQ-----------------------QQRITLPSL--SALSTKEEDRRD-
KLLA0C06182g       LLPQLAPPAVNIQIKPEHDQQ---------------QHHVTLPSI--STISGSNQPSQG-
NCAS0D02130        EQQQTNMKAEPS------------------------SEHVILPSL--SSIGGVQTSSEN-
KLTH0C10956g       GESKANAPVDASQQ----------------------PHQFVLPSL--SGLDAGTRAEYG-
Kwal_56.22462      YFIRSSRSSAYRSIELSCDPLLQQSPESYVEERFA-KRSVRMPQSWSNQATGQTGLKSS-
SAKL0E01540g       DAIKNSIEQTQPQV----------------------QVPYTLPSI--SGLNSTHSDSGI-
ACL004W            GLLPGRRGSEGL------------------------KTHYTLPSI--SAAGLPGAGEPH-
Ecym_3033          GLLGKRRSDGM-------------------------KGHYTLPSI-SAGLPGSGEHQHQ-
TPHA0J00400        MDVDGNEA----------------------------NKPVVLPSF--SKLNNNSSNGSV-
Kpol_1037.22       ------------------------------------QQHVVLPSF--SNINPENTTNIS-
ZYRO0C07524g       NNENNNNPASRNGVELPLPQQQQQNSGTEIKQESGSKPHFVLPSI--SDLSGETGSSPS-
TDEL0G04400        GLTGGKTPEMTKQEIKVES-----------------KPHVTLPSI--SDLSGESAHNGK-
                                                              .                

CAGL0J11594g       ------------------------------------------------------------
TBLA0E03160        -QHQQLQHPSI--------------------SPSQNMTS-----------MNTGIMNSNT
CAGL0E02475g       ------------------------------------------------------------
KNAG0F02920        QDMARTSGGDG-------------------------------------------------
NDAI0C02660        SSNNISDNNSDNKHNKNSNNNNNGATPASITATTPSIFPANSNNINKNNMPVLHSVQTHQ
KAFR0A05120        -------------------------------QEQQHFNP----------LNILNTNGSNR
Skud_15.158        ------YNGAQ--------------------PLASHATH------------ILGYSPVHS
Suva_15.171        ------------------------------------------------------------
Smik_15.166        ------SNGQL--------------------PLASHGTH------------ILGYPPTHP
YOL004W            ------SNGQQ--------------------ALTSHAAH------------ILGYPPPHS
KLLA0C06182g       -------QGQE--------------------QVQGQQNA--------------RSHSHSH
NCAS0D02130        -----------------------------------------------------NITNPTQ
KLTH0C10956g       ------------------------------------------------------------
Kwal_56.22462      ------AEGHG------------MVEQQAGSGGSMEQLPGIASEAKGAVPNGMGQPPQLP
SAKL0E01540g       ------------------------------------------------------------
ACL004W            ------------------------------------------------------------
Ecym_3033          ------------------------------------------------------------
TPHA0J00400        ------------------------------------------------------------
Kpol_1037.22       -------------------------------QQSNNKST--------------NTTPSST
ZYRO0C07524g       ------HGGSGTTNTTNVNTSGSQNPNATGAGVNSTMAPGVPSMLSQQSLPRLSSVQATY
TDEL0G04400        ------------------------------DGLTSSNTP-----------LRLPSVQSTY
                                                                               

CAGL0J11594g       ------------------------------------------------------------
TBLA0E03160        SGIS--------RHNSNPTPKSNPLKVSSFDNPLPPLSNKSIGIVNSNSPTNSHAT--IN
CAGL0E02475g       ----------------------SMNPIGPKSITTSSSTPA--------------------
KNAG0F02920        --------------------QRRKSSNGFSLASLDNPLPASNDAENSS----------LR
NDAI0C02660        S-----------PMNNPSVSPARAARAANTSTTTATATTNNNIVESNRNNNVSQSHPQRN
KAFR0A05120        KNSTMDSIMNPEPPTSMVSKASTTNTQTTPSSSSVPPINNGNVKVKNE----------RA
Skud_15.158        NIIP--------SISTDSALKQSHEYHPHPKSSSSSPSLKTAVVDTAPATTLAPALAPLP
Suva_15.171        ------------------------------------------------------------
Smik_15.166        NIIP--------SITSDSTFKQSHEYQPHPKSSSSSPSINTSVMNAASASAPAP----LP
YOL004W            NAMP--------SIATDSALKQPHEYHPRPKSSSSSPSINASLMNAGPAP--------LP
KLLA0C06182g       SHVH--------PHIHGPLSGVSNRMDNINLQNGGTPINS--------------------
NCAS0D02130        NQIP------TTGVNTATTSQSSSQMLPSVSSTFATPPNSTNITVPAQNQEQP-----KR
KLTH0C10956g       ---------------------SEPQRLPSLQGAQPQSISS--------------------
Kwal_56.22462      QQHVVLPSLSGLETGGRAEYGASAQRLPFMQGAAPQSASS--------------------
SAKL0E01540g       ----------------------GQQMLPSVQSSLPPPPPPALQPTH------------RH
ACL004W            ----------------------GGSRLPPMQNALGVGGGG-------------------P
Ecym_3033          --------------------QHDGSRLPPMQNTLAAAASA-----------PPGGGGGGG
TPHA0J00400        ----------------------NSNANASTSSNTTTQTPLHHFPNS------------NA
Kpol_1037.22       SNTP----------------NTGVKLENSSSLSRPNLPKT--------------------
ZYRO0C07524g       PSAP--------PVLPRFSTATAGEVQGPTTLTSSSSIPTTQQQQQQQPPDDKSRIGVKP
TDEL0G04400        GSKA---------------PGAGQEVNGTIMESTVNPAPA------------------QG
                                                                               

CAGL0J11594g       ------------------------------------------------------------
TBLA0E03160        TNTNSTSNINSMVNPNPTIPSVAVNSASPI----VHSQSPLLNQQPQEQQQQQHLLQNMQ
CAGL0E02475g       ---SVGFSVASLDNPL------------PPATKKPEIKLHPLPQQQQPRIYTQQQPQQQQ
KNAG0F02920        APAARGLSIDETTTPA---------VGVPPVVGTNQGKSAVTPPSLHIPTHQQQQQQQQQ
NDAI0C02660        NSASAGFSVASFDNPL------------PS-SNNNEVPPPVAPTVPQFQYIQPQPPVIQP
KAFR0A05120        PFFGTGVSVASFDNPL------------PP---------------LNQQQSQPSFPAMHM
Skud_15.158        TAGGASFSLSRFDNPL------------PI------NTSVCTKDSKSYNGVQEEEKANQQ
Suva_15.171        ------------------------------------------------------------
Smik_15.166        TAGGASFSLSRFDNPL------------PI----NAPVH--TEGSQSYNCPQEEEKASQQ
YOL004W            TVGAASFSLSRFDNPL------------PI----KAPVH--TEEPKSYNGLQEEEKATQR
KLLA0C06182g       AAGSNGPVSTNSEGAI------------PT----PSINNIVQQPDITHQQQQQQLLQGHN
NCAS0D02130        NSASTGFSVASFDNPL------------PAVQNQQPLPVQPQPQPQPHPQPQPQPQSQQS
KLTH0C10956g       -GGSKGFSVASLNNPL------------PA-----------------------QQQMLHS
Kwal_56.22462      -GGSKGFSVASLNNPL------------PM--------------------QQQQQQQQQQ
SAKL0E01540g       TPSGTGFSVASLNNPL------------PE---------------------QQQQQQQQQ
ACL004W            GSIANGFAVGRLEGAV------------PV-----------------------------S
Ecym_3033          GGVSNGFSMSSLDNPL------------PQ------------------QEFQEQSQHQQQ
TPHA0J00400        NVNSNSLSVASFDNPL------------PV--------KTETTPAISAETSIPNVNTTYS
Kpol_1037.22       ---STTLSVASFDNPL------------PP------------------------APAAHL
ZYRO0C07524g       RSGSAGMSVASFDNPL------------PP----SQPS---V-PSLHYQMLSSQQQQEQK
TDEL0G04400        RQNSVGLSFASFDNPL------------PP---------------QQQTILSSSHFQVLP
                                                                               

CAGL0J11594g       ------------------------------------------------------------
TBLA0E03160        PHQQQKQKQQSLQSNSNKLDMSNKENKNIKPNMGMIPVSNLNQETDATTATTTANTMPNN
CAGL0E02475g       ILQQDQQEILQNQRQ---------------------------GSTGASETSTTQSPLVSG
KNAG0F02920        QQQQQQMVASVSAMG---------------------------------------------
NDAI0C02660        PNIQQQQQQQSLPHQ--------------------------------LIQSQQPQLQQQP
KAFR0A05120        RDQQQQQQMAAAPAA---------------------------------------------
Skud_15.158        QIQDQRPAAHSANAS-------------------------------EPSSNYVDTSYSVN
Suva_15.171        ------------------------------------------------------------
Smik_15.166        TQDHKEVSAGAQPTDATK----------------------SANDHIDTNDDNNNNNSNNN
YOL004W            PQDCKEVPAGVQPAD----------------------------APDPSSNHADANDDNNN
KLLA0C06182g       VQVENAMTVGQDPLQ---------------------------------------------
NCAS0D02130        QQAQQAQQAQPQPQQ--------------------------------------------P
KLTH0C10956g       QQQQQLLQQGVLPLE---------------------------------------------
Kwal_56.22462      QQQQQLLQQGVLPLE---------------------------------------------
SAKL0E01540g       QQQQQQQQQQQQP-----------------------------------------------
ACL004W            GTGGPGSPGPQVPAQ---------------------------------------------
Ecym_3033          QHHHHQLDQLQSPA----------------------------------------------
TPHA0J00400        ATAGTTASANDSKES---------------------------------------------
Kpol_1037.22       QQQQQQQQQQQQA-----------------------------------------------
ZYRO0C07524g       GQDQQQQHQQQQQQI---------------------------------------------
TDEL0G04400        PHQQQQEQQQQMQQQ---------------------------------------------
                                                                               

CAGL0J11594g       --------------DLKKNLSHEDYNSLISAIRSDI--------DEFSNGESSPDNSIER
TBLA0E03160        TQDSPKEDNQYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIAR
CAGL0E02475g       PAQTQGDPMSYRPLNVKDALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQTIDTPGVIER
KNAG0F02920        ----GGIDSPYRPLNVKDALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNIDTPGVIER
NDAI0C02660        QQQQSEEDPEYRPLNVKDALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIER
KAFR0A05120        ----AEDDASYRPLNVKDALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIER
Skud_15.158        NENSNDEDPDYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIER
Suva_15.171        AENTNDEDPDYRPLNVKDALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAIDTPGVIER
Smik_15.166        NENFNEEDPDYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIER
YOL004W            NENSHDEDADYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIER
KLLA0C06182g       ----QAQYSSYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQR
NCAS0D02130        REQDQFQDLAYRPLNVKDALSYLEQVKYQFSQRPDIYNQFLDIMKDFKSQSIDTPGVIER
KLTH0C10956g       ----HVQDPSYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIER
Kwal_56.22462      ----HVQDASYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIER
SAKL0E01540g       ------QDPSYRPLNVKDALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIER
ACL004W            ------DGSAYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIER
Ecym_3033          ----HQDGSSYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIER
TPHA0J00400        ------DEQFYRPLNVKDALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIER
Kpol_1037.22       ------DGSYYRPLNVKDALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIER
ZYRO0C07524g       ----PLHDQYYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIER
TDEL0G04400        ----MQHDAYYRPLNVKDALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDR
                                 :.*. *:: :  .     .. :        .::..   .. . * *

CAGL0J11594g       VIKGINEQYPHLSSTIRDIFGKD--------PNE----YTTRTCGQNLNVDLIVDELCGI
TBLA0E03160        V-SSLFHDYPSLIQGFNTFLPQGYRIECSSNPNL--PITVITPMGTTTVSGVLETSVTEN
CAGL0E02475g       V-SSLFKGYPNLIQGFNTFLPQGYRIECSNNPND--PIKVTTPMGSSTTVLNTAPQKSPS
KNAG0F02920        V-STLFKGFPALIQGFNTFLPQGYRIECSSNPNE--PIKVTTPMGV-----LENVRGSDI
NDAI0C02660        V-STLFKGYPVLIQGFNTFLPQGYTIHCSDNPDD--PVRVTTPMGTSTYTNLPNVDNTNV
KAFR0A05120        V-STLFRGYPSLIQGFNTFLPTGYRIDCPSNPND--PIKVTTPIGSSTLHEMTRSVQRAN
Skud_15.158        V-STLFRGYPILIQGFNTFLPQGYRIECSTNPDD--PIRVTTPMGTTTVNNNVSPSGRGT
Suva_15.171        V-STLFRGYPILIQGFNTFLPQGYRIECSTNPDD--PIRVTTPMGTTTVNNNVSPPARSA
Smik_15.166        V-STLFRGYPILIQGFNTFLPQGYRIECSTNPDD--PIRVTTPMGTTTVNNNISPPERGT
YOL004W            V-STLFRGYPILIQGFNTFLPQGYRIECSSNPDD--PIRVTTPMGTTTVNNNISPSGRGT
KLLA0C06182g       V-TTLFQGFPNLIQGFNTFLPHGYKIECSTNPND--PIKVTTPFGTTGEVSAGPPTQYQL
NCAS0D02130        V-SALFRGYPMLVQGFNTFLPQGYRIECTTDPDG--PIRVTTPMGTSTLSGGPAMEAPSS
KLTH0C10956g       I-STLFKGYPILIQGLNTFLPQGYKIECTLNPNDPHSIKVTTPFDNARELNLATMATGNG
Kwal_56.22462      I-STLFKGYPVLIQGLNTFLPQGYKIECTSNPHDPHSIKVTTPFDTTRELSLDHNTGGSA
SAKL0E01540g       V-SNLFQGYPNLIQGFNTFLPQGYKIECSSNPNDPHPIKVTTPFGTTGSVTLNTAPLEQR
ACL004W            V-STLFHGYPALIQGFNTFLPHGYNIECPSDPND--PIKVTTPFGT---IGEIPITGAGG
Ecym_3033          V-STLFQGYPTLIQGFNTFLPQGYNIECSSDPND--PIKVTTPFGTTGEVAIGGGGGSGV
TPHA0J00400        V-STLFRGYPSLIQGFNTFLPQGYTIECTNNPND--PIKVTTPIGSETIPYAKPIPSAAT
Kpol_1037.22       V-STLFRGYPNLIQGFNTFLPQGYTIECSSNPDD--PIKVTTPLGSQIVTNSSIAKPASA
ZYRO0C07524g       V-STLFRGYPNLIQGFNTFLPQGYRIDCSQNPDE--PIKVTTPMGSSTVAGVAEMNQAAL
TDEL0G04400        V-STLFKGYPGLIQGFNTFLPQGYRIECSANPDE--PIRVTTPMGSSSVAGTIENAVAGF
                   : . :   :* * . :. ::  .        *       .  . .               

CAGL0J11594g       LENKQ-------------------------------------------------------
TBLA0E03160        QNHQLQHSL---PQPSTTASASNVDSKVSSISGIMGPSNITEQSQQQQRHHPQQLINVND
CAGL0E02475g       PSDIQ--------------------------TNNQQTQAIAQEAQLQSQ-----------
KNAG0F02920        TADQQPAIG-----------------------------QLPTTQSPIQASLP--------
NDAI0C02660        SPTL---------------------------PTVQPLLQQPQPQGNNDTTNVINNAANQP
KAFR0A05120        SNLQQQQALSQ--------------------NNMMQQAQIPIGSISNNANL---------
Skud_15.158        VDGQEPSSL---SEPDG--------------NAIQPFHNLPMVPSNVYRSEQS-------
Suva_15.171        LEPQEPSSL---PEADG--------------STIPQSHNVPMVPSNVYHSEQS-------
Smik_15.166        IDAQEPSSL---PEADG--------------NGTQRSHNVPMVPSNVYHSEQN-------
YOL004W            TDAQELGSF---PESDG--------------NGVQQPSNVPMVPSSVYQSEQN-------
KLLA0C06182g       APVAGQNVENQNIEMQQQVSQPQFNN-----GDQIQHQQLQDQLQNQSATSAAMLVS---
NCAS0D02130        SESN---------------------------LQQQQHHQSPTIPSLAAS-----------
KLTH0C10956g       IVEGHPSLMPS--------------------DDVSPPKLVGHEPAAVQPKLENAPTN---
Kwal_56.22462      VGGHLAGPA----------------------TVSTSPSQIPRQETAVSETKQEETPV---
SAKL0E01540g       YPSNENVLL----SPDH--------------LQLQQHHSVLQQEQQQPQ-----------
ACL004W            NHAHGANTE----------------------PRLQSTQNVPTVYRS--------------
Ecym_3033          CGHVVPRAE-----PLQ--------------QQLRQHQQPATVAEAAAAAAAAAGGGGGG
TPHA0J00400        NTNVPGPTTSTSPPTAATTTGTTT-------PVAANTTAIPNITRNKETNAIENVATAAQ
Kpol_1037.22       SPSAPSTTV--APTSTATTPATTATASTATVTATAPTAAANNTAATTTTTAPAPAPAP--
ZYRO0C07524g       FQGQQPRIQ-QHLQPLSFPPSQDYQLQ----QQQQPQQQVPFEQARGQQVLPATFPPPAE
TDEL0G04400        PAQPRIQQLQQLGQQQ---------------EQSLPEHVLPGVQVTTSATTTPTLNN---
                                                                               

CAGL0J11594g       ------------------------------------------------------------
TBLA0E03160        SAPISGSISSTVPSNVEPTNMNAAANAAISAASALPNTNTPKSQT---------------
CAGL0E02475g       -------------------------------ATPIPTQHDVGQNF---------------
KNAG0F02920        --------------PPQSA------------HLHLPSTVAAATTV---------------
NDAI0C02660        QQVHAQTHLQEQTQAQTPA------------DADAQAQAEVQAQV---------------
KAFR0A05120        -------------------------------NAAVQSVDDQAKQA---------------
Skud_15.158        -------QDQKQSLPLSAN------------SVGLSSIHPPEIPP---------------
Suva_15.171        ------QDQQQQPLPLLAN------------PSGLPSIHQPELPI---------------
Smik_15.166        -------QDQQQVLPLSAT------------STGLPSIQQSEIPV---------------
YOL004W            -------QDQQQSLPLLAT------------SSGLPSIQQPEMPA---------------
KLLA0C06182g       -QPQSQTQPQQLHSQQSPQ------------QQGQPPQRQAQQQP---------------
NCAS0D02130        -------------------------------TFQESNFQQTPQPE---------------
KLTH0C10956g       ------LPVPTTFNQNLPQ------------HEQQNQQHGSQSPA---------------
Kwal_56.22462      -----DLPASAAFAQDQVH------------HAESDTQREIQKSA---------------
SAKL0E01540g       ------PQPQQQPQPQTQT------------QTQTQTQTQQQHYP---------------
ACL004W            -------------------------------AEGSPAAIATPATT---------------
Ecym_3033          AIAGGGPPPQAQTLVVYQS------------TDGSPTM--PQRQP---------------
TPHA0J00400        PSLLPNLGTPSHTEVTKSE------------SVIQSSANAPIQPN---------------
Kpol_1037.22       -APAPAAGPTVAPAPVVAT-----------AHAAVTTADAESKKPAVLQVSNTNTGISSP
ZYRO0C07524g       NAPQQQLQHQQQQQQASST------------HVQPPTVGPPSQQP---QQQQPQHGSPQP
TDEL0G04400        ------QQPQPQPRPQLPA------------DYQLPLQPAAGQQS---------------
                                                                               

CAGL0J11594g       ------------------------------------------ITYIERV-----------
TBLA0E03160        -TPPIATAGTATQQFPMVSSVSPPLQELPEQRRTQDVEFSQAISYVNKIKNRFANQPYIY
CAGL0E02475g       ----------------------------GSAKKPADVEFSQAITYVNKIKTRFADQPDIY
KNAG0F02920        -------------------QQSANVHAENEPKKANDVEFSQAISYVNKIKNRFSDQPDIY
NDAI0C02660        --------------QAHAQAQAQAQAQMQAQNQNPEVEFSQAINYVNKIKTRYADQPFIY
KAFR0A05120        ------------------------------NKKPADVEFSQAINYVNKIKNRFADQPDIY
Skud_15.158        ---------------HHQILQGQSLPVQEDAKKNVDVEFSQAISYVNKIKTRFADQPDIY
Suva_15.171        -------------------PQSQPLTAQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIY
Smik_15.166        ---------------HHQIPQIQPLAVQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIY
YOL004W            ---------------HRQIPQSQSLVPQEDAKKNVDVEFSQAISYVNKIKTRFADQPDIY
KLLA0C06182g       ---QPPQLENQFVNQKIVAAGGGMLGALPGQQKTGEVEFSHAISYVNKIKTRFADQPDIY
NCAS0D02130        ----------------------------DQSAKNAEVEFSQAINYVNKIKNRFADQPDIY
KLTH0C10956g       -----------------MPQQQRQDQQFMGNRPSGDVEFSHAISYVNKIKTRFADQPEIY
Kwal_56.22462      -----------------QLQQSQQDQQYATNRPNGDVEFSHAISYVNKIKTRFADQPDIY
SAKL0E01540g       ----------------------DQQDQHYLAKKGGDVEFSHAISYVNKIKTRFAEQPDIY
ACL004W            -----------------------QEQYGTGPKKAGDVEFSHAISYVNKIKTRFAEQPDIY
Ecym_3033          -----------------------QDQFGTGGKKTGDVEFSHAISYVNKIKTRFADQPDIY
TPHA0J00400        -------------------MHNMTQDTMKITEKPADVEFSQAVSYVNKIKNRFVDEPDIY
Kpol_1037.22       SSTIPA-------GTVPGTTVANNIQGTTQIEKPADVEFSQAVSYVNKIKNRFADQPDIY
ZYRO0C07524g       APQPTSAVSSGTGPTQPEVPAPVQPQLADQTKKAADVEFSQAISYVNKIKNRFSDQPDIY
TDEL0G04400        -----------------------QLPSNDQGKKTADVEFSQAINYVNKIKNRFAEQPDIY
                                                             :.*::.:           

CAGL0J11594g       -----LYSDLSRDEK-----ISKLSIALKDEPKVLEKLLALIPTGVIDPRQSTEKNEE--
TBLA0E03160        KHFLEILQTYQREQKPINEVYSQVTVLFQEAPDLLEDFKKFLPDSSANNNGSIVTSQEEN
CAGL0E02475g       KQFLEILQTYQREQKPIHEVYAQVTILFQNAPDLLDDFKKFLPDSSASGSEETQVQQQQH
KNAG0F02920        KNFLEILQTYQREQKPINEVYAQVTVLFHNAPDLLDDFKKFLPDSSASNEQQPKQSPYSP
NDAI0C02660        KHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLLEDFKKFLPE-TPANNQPVQQPHAHP
KAFR0A05120        KNFLEILQTYQREQKPINEVYAQVTILFQNAPDLLDDFKKFLPDSSKEQQYTGQLPQQIP
Skud_15.158        KHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKFLPDSSASANQQVQHAQQHA
Suva_15.171        KHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKFLPDSSASANEQVQHAQQHA
Smik_15.166        KHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKFLPDSSASANQQVQHAQQHA
YOL004W            KHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKFLPDSSASANQQVQHAQQHA
KLLA0C06182g       KQFLEILQTYQREQKPIHEVYAQVTILFQNNPDLLDDFKKFLPDSSVSQQQQEQQQEPQQ
NCAS0D02130        KRFLEILQTYQREQKPINEVYSQVTVLFQHAPDLLDDFKKFLPESSGTTSTSELPQNAGI
KLTH0C10956g       KHFLEILQTYQREQKPIHEVYAQVTSLFQNAPDLLDDFKKFLPDATAAHEQQQLLLQQQQ
Kwal_56.22462      KHFLEILQTYQREQKPIHEVYTQVTSLFQNAPDLLDDFKKFLPDATAAHEQHQQLLQQQQ
SAKL0E01540g       KHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKFLPDASAPQSTTTPAPVNG-
ACL004W            KHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKFLPDSSAPQLQSHQQIN---
Ecym_3033          KHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKFLPDASAPQAQQQHLAQSHP
TPHA0J00400        KTFLEILQTYQKEQKPIHEVYSQVTILFQNAPDLLDDFKKFLPDNNNSAGAETNQNIQAN
Kpol_1037.22       KHFLEILQTYQREQKPISEVYAQVTVLFQNAPDLLDDFKKFLPDSSPSVTTQQPVQPQQQ
ZYRO0C07524g       KHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKFLPDSSASAAQQQRQQLQPV
TDEL0G04400        KHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKFLPDSSPSANRQQQQPGVLQ
                        : .  ..::*       :::  ::  *.:*:.:  ::*                 

CAGL0J11594g       ------------------------------------------------------------
TBLA0E03160        FMY---------------------------ANGFNQQQPHL-------------------
CAGL0E02475g       YQSLSDKMGGNAEAANYA------------ASGMNAQTGYY-------------------
KNAG0F02920        QVYSGADMA---------------------RGYMYNNTGVY-------------------
NDAI0C02660        QLQQL-------------------------QPRIPSISQQQ-------------------
KAFR0A05120        N-----------------------------QEQLEEFSGSY-------------------
Skud_15.158        QQQQEAQMHAQTQAQAQVQAHA--------QAEVEQQQQKH-------------------
Suva_15.171        QQQQEAQMHAQAQAQAQAQAQAHAQAQAQAQAQAQAQAEAEQQQQQQQQQQQQQQQQQQQ
Smik_15.166        QQQQDAQMQAQAQAQMQAQAQAQAQAQVQAQAQAQAQAQAQ-------------------
YOL004W            QQQHEAQMHAQAQAQAQA------------QAQVEQQKQQQ-------------------
KLLA0C06182g       QQQDQQQEHQQDQEQQHHEQKQQPLPQDQNQQAMLPPQPYL-------------------
NCAS0D02130        QQRAAIPT----------------------PNPKHQQYGYP-------------------
KLTH0C10956g       QQQQQLQ-----------------------QQQIQQHQSHY-------------------
Kwal_56.22462      QQQQLQHQIQL-------------------QQQQSQQYQSF-------------------
SAKL0E01540g       ------------------------------------------------------------
ACL004W            ------------------------------GAMVAPGFGHA-------------------
Ecym_3033          QLNGALTPSSFYHSQQQQGP----------QPQQDQSQSQH-------------------
TPHA0J00400        AMQYQQLHQNNVAI----------------PQHIYENNTYY-------------------
Kpol_1037.22       ALPQQQ------------------------QPMYGVNNGYY-------------------
ZYRO0C07524g       MQHQ--------------------------QAAAATGYGYY-------------------
TDEL0G04400        Q-----------------------------QSPAFGLSAYY-------------------
                                                                               

CAGL0J11594g       ------------------------------------------------------------
TBLA0E03160        ------------------------------------------------------------
CAGL0E02475g       ------------------------------------------------------------
KNAG0F02920        ------------------------------------------------------------
NDAI0C02660        ------------------------------------------------------------
KAFR0A05120        ------------------------------------------------------------
Skud_15.158        ------------------------------------------------------------
Suva_15.171        QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ
Smik_15.166        ------------------------------------------------------------
YOL004W            ------------------------------------------------------------
KLLA0C06182g       ------------------------------------------------------------
NCAS0D02130        ------------------------------------------------------------
KLTH0C10956g       ------------------------------------------------------------
Kwal_56.22462      ------------------------------------------------------------
SAKL0E01540g       ------------------------------------------------------------
ACL004W            ------------------------------------------------------------
Ecym_3033          ------------------------------------------------------------
TPHA0J00400        ------------------------------------------------------------
Kpol_1037.22       ------------------------------------------------------------
ZYRO0C07524g       ------------------------------------------------------------
TDEL0G04400        ------------------------------------------------------------
                                                                               

CAGL0J11594g       ------------------------------------------------------------
TBLA0E03160        ------------------------------------------------------------
CAGL0E02475g       ------------------------------------------------------------
KNAG0F02920        ------------------------------------------------------------
NDAI0C02660        ------------------------------------------------------------
KAFR0A05120        ------------------------------------------------------------
Skud_15.158        ------------------------------------------------------------
Suva_15.171        QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ
Smik_15.166        ------------------------------------------------------------
YOL004W            ------------------------------------------------------------
KLLA0C06182g       ------------------------------------------------------------
NCAS0D02130        ------------------------------------------------------------
KLTH0C10956g       ------------------------------------------------------------
Kwal_56.22462      ------------------------------------------------------------
SAKL0E01540g       ------------------------------------------------------------
ACL004W            ------------------------------------------------------------
Ecym_3033          ------------------------------------------------------------
TPHA0J00400        ------------------------------------------------------------
Kpol_1037.22       ------------------------------------------------------------
ZYRO0C07524g       ------------------------------------------------------------
TDEL0G04400        ------------------------------------------------------------
                                                                               

CAGL0J11594g       ------------------------------------------------------------
TBLA0E03160        ----------------------------TPHSE----------IQAQNLPPLGSFSTQPN
CAGL0E02475g       ----------------------------EPVKGGVSYNTQQNQHQQQNLPPIGSFSPPTN
KNAG0F02920        ---------------------------YPPQVN----------QPQSNLPPIGSFSPPAN
NDAI0C02660        -----------------------QPSQLYPFSNNGPVPSGFYQIPQQNLPPIGSFSPPTA
KAFR0A05120        --------------------------ARPPNAP-------LDMVAQQSLPPIGSFSPPAN
Skud_15.158        -------------------QQKQQPQFLYPASS-YYNHSTNRGVPQQNLPPIGSFSPPTN
Suva_15.171        QQQQQQQQQQQQQQQQQQQQQQQQQQFLYPASN-YYSHSTNGGIPQQNLPPIGSFSPPTN
Smik_15.166        -------------------AEQQQQQFLYPASS-YYGHSNNRGIPQQNLPPIGSFSPPTN
YOL004W            -------------------------QFLYPASG-YYGHPSNRGIPQQNLPPIGSFSPPTN
KLLA0C06182g       -----------------QQNQSMQGQGFYPQSG--------VLMQPTNLPPLGNFSASGQ
NCAS0D02130        -------------------------NNYYPNGT----------GTQQNLPPIGSFAPPNG
KLTH0C10956g       -------------QNASQDLDQRQQHTHQPFGN-TVPFYQTQQGRPQNLPPLGSFSPPIN
Kwal_56.22462      -------------QSSPQELDQRQQQSNSPFNH-PASFYQHQQARAQNLPPLGNFSPPIN
SAKL0E01540g       -------------------------GTFYPQAA-----------PQQNLPPLGSFSPPSS
ACL004W            ---------------------QSGLQQALPGTQ--------PLMHQQNLPPLGNFSTPGD
Ecym_3033          ------------------PVQQQQQQQQQQQQQ--------TVIHQQNLPPLGSFSTPGD
TPHA0J00400        -------------------------QNNVPTAAAAAANAAGNVVTIQSLPPLGNFLPPSN
Kpol_1037.22       ------------------------QAGKIPSAN-------------QNLPPLGNFSPPSN
ZYRO0C07524g       -------------------------GENQPVAR-------------QNLPPLGSFSPPPN
TDEL0G04400        ------------------------NETSPPTSR-------------QNLPPLGSFSPPPN
                                                                               

CAGL0J11594g       ------------------------------------------------------------
TBLA0E03160        GVFPKQES--QQIVPTSRFDANN--DQLAQQQHRHQ-----QQQQQI-------------
CAGL0E02475g       GPFVDQTQ------QSANPETQK--GVMSLPSMMNNAEAVKEQAIKQAHSRLISDSHDHN
KNAG0F02920        GVAPTTGT------AIPHADEQH--VVAGVPAMAPH-----EQQHAP-------------
NDAI0C02660        TNANATTTPAAGTVVNNFRHGIS--MQTALPSMMTP-----DTEAIP-------------
KAFR0A05120        TGI----S-------MHDQSQRP--HMMALPSMLQH-----EQIIDM----------NNH
Skud_15.158        GST-------------VHDNYQD--QQHMQPPHLVP-----LPSMVQ-------------
Suva_15.171        GST-------------THEGFQD--QQHMQPPHLMP-----LPSMVQ-------------
Smik_15.166        GST-------------VHENYQD--QQHMQPPHLMP-----LPSMVQ-------------
YOL004W            GST-------------VHEAYQD--QQHMQPPHFMP-----LPSIVQ-------------
KLLA0C06182g       ASP------------------AE--NSHMLPSMHQH-----IAGGHV-------------
NCAS0D02130        TAS------------REYAPGNQFVGPGGLPSMIPN-----DQALQQ-------------
KLTH0C10956g       GRE------------------ND--PQLNLPAVQPPAMEFASQQVPH-------------
Kwal_56.22462      GRD------------------NE--AQVNLPAVQPPALDFPPQQQSQ-------------
SAKL0E01540g       GSA-----------------REG--EHVGLPAVQPP-----SMDISG------------Q
ACL004W            H------------------------HPMSLPSVQGP-----NVGLSQ------------G
Ecym_3033          H------------------------HPMNLPLVQAP-----NMNLNQ------------G
TPHA0J00400        KNN-------------NTTAVNN--NLMGISSIMHP-----KVDHIQSQQYIADQKQAYT
Kpol_1037.22       GAVPGRPE-------EFSTEAQH--HMMALPSMLQA-----PTEHAQ-----------LH
ZYRO0C07524g       GTA-------------PRDYYQEPSQGMALPPMTHL-----ETQAAK-----------VT
TDEL0G04400        GAVPH----------NYYRDQQP--QTLGLPPVAQV-----ENHIDQ------------R
                                                                               

CAGL0J11594g       ------------------QISSIRSTLSQNT---------DNRCAKFSMLSSK-------
TBLA0E03160        PQQSTMYQNV---HPEVVPVSDLRSQPETMHAPTQAQLHAEAQAQAQAQAQAQVQAQAQA
CAGL0E02475g       SQQQVLSQNI--HSNDDIPVSNLRTTVVEQ----------NYHPETIYQQQGNAQQHMV-
KNAG0F02920        -------SMI---NNDGIQISNMRGGGTV----PALNQYGMISPHDYTQQQAKQVQQFQE
NDAI0C02660        ISNLRSVDGFPPSSGGVIPMPNNQTADFQYQQQQPQPPLTNRLPDQFPLDQQQSQQQQAQ
KAFR0A05120        PKPAVSTQGI---SNDEIPVSDVRMAQYPNGAVPDYGQY-PTHPQMKPDLATQRHILQQQ
Skud_15.158        HGPNMVHQGI---ANENLPISDLRTSLTD-----------QYAPSTFQQQQQNPPSISPI
Suva_15.171        QGPNMVHQGI---VNENIPLSDLRTSLTD-----------QYAPSNFQQQQQQQPSISPI
Smik_15.166        HGANIVHQGI---ANENLPLSDLRTSLTE-----------QYAPSNIQQQQQQHPQSISP
YOL004W            HGPNMVHQGI---ANENPPLSDLRTSLTE-----------QYAPSSIQHQQ-QHPQSISP
KLLA0C06182g       IPQHVVTQGM---SNQDIPVSEMRSTMNG-----------TYNQVEYIQGAPGYPQPLE-
NCAS0D02130        QQQPGLVHGY---TNEAIPVSNLRSPLTD-----------QQYPNLLNMQNQMTPGQMDI
KLTH0C10956g       HPSHVVPQVI---PGGTLPLSDLRGAMDG-----------NFAPQPLQSQ----------
Kwal_56.22462      SHRHVVAQGM---TNNSLPVSDMRGPVDG-----------GFAPQPLYSQ----------
SAKL0E01540g       PQQHIITQGM---SNDDIPISEVRNTADG-----------AYRSDLRNSG----------
ACL004W            QSGHIVTQGV---SNQHIPVSDLRGAPDA-----------SFRASEYNQVQ---------
Ecym_3033          HPAHIITQGM---SNQKIPISDLRTTADT-----------SYRPAEYSQGQ---------
TPHA0J00400        PAQQQSTTQL---TNEAMQISELRGSPMMDGQTARNLANVNYSPAELNQLQAQQHISIQQ
Kpol_1037.22       AQQHIAP--M---TNEAIPISDLRSQIIDNNHVH------NYTPIELAQLQQQQQQQQQQ
ZYRO0C07524g       PSHYVMTQGM---SNDAIPLSNMRSPTVGAPGAQTPVETAPQHPQQYSPQQAPQPQLPQQ
TDEL0G04400        SPPHIATQGI---AGEPMPVSNLRSQIT------------AQSPSELAQLHQQQQIPSQP
                                      :.. .                                    

CAGL0J11594g       ----------------------------DTF-----------------------------
TBLA0E03160        QAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAEAESHQQQMQMQMQLQMQNNIAPDIN
CAGL0E02475g       ----------------------------DGG-----------------------------
KNAG0F02920        DQQQQQQQSMMM----------------DEQ-----------------------------
NDAI0C02660        QQAQQQ----------------------QQQ-----------------------------
KAFR0A05120        EIQQQQLMLQQQQEQELLEQQ-------QQQ-----------------------------
Skud_15.158        T---------------------------DLQ-----------------------------
Suva_15.171        I---------------------------DSQ-----------------------------
Smik_15.166        IA--------------------------NSQ-----------------------------
YOL004W            IA--------------------------NTQ-----------------------------
KLLA0C06182g       ----------------------------GVQ-----------------------------
NCAS0D02130        NNATAPM---------------------AQQ-----------------------------
KLTH0C10956g       ----------------------------DVQ-----------------------------
Kwal_56.22462      ----------------------------DVQ-----------------------------
SAKL0E01540g       ----------------------------EVQ-----------------------------
ACL004W            ----------------------------DVQ-----------------------------
Ecym_3033          ----------------------------DTQ-----------------------------
TPHA0J00400        QQQQQQQQQQQLQMQMQMQM--------DGG-----------------------------
Kpol_1037.22       QQQQQQQQMQL-----------------EAA-----------------------------
ZYRO0C07524g       QLPPQQQEQSLPPQTIPLTQPSQLGPQQEVQ-----------------------------
TDEL0G04400        TANIP-----------------------DGQ-----------------------------
                                                                               

CAGL0J11594g       -------YT---------------------------PIDRPTNMAEFLIYF---RNLVYD
TBLA0E03160        DHQQQVMYE----ENAVRPEIDLDPSLVPIVPEPTQPIEDTLPLVEETNFFDKVKKYIGN
CAGL0E02475g       -------YVGTPSELVVRPEIDLDPSLVPVVPEPTEPIENSLNLMEETNFFERVKKSIGN
KNAG0F02920        -------YG--SGDMQVRPEIDLDPSIVPVVPEPTEPIENNLSLSEETSFFEKVKKNIGN
NDAI0C02660        -------LI---SEAPTRPEIDLDPSIVPIIPEPTEPIENNITLVEETSFFEKVKKFISS
KAFR0A05120        -------YV----EAPVRPEIDLDPSIVPVVPEPTEPIESNFTLIEETSFFDKAKKFINN
Skud_15.158        -------YG----DVPVRPEIDLDPSIVPVVPEPTEPIEDNISLNEEVTFFEKAKRYIGN
Suva_15.171        -------YG----DVPVRPEIDLDPSIVPVVPEPTEPIEDNISLNEEVTFFEKAKRYIGN
Smik_15.166        -------YG----DVPVRPEIDLDPSIVPVVPEPTEPIEDNISLNEEVTFFEKAKRYIGN
YOL004W            -------YG----DIPVRPEIDLDPSIVPVVPEPTEPIENNISLNEEVTFFEKAKRYIGN
KLLA0C06182g       -------YM---EAPMARPEIDLDPSLVPVVPEPIQPPEDAIALGDEVTFFERVKRFIGN
NCAS0D02130        -------YT---NEAPIRPEIDLDPSIVPVIPEPTEPLEYNVSLVEETNFFEKAKKFIGT
KLTH0C10956g       -------FI----EPTSRPEIDLDPSLVPVIPEPIKPLENDLTLIEETSFFDRAKKYMGN
Kwal_56.22462      -------YM----EPTSRPEIDLDPSLVPVIPEPIRPLENDSTLIEETSFFDKAKKYMGN
SAKL0E01540g       -------YM----EPVARPEIDLDPSLVPVIPEPIEPMENEVSLVEETSFFDKAKKFIGN
ACL004W            -------YM----EPTVRPEIDLDPSLVPVIPEPIKPLEDELNLVEEATFFDKAKKFIGN
Ecym_3033          -------YM----ETNARPEIDLDPSLVPVIPEPIKPLEDELNLVEEASFFDKAKKYIGN
TPHA0J00400        -------YP---QDISVRPEIDLDPSIVPVIPEPVEPIEDSLSLVEETNFFDKAKKFINN
Kpol_1037.22       -------YA---TEGIVRPEIDLDPSIVPVIPEPTEPIEESLSLVEEANFFDKAKKFIGN
ZYRO0C07524g       -------YV----DIAVRPEIDLDPSIVPVVPEPTEPIEDSLSLVEETSFFDKAKKFIGN
TDEL0G04400        -------YL----DIAVRPEIDLDPSIVPVVPEPTAPIEDSLTLVEETSFFDRAKKFIGN
                                                       * :    : :   :*   .. :  

CAGL0J11594g       ESIYPEFLKLMNLFAQSLIDLNTFTKRAYIFFGSHNGLKTAFGNIMSEYKDIHQRMKPTL
TBLA0E03160        KTIYAEFLKVLNLYSVDLLEVDELVEKIKYYLNDNEELFSWFKNFVG-YVEKPKHIENIV
CAGL0E02475g       KQIYNEFLKILNLFSLDLLTVDELVDKVEYYIGANKELFDWFKVFVG-YQDKPKRIENIV
KNAG0F02920        RQIYIEFLKVLNLFSQDLIAVDELVTKVENYLAGQPELFEWFKNFVG-YQDKPKIIENVI
NDAI0C02660        KPIYMEFLKVLNLYSQDLLSTNELVTRVDYYIGSNKELFDWFKTFVG-YSEIPSTIENII
KAFR0A05120        KQIYTEFLKVLNLFSQDLISVDDLVNKVEYYIGSSKELFEWFRNFVG-YQGNPKIIENIV
Skud_15.158        KHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVG-YQEKTKCIENIV
Suva_15.171        KHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVG-YQEKIKSIENVV
Smik_15.166        KHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVG-YQERTKFIENIV
YOL004W            KHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFTWFKNFVG-YQEKTKCIENIV
KLLA0C06182g       KQVYAEFLKILNLYSQDLLTTSELVSKVEFYLHSSKELFDWFKSFVG-YQEKPKHIENIV
NCAS0D02130        KQVYTEFLKILNLYSQDLLTTDELCVKVEYYLGSNEELFTWFKNFVG-FQEKPLIIENIV
KLTH0C10956g       KQVYTEFLKILNLFSQDLIGTEELVDKVEHYLGGSPELFDWFKSFVN-YVEKPKHIENVI
Kwal_56.22462      KQVYTEFLKILNLFSQDLIDTDELVDKVEHYLGGNSELFDWFKSFVN-YVERPKHIENVV
SAKL0E01540g       KQIYTEFLKILNLYSQDLLDRDELVEKVEYYLGGNKELFDWFKNFVG-YEKKPKHIENIV
ACL004W            KQIYTEFLKILNLYSQDLLEKEKLVEDVSHYLSGSPELFDWFKSFVG-YQERPKHIENVI
Ecym_3033          KQIYTEFLKILNLYSQDLLDKERLVEKVGHYLSGCPELFDWFKSFVG-YQEKPKHIENIV
TPHA0J00400        KQIYMEFLKILNLYSQNILNVNELVEKVQYYLGSNKELFDWFKGFVG-YQDKPKHIENIV
Kpol_1037.22       KQVYVEFLKILNLYSQDILSLDDLIEKVDYYLGSNKELFDWFKNFVG-FQDKPKHIENVV
ZYRO0C07524g       KQLYTEFLKILNLYSQDLLDIDGLVEKVEHYLGGSKELFTWFKNFVG-YQDRPKNIENVI
TDEL0G04400        KQIYTEFLKILNLFSQDLLDVDELVGRVEHYLGGNKELFVWFKNFVG-FQDKPKHIENIV
                     :* ****::**:: .::  . :      ::     *   *  ::. :      ::  :

CAGL0J11594g       KSNDFDDIEDFSTESGPSYKRLSGFETRASCHGRDRLCHEVLNDEWVGHPVWASEEVGFI
TBLA0E03160        HEKHKLDL-DLCEACGPSYKKLPKTDTLMPCSGRDEMCWEILNDEWVGHPVWASEDSGFI
CAGL0E02475g       HEKHKLDL-DLCEAYGPSYKKLPKTDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFI
KNAG0F02920        HEKHRLDL-DLCEAYGPSYKKLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFI
NDAI0C02660        HEKHKLDL-DLCEAYGPSYKKLPKTDTFMPCSGRDAMCWEVLNDEWVGHPVWASEDSGFI
KAFR0A05120        HEKHRLDL-DLCEACGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFI
Skud_15.158        HEKHRLDL-DLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEILNDEWVGHPVWASEDSGFI
Suva_15.171        HEKHRLDL-DLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFI
Smik_15.166        HEKHRLDL-DLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFI
YOL004W            HEKHRLDL-DLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFI
KLLA0C06182g       HEKHRLDL-DLCEACGPSYKKLPKDDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFI
NCAS0D02130        HEKHKLDL-DLCEACGPSYKKLPKTDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFI
KLTH0C10956g       HEKHRLDL-DLCEACFPSYKKLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFI
Kwal_56.22462      HEKHRLDL-DLCEACCPSYKKLPKADTFMPCCGRDEMCWEVLNDEWVGHPVWASEDSGFI
SAKL0E01540g       HEKHRLDL-DLCEACGPSYKKLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFI
ACL004W            HEKHRLDL-DLCEACGPSYKRLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFI
Ecym_3033          HEKHRLDL-DLCEACGPSYKRLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFI
TPHA0J00400        HEKHKLDL-DLCEAYGPSYKKLPKTDTFMPCSGRDEMCWEVLNDDWVGHPVWASEDSGFI
Kpol_1037.22       HEKHKLDL-DLCEACGPSYKKLPKTDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFI
ZYRO0C07524g       HEKHRLDL-DMCEASGPSYKKLPKSDTFMPCSGRDEMCWEVLNDEWIGHPVWASEDSGFI
TDEL0G04400        HEKHRLDL-DLCEACGPSYKKLPKSDTFMPCSGRDEMCWAVLNDEWVGHPVWASEDSGFI
                   :.:   *: *:.    ****.*.  :*  .* *** :*. :***:*:********: ***

CAGL0J11594g       AHKKNQYEETLFKVEEERHEYDFFLLSVEHLIVKFTEYEKSLQLSKDDGRRRNRVSSPKE
TBLA0E03160        AHRKINTKKPYLRLKKKVHEYDFYIESNLRTIQTLETIASKIANMTENEKCNFKL--PDG
CAGL0E02475g       AHRKNQYEETLFKIEEERHEYDYYIESNLRTIQTLETIANKIANMTDAEKAQFRL--PPG
KNAG0F02920        AHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKNMFKL--PPG
NDAI0C02660        AHRKNQYEETLFKIEEERHEYDFHIESNLRTIQTLETIANKINNMTAEEKKNFKL--PVG
KAFR0A05120        AHRKNQYEETLFKIEEERHEYDYYIESNLRTIQTLEAIVNKISNMSEEEKKNFKL--EPG
Skud_15.158        AHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTESEKSDFKL--PPG
Suva_15.171        AHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKANFKL--PPG
Smik_15.166        AHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKVNFKL--PPG
YOL004W            AHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKANFKL--PPG
KLLA0C06182g       AHRKNQYEDTLFKVEEERHEYDFYIESNLRTIQTLETIANKIANMTNEEKNNFKL--PPG
NCAS0D02130        AHRKNQYEESLFKTEEERHEYDFCIESNLRTIQTLETIANKIGNMTNEEKKNFKL--PPG
KLTH0C10956g       AHRKNQYEETLFKIEEERHEYDYYIEANLRTIQLLETIANKISNMTPEEKQAFKL--PPG
Kwal_56.22462      AHRKNQYEETLFKIEEERHEYDYYIEANLRTIQLLETIANKISNMTVEEKKTFKL--PPG
SAKL0E01540g       AHRKNQYEETLFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKATFKL--SPG
ACL004W            AHRKNQYEDTLFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKAAFKL--PPG
Ecym_3033          AHRKNQYEDTLFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKATFKL--PPG
TPHA0J00400        AHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEERANFKL--PIG
Kpol_1037.22       AHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKQAFKL--PIG
ZYRO0C07524g       AHRKNQYEETLFKVEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKANFKL--PPG
TDEL0G04400        AHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMSEEEKATFKL--PPG
                   **.* : :.. :. ::: ****: : :  . *  :    ..:   .   .   .:     

CAGL0J11594g       PMISLNSITEKVIRRLYGIEHGNILIDAIKTNPEKVVPTILKTAKEKYQQWNSAKNEWNK
TBLA0E03160        LGHTTSTIYKKVIRKVYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNK
CAGL0E02475g       LGHTSMTIYKKVIRKVYDKERGFEIIDALHNYPAISVPIILRRLKQKDEEWRRAQREWNK
KNAG0F02920        LGHTSLTIYKKIIRKVYDKERGFEIIDELHEHPAITVPIVLKRLKQKDEEWRRAQREWNK
NDAI0C02660        LGHTSSTIYKKVIRKVYDKERGFEIIDALHEHPAFAVPIILRRLKEKDEEWRRAQREWNK
KAFR0A05120        LGHTSLTIYKKVIRKVYDKERGFEIIDALHEHPAIAAPIVLKRLKQKDEEWRRAQREWNK
Skud_15.158        LGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNK
Suva_15.171        LGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNK
Smik_15.166        LGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNK
YOL004W            LGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNK
KLLA0C06182g       LGHTSLTIYKKVVRKVYDKDRGFEIIDALHEHPAVTVPIVLKRLKQKDEEWRRAQREWNK
NCAS0D02130        LGHTSSTIYKKVIRKVYDKDRGFEIIDLLHEEPALTVPVVLKRLKQKDEEWRRAQREWNK
KLTH0C10956g       LGHTSMTIYKKVIRKVYDKDRGFEIIDALHENPAVSVPIILKRLKQKDEEWRRAQREWNK
Kwal_56.22462      LGHTSTTIYKKVIRKVYDKDRGFEIIDALHENPAVSVPIVLRRLKQKDEEWRRAQREWNK
SAKL0E01540g       LGHTSVTIYKKVIRKVYDKDRGFEIIDALHETPSIAVPIVLKRLKQKDEEWRRAQREWNK
ACL004W            LGHTSVTIYKKVIRKVYDKDRGFEIIDALHEHPAITVPLVLKRLKQKDEEWRRAQREWNK
Ecym_3033          LGHTSVTIYKKVIRKVYDKDRGYEIIDALHEYPAITVPIVLKRLKQKDEEWRRAQREWNK
TPHA0J00400        LGHTSVTIYQKVIRKVYGKERGFELIDALHEYPAVAVPIILKRLKQKDEEWRRAQREWNK
Kpol_1037.22       LGHTSTTIYQKVIRKVYDKERGFEIIDALHEYPSVAVPVVLKRLKQKDKEWRRAQREWNK
ZYRO0C07524g       LGHTSLTIYKKVIRKVYDKERGFEIIDALHEHPAVAVPVVLKRLKQKDEEWRRAQREWNK
TDEL0G04400        LGHTSLTIYKKVIRKVYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNK
                      :  :* :*::*.:*. :.*  :** ::  *   .* :*.  *:* ::*. *:.****

CAGL0J11594g       AWREVEQKAYYKSLDHLGLPFKNAEKRFLNDKQLLLEYKSEKQDKLLKEHY-----DNYE
TBLA0E03160        VWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTHKRMHWLTPKPKSQ
CAGL0E02475g       IWRDLEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEINGIKVDQNSKRIHWLTPKPKNQ
KNAG0F02920        VWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQNNKRMHWLTPKPKKQ
NDAI0C02660        VWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLISEISSIQVDQNNKRIHWLTPKPKSQ
KAFR0A05120        VWRELEQKVYFKSLDHLGLTFKQADKKLLTIKQLISEISSIKVDQNNKRIHWLTPKPKSQ
Skud_15.158        VWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEINSIKVDQTNKKIHWLTPKPKSQ
Suva_15.171        VWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQ
Smik_15.166        VWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQ
YOL004W            VWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQ
KLLA0C06182g       VWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLLSEISSIKVDQTNKRIHPLTPKPKSQ
NCAS0D02130        VWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLLSEISSIKVDQTNKRIHWLTPKPKSQ
KLTH0C10956g       VWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQTNKRIYPFTPKPKSQ
Kwal_56.22462      VWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIKIDQANKRIYPFTSKPKSQ
SAKL0E01540g       VWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLVSEISTIKVDQANKRIHPLTPKPKSQ
ACL004W            VWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQSNKRIHPLTPKAKSQ
Ecym_3033          VWRELEQKVFFKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQNNKRIHPLTPKAKSQ
TPHA0J00400        VWRELQQKVYYKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKLHWLTPKPKSQ
Kpol_1037.22       VWRELEQKVFFKSLDHLGLTFKQSDKKLLTTKQLLAEISSIKVDQTNKRIHWLTPKPKSQ
ZYRO0C07524g       VWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKRIHWLTPKPKSQ
TDEL0G04400        VWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLISEIGSIKTDQTNKRMHWLTPKPKDQ
                    **:::**.::********.**:::*.:*. ***: *    : *:  *  :      : :

CAGL0J11594g       YKYEFFDKSVLYDVKDIILCGLRSNSSTSESQKNLYCQIFEAFFDLLF------------
TBLA0E03160        LDFNLPDKDIIFDILSFVEIFVEHTSTYSNPEKERLIDFMKYFTSLFFSIPLEEIKEAIS
CAGL0E02475g       LDYDFPDYDILFDIIALGFVFTINTNLYSNPDKERIKDMLRVFVSQFFSIPLKEVSDALE
KNAG0F02920        LDYQFNDMDIIFDIVGLTDVFVDHCSTYSNPDKERLKDLFRVFISLFFFIPRDLISAALD
NDAI0C02660        LDFTFNDHDILVDILDLANVFIDHTSTYSNSEKERLKDFLRVFIGLFFSIPSSEIDKKLS
KAFR0A05120        LNFDIKDFEILFDILSLSENFINHSSTYSTSDKERLNDFLKSFISLFFSVPLNEINNALD
Skud_15.158        LDFDFPDKDIFYDILYLADSFISHTTAYSNPDKERLKDLLKYFISLFFSIPLEKIEKALQ
Suva_15.171        LDFDFPDKDIFYDILYLADSFIAHTTAYSNPDKERLKDLLNYFISLFFSIPLEKIEEALQ
Smik_15.166        LDFDFPDKNIFCDILYLADSFISHTTAYSNPDKERLKDLLKYFISLFFSISLEEIEESLQ
YOL004W            LDFDFPDKNIFYDILCLADTFITHTTAYSNPDKERLKDLLKYFISLFFSISFEKIEESLY
KLLA0C06182g       LDFEINDREVLYDILDLVFTFVKTNASYSNSDKIKLDHFFKAFISLFFSYPIKDVNEAVS
NCAS0D02130        LEFQFDDNDIFVDILGLTSVFINHSSTYSNPEKERMKDFLRVFVSLFFSIPLDKVNEALS
KLTH0C10956g       LDYDLKDKGVLFDILCLVNNFIDHSSTYSNPDKEKLAAFFKGFLSVFFSISYQEIE----
Kwal_56.22462      LDFDISDKGVLFDILNLVDTFIDHSTTYSNPDKEKLSAFFRGFLSIFFSIPLTDLD----
SAKL0E01540g       LDYHFKDREVLYDILNLAKVFIDCNTTYSNPDKEKMFDFLKSFLVLFFSYPMYEVETAFA
ACL004W            LSYDFKEPEVFQDILSLVMVFLANNNTYSPSDNERLKDFFKGFISLFFSYPLHEIEEGLL
Ecym_3033          LDHDFTDPEVFYDILNLAIVFLENNNTYSAPDKERLKDFFKGFISLFCSYPVPQIEKALA
TPHA0J00400        LDYKVADRQILYDILKLTDVFINHTSNYSNPDKERLRDFLQSFISLFFFIPLADIKAAIK
Kpol_1037.22       LDYEVKDKRVLFDILRLADVFINHTSSYSNPDKERLRDFLQSYIGLFFSIPIREIKDAVE
ZYRO0C07524g       LDYDFPDREIFCDILSLTEVFLNHTGNYSNSDKERLKDFLKSFLSLFFSIPVSEVNDGLR
TDEL0G04400        LDYYVPDKSVFFDILSLTDTFINHNSSYSNPDKIRLKDLFKIFVSLFFSIPMYEVNEAVS
                    .. . :  :: *:  :           * .::     ::  :   :             

CAGL0J11594g       -------------------------------------------EE-SSFTKHLD------
TBLA0E03160        KRDITEKNDEKLEDKQ-------------KNGEENSKKRTSRDIT-LSLEDILQ-RTKYQ
CAGL0E02475g       RRGFSDDNNNDSDKGSGKMDQIAEEIGETEQDTSSSKKRP-FDND-LNMSDILH-KTKQQ
KNAG0F02920        ----TKSDEGKSTDTK-------------FEKADDSKKRPRPDVE-LSLSDILH-RAKYQ
NDAI0C02660        GKNDEKFEKGSSSSSS------------TSNSTPSAKKRS-LELD-IPLADVLR-KYKYQ
KAFR0A05120        KRNNQKNSEKVTDSAL-------------PDGTENQKKRSIHDIE-LSMSDILH-RTKYQ
Skud_15.158        FHKENVSESSGSDDGG----------------SSTSRKRP-YQQE-MSLLDILH-RNRYQ
Suva_15.171        SYKQNLSDSSGSDDGD----------------SSTPRKRP-YQQE-MSLLDILH-RSKYQ
Smik_15.166        AYKQSVSESSGSDDGG----------------SSVSRKRS-YQQE-MTLLDILH-RSRYQ
YOL004W            SHKQNVSESSGSDDGS----------------SIASRKRP-YQQE-MSLLDILH-RSRYQ
KLLA0C06182g       ERSSITDQENGEEDSN-------------KSDSEKSNKRTLSDEDSYLMKDILR-RTKNA
NCAS0D02130        DRSHWLQEKEKKTKES---SRNIDSTTSSSSSGSNSKKRP-LNID-IPLADILR-KHKYQ
KLTH0C10956g       -----NSTPADSDAVS----------------NSNPRKRL-WESE-QPLKELLRSKHKHH
Kwal_56.22462      ----NPSEEHKVENGD------------------STRKRS-RDDD-QFFRDLLKSKHKQA
SAKL0E01540g       RRRGDIGVQDGEENSG-------------QENSDLSRKRT-REEE-NLLKDVLR-RNKYQ
ACL004W            KRSSQNGTISHGDDTR-------KSKEDPKTEKHSARKRVRDDTE-HLLRDILY-RNKQQ
Ecym_3033          KRDAASSSQSSNSNTE-----TYSEKQQEDGDMKLPKKRNREDSD-RLLRDVLF-RNKQQ
TPHA0J00400        IRSPLDDTKTDSEESS-------------GDSDKFPKKRSIEDDD-ISFHDILD-KVKYQ
Kpol_1037.22       --AAIDNGKQLDENEQ-------------NSSKKNSNKRP-RDVE-ICLSDILN-RSRYQ
ZYRO0C07524g       RRSPSNKEEHEANKKE-------------NGTALAHGKRP-REIE-LPLRDILH-RNKYQ
TDEL0G04400        RRGNLDDDKEDSTQKM-------------ESDNLNNSKRP-REDE-ISLSEVLH-RAKNQ
                                                                   : . *       

CAGL0J11594g       ------------FQFCHNPAISSNSQISEDDVEAMFM--K-GILEEKGLGRWFS----ND
TBLA0E03160        RLK------------YGDDSDEVDGHGNRHDDQKLLE--EEELLRQEAKKPWLLGTLVEE
CAGL0E02475g       KTK---------MNKEMDGSKSPSEDLGTDRNVGTIE--D-SGSLSEHRKQWLVGDVVDS
KNAG0F02920        KLK--------------NGEGLGMSEDDDEEKLAKEA--E-EMSEKNASKPWLVGDIVER
NDAI0C02660        KIKEKVINELENNSNEYDERDEEFDEELKRQQQEQEE--EDHMIDEEMKKPWLLGSVIDK
KAFR0A05120        KMK------LSNRGSDSQEENNIDTIIDEESDERLAE--EADLIRQDAKRPWLLGDIIDK
Skud_15.158        KLK---------RSNDEEGKIPQLSEPLDEESNTIEE--E-ELISEEARNPWLTGNLVEE
Suva_15.171        KLK---------RSNDEDGKVPQLSEPLDEESNAIEE--E-ELINEEAKNPWLTGNLVEE
Smik_15.166        KLK---------RSKDEDGKVPQLSEAPDEESNIIEE--E-ELINEEAKNPWLTGNLVEE
YOL004W            KLK---------RSNDEDGKVPQLSEPPEEEPNTIEE--E-ELIDEEAKNPWLTGNLVEE
KLLA0C06182g       KTS---------NSEENQNSSSVKSNEEDET----------ELLAKEAAKPWLLGSLIDE
NCAS0D02130        KIR-----KQAKESNEENAQEEDDENIVGDSNEELNEQDENEIILEEIKRPWLLGNIIET
KLTH0C10956g       KKR---------DTSAEDDSISDDQNSPEKSPQEIED--E-EVIRQEAKKPWLLGNILDE
Kwal_56.22462      KKK---------TSQQEDESTSDDQDTAAKTSPDLEY--E-EAVRLDAKKPWLLGNILDE
SAKL0E01540g       KGR----------NFAEEEPIPEESEFAEKTVEEKEE--E-EIIRQEAKKPWLLGSIVDE
ACL004W            KV--------------NKGPQNDQSSEEFEKESDIEE--K-EIVRQEAKKPWLLGSIVDE
Ecym_3033          KG--------------GRNSPRGDSSISAEKESDMEE--E-EIIRQEAKNPWLLGSIVDE
TPHA0J00400        KVK---------QGLDKNETFSNDISSATSVDDD-------ELIRQEAQKPWLLGSIVDD
Kpol_1037.22       RLK---------HSLDSSEASLGAVSPGQNEQDDMD-----EMIRQEAKKPWLLGSLVEE
ZYRO0C07524g       KLK---------LRSDGEEGSIGQSEEGLDEQEEVDE--EEEIIKQEAKKPWLLGNIVEE
TDEL0G04400        RFK---------SRAADETS----EESAAEPEPELNE--EEETIRQEAKKPWLLGNLVEE
                                                                 .    *:     : 

CAGL0J11594g       TELKKEFSNRQNINIFCDINIMSLFHYIQTLYERYNDVKIAETTILKDLRTKKRRPSLLA
TBLA0E03160        ANAQGEIMHRNIFNMFSNTNMYIFIRHLTTMYERLHEIKQMNDKVSREISG--RKISKFA
CAGL0E02475g       ANKETPMDNRNIYNLFANTNIYIFFRHLVTLYERLSEVKQINDEINKEIKS--RRVTTFA
KNAG0F02920        ANSHGLVTDRAVYNLFGNTNVYIFIRHWSTLYGRLLELKQMDERVTKEINN--RKVVQFA
NDAI0C02660        TSEHGLIENRHIFNLFANTNIYVFFRHWTTIYERLLELKQINDKVTREINS--RKVTPFA
KAFR0A05120        TNTQGIITDRKKFNLFANTNIYVFLRHWTTLYERLLELKEMNGEVTKEINN--RKSVKFA
Skud_15.158        ANSQGIIQNRSIFNLFANTNIYIFFRHWTTIYERLLEIKQMNGKITKEVNT--RSTVTFA
Suva_15.171        ANSQGIIQNRNIFNLFANSNIYIFFRHWTTIYERLLEIKQMNEKVTKEISK--RSMVTFA
Smik_15.166        ANSQGMIQNRGIFNLFANTNIYIFFRHWTTIYERLLEIKQMNEKVTKEINT--RSTVTFA
YOL004W            ANSQGIIQNRSIFNLFANTNIYIFFRHWTTIYERLLEIKQMNERVTKEINT--RSTVTFA
KLLA0C06182g       ANNSGIVSDRHIFNLFTNTTIYVFFRHLNTLYERLLEVKKIDAEVTDEIKN--RKIVQFA
NCAS0D02130        ASNHGTISNRKVFNMFANTNIYVFFRLWTVIYERLYEMKQINEKVTKEVNS--RRISQFA
KLTH0C10956g       ANDHGYVSNRKIFNLFANTNVYVFFRHLTTMYQRLSEVKNMNEEVTREINS--RNVVQFA
Kwal_56.22462      ANNHGFVSNRKTYNMFANTNIYVFFRHLTTMYQRLSEAKNINEEVTKEINS--RKVVQFA
SAKL0E01540g       ANEHGFVENRKTFNMFANTNIYVFFRHLATLYTRLSEVKDINEAVTEEIKN--RKVVQFA
ACL004W            ADNHGHVSDRVTFNMFANTNIYVFFRHLTTMYERLVEVKKINGEVTKEISN--RKVVQFA
Ecym_3033          ADNHGHVENRKTFNLFANTNIYVFFRHLATIYERLVEVKKMNDEVTKEIAN--RKVVQFA
TPHA0J00400        ANSLGIIQNRSKYNIFGNTNIYVFIRHLITLYERLNEAKQMNAEVTEEIKN--RSIVPFA
Kpol_1037.22       ANSQGLIQNRKIYNMFANVNMYVFMRNLITIYDRLHEVKDINDVVTKEING--RKVVQFA
ZYRO0C07524g       ANAQGIISNRKSFNLFANTSIYVFFRHLTTLYERLIEVKSIDQEVTQEINS--RKVSQFA
TDEL0G04400        VNAQGLINNRKTFNMFANTNIYVFFRHLTTLYERLEEVKKMNDAVTKEINS--RKVVQFA
                   ..    .  *   *:* : .:  ::.   .:* *  : *  :  :  ::    *    :*

CAGL0J11594g       KSLKLLPMQLSDNGLELGQDDGYEWIKTTSKKFLSGNLDHQWFEESLRINFENKAYKLYT
TBLA0E03160        KDLNLISTQLTEMGLDFSEGDVYQQLLVLCKRLILGDLEHQWFEESLRQAFNNKAFKLYT
CAGL0E02475g       KDLGLISTQLSELGLDFNSSDAYQQLLTLSKRLIEGDIEHQWFEESIRQAYNNRAFKLYT
KNAG0F02920        EDLNLLSTQLRDMGLDFDGKNAYQETLKLSKRLIRNELEHQWFEESLRQAYNNKAFKLYT
NDAI0C02660        KDLGLISTQLTMMGLDFKTSDSYKELLNLTKRLIKNDIEHQWFEESLRQAYNNKAFKLYT
KAFR0A05120        EDLGLVSTQLKNMGLDFVDKDSYEELLRLSKRLIENDIEHQWFEESLRQAYNNRAFKLYT
Skud_15.158        KDLDLLSNQLPEMGLDFIGEDAYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAFKLYT
Suva_15.171        KDLDLLSSQLSEMGLDFNGEDAYKQVLKLSRRLINGELEHQWFEEGLRQAYNNKAFKLYT
Smik_15.166        KDLDLLSNQLSEMGLDFIGEDAYKQVLKLSRRLINGDLEHQWFEESLRQAYNNRAFKLYT
YOL004W            KDLDLLSSQLSEMGLDFVGEDAYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAFKLYT
KLLA0C06182g       SDLNLISTQLADMGLAFKDTKAYGELLRLSKRLITGDLDHQWFEESLRQAYKNKAFKIYT
NCAS0D02130        KDLNLISTQLKDMGLDFVGVNSYQELLVLSKRLIQNDIEHQWFEESLRQAFNNKAFKLYT
KLTH0C10956g       KDLNLVSTQLSDMGLDFKGKDAYDQLLTLCKRLIRNDMDHQWFEESLRQAYKNKAFKIYT
Kwal_56.22462      KDLNLASTQLSDMGLDFKGADAYEQLLALCKRLIQSDIEHQWFEESLRQAYKNKAFKIYT
SAKL0E01540g       KDLNLISTQLSDMGLDFEGADAYGQVLTLSKRLIEGDIEHQWFEESLRQAYKNKAFKIYT
ACL004W            KDLNLISTQLTDMGLDFKGADAYEELLRLSRSLISGELEHQWFEESLRQAYKNKAFKLYT
Ecym_3033          KDLNLISTQLTDMGLDFKGEDAYEKLLQLSRSLIAGDLEHQWFEESLRQAYKNKAFKIYT
TPHA0J00400        KDLNLVSTQLKNMGLDFEGTDSYKQLLDLSTRLIEGNLEHHWFEESLRQAFRNKAFKLYT
Kpol_1037.22       KDLNLISAQLKNMGLDFSGGDSYTQLLLLSKRLIEGDLEHQWFEESLRQAYRNRAFKLYT
ZYRO0C07524g       KDLNLISEQLKNMGLDFAGLDAYEQLLHLSKRLIEGDIEHQWFEESLRQAYNNRAFKFYT
TDEL0G04400        KDLNLISQQLKEMGLDFEGADAYEQLRHLCKRLIEGDIEHQWFEESLRQAYNNKAFKLYT
                   ..* * . **   ** :   . *         :: .:::*:****.:*  : *.*:*:**

CAGL0J11594g       IDRVIRNILGVITTISQTPSLLQILDLLVDNMKKLTTTKLQQLTYRTKVRMLMDGVGDMF
TBLA0E03160        LDKVTQALVKHAHTIISDLKTTEIMALFEKDRTKNSTSSKDQILYRLQTRARMTHNENMF
CAGL0E02475g       IDKVVQSFVKHAHTLISDSKTSEIMLLFENQRNNTLTTTKDQILYRIQCRSHMSSTENMF
KNAG0F02920        VDKVVHSLVKHAHTLMTDNKSSELMELFEKDRLQSSTCVKDQILYRLLTRSHMSSTENMF
NDAI0C02660        ADKVIQALVKHANSILTDSKASEIMALFEKDRLRSSTTTRDQIIYRLQTRTHMTNTENMF
KAFR0A05120        VDKVVQALVKHGHTLMTDYKTTEVMKLFEKDRLSSATSAKDQILYRLQARSHMSNTEYMF
Skud_15.158        IDKVTQSLVKHAHTLMADVKTAEIMALFVKDRNAFTTSAKDQIIYRLQVRSYMSNIENMF
Suva_15.171        IDKVIQLLVKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQIIYRLQARSYMSNTENMF
Smik_15.166        IDKVTQSLVKHAHTLMTDAKTAEIMALFVKDRNVTTTSAKGQIIYRLQVRSHMSNTENMF
YOL004W            IDKVTQSLVKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQIIYRLQVRSHMSNTENMF
KLLA0C06182g       IDKVVQSLVKHAHSIITDPKNAMVMVLFEQDRLKRDTTAKDQILYRLKVRNTMGESENMF
NCAS0D02130        VDKVIQSLVKHAHTILGDVKTSEIMVLFEKDRLCSSTSAKEQILYRLQTRAHMTNTENMF
KLTH0C10956g       VDKVIQSLVKHAHSIITDAKSAEIMILFEKDRRCTATSTKEQILYRLQVRSYMGLTENMF
Kwal_56.22462      VDKVIQSLVKHAHSIITDAKTAEIMILFEKDRKAPTTSTREQILYRLQVRSCMGLTENMF
SAKL0E01540g       IDKVVQSLVKHAHTIITDPKTVEIMILFEKDRTCLNTSAKEQILYRLQVRSHMTTAENMF
ACL004W            IDKVIQALVKHAHTILMDHKTVEIMLLFDNDRTSTSTSTKDQILYRLQVRSNMSNIENMF
Ecym_3033          VDKVIQALVKHAHAIITDNKTVEIMMLFEKDRTSLSTSTKDQILYRLQVRSNMSNIENMF
TPHA0J00400        IDKVTQSIVKHAHTIMSDTKTAEIMMLMEKDRSCATTSSKDQILYRLQARSHMSTTDNMF
Kpol_1037.22       IDKVIQSLVKHAHAIMTDSKSSDVMALFEKDRISSSTTSKDQILYRLQTRSHMSTTEHMF
ZYRO0C07524g       VDKVVQALVKHAHTILTDIKCSEIMVLFEKDRTLATTSAKDQILYRMQARSHMSNTENMF
TDEL0G04400        VDKVIQSLVKHAHTILTDSKTSEIMTSFEKDRTQINTSAKDQILYRLQVRSYMSSTENMF
                    *.* . ::    ::    .   ::  : .:     *    *: **   *  *     **

CAGL0J11594g       RLEIVRDSNAIYGQYIGVDDLLHAQLDKNKLEHSLYCQEYLSADATKYLDTDGLNTPYYS
TBLA0E03160        RIEYNNTTKHICIQYIALDDLTVKDAKTLEEKWKYYITSYALSHPTEGIFQENIQIPFLE
CAGL0E02475g       RIEYKREKRHASIQYIALDDLTLKTAKSPEEAWNYYVTSYSLSNPTEGVPHENLEVPFLE
KNAG0F02920        RVQYNKDTRHVSIQYIGLDDVTLEDAKDDNERWNYYMTSYALPHPTEGIMQDKLVVPFLE
NDAI0C02660        RIEFNENTNHVCIQYIAVEDLTLKPSPTTKETWEYYVTSYALPHPTEGVPQEGLKVPFLE
KAFR0A05120        RIEYNKDDRNICIQYIALDDLTLKEGNTEEEKWKYYVTSYSLPHPTEGIDHESLQIPFLQ
Skud_15.158        RIELNKRSLHVSVQYIALDDLTLKEPKADEDKWKYYVTSYGLPHPTEGISHEKLKIPFLE
Suva_15.171        RMEFDRRNLHVSVQYIALDDLTLKEPRADEDKWKYYVTSYALPHPTEGISHEKLKIPFLE
Smik_15.166        RIEFDKRTLHVSIQYIALDDLTLKEPKEDEDKWKYYVTSYALPHPTEGVLHEKLKIPFLE
YOL004W            RIEFDKRTLHVSIQYIALDDLTLKEPKADEDKWKYYVTSYALPHPTEGIPHEKLKIPFLE
KLLA0C06182g       RIEYNTDSSHVSIQYVAVDDLTLKEPQNMKEKWDYYVTSYSLSHPTEGITQEDISQPFLG
NCAS0D02130        RIEFNEEKNHVCIQYIALEDLTIKQPKSMEKNWEYYVTSYSLPHPTEGVPQDELKIPFLE
KLTH0C10956g       RVEINKDSCHVCIQYVAIDDLTLKEPESLKDRWHYYLTSYALSHPTEGIPHEEIKVPFLE
Kwal_56.22462      RIELNSTSAHVSIQFVAVDDLTLNQPNSLKDQWQYYLTSYSLSHPTEGVPHEEIKAPFLE
SAKL0E01540g       RIEYNRQSTHASIQFVAVDDLTLEEPKSLEDRWKYYVTSYSLSHPTEGISHEELQPPFLE
ACL004W            RIEYNTTTSHASIQFVAVEDLTLDEPKSLRDKWQYYLTSYSLSHPTEGISHDNLRTPFLE
Ecym_3033          RIEYNRLTAHVCIQFVAVDDLTLEEPKSLKDKWQYYLTSYSLSHPTEGISHDNLRSPFLE
TPHA0J00400        RIEFNKSSDNISIQYIGMDDLTLGEPKTAEEKWKYYITSYALSHPTEGVPQEEIQIPFLE
Kpol_1037.22       RIEYNTKKSSISIQYIALDDLTLEEPKTLEDKWKYYITSYSLSHPTEGIPQEEIKIPFLD
ZYRO0C07524g       RIEFNRISKHVCIQYIAIDDLTLAEAKSLEDKWKYYVTSYSLSHPTEGISHEDLQVPFLE
TDEL0G04400        RIEYNKQSKNVRIQFIAVDDLTLAEPRSLEEKWRYYVTSYSLSHPTEGISQEELQLPFLE
                   *::          *::.::*:           .  *  .*  . .*: :  : :  *:  

CAGL0J11594g       LNLLKREEQNIP--------------FMNGNIYKPHLSVNINPLDYVVDIAPGSIDICSS
TBLA0E03160        -RIIEEEQLYEDEETDDQKQTKSLMKYSPEGISGSTLKIKIDPQNYCLNIEEGSFDIFSR
CAGL0E02475g       -KVIEFDQEYSK--DNG-----NNSTYSLAGISKSNLHIDIDREKYNLILQGGSSDVYSR
KNAG0F02920        -RILEFENDMLD--VEA-----GSDRYNPVGTSYSKLKINIDPKTYKLIIQDGSYDIFSR
NDAI0C02660        -KNLNLELENAQDLDNETEKNEFIEKISPEGISTSKLKIKIDQETYNLDVEPGSFDVFSR
KAFR0A05120        -KILEFDQEELENNDEE---NKSNGKYSPEGVSNSMYKIKIHPGNYALDIQTGSFDIFSR
Skud_15.158        -RLIEFGQDTDG--REV------DEEFSPEGISLSTLRIKIQPITYKLHIENGSYDVFTR
Suva_15.171        -RLIEYGQDTDG--REV------DEKFSPEGLSVSTLKIKIQPVTYKLHIESGSYDVFTR
Smik_15.166        -RLIEFGQDIDG--KDV------DEKFSPEGISVSTLKIKIQPTTYKLDIENGSYDVFTR
YOL004W            -RLIEFGQDIDG--TEV------DEEFSPEGISVSTLKIKIQPITYQLHIENGSYDVFTR
KLLA0C06182g       -KIIEKEAEYLD--DEE-----QNDKFSPEGVSQSKLKVNIHPETYELTFECGSTDVFTR
NCAS0D02130        -KTLELEVDEEG--DNK---------SSPEGVSSSKLKIKIDPKSYALEIEPGSFDLFSR
KLTH0C10956g       -KTLQDDEEADE--GSE--------ERSPSGHSLSNLRIQVNPESYELQIEPGSKDIFTR
Kwal_56.22462      -KTLRDDGDSDE--DSE--------WYSPGGQSVSQLRIQINPESYALQIEPNSKDLFTR
SAKL0E01540g       -KILEKEEEFQC--ENG--------EYSPEGVSSSNLKVKINPETYSLDVQPGSYDFFSR
ACL004W            -KIIERDEGYID--DGD-------ERYSPEGVASSNMKVKIDPLTYSMEVEPGCHDIFSR
Ecym_3033          -KIIESEEDIIE--DKD-------EKYSPEGVATSNLKVKIDPITYSMEVEFGSHDIFSR
TPHA0J00400        -KILETEEAYAE--EEE----VINDKYSPKGVSQSDLKIKISPENYALEIEPGSFDTFSR
Kpol_1037.22       -KVIESEQVHME--DED-----DNPKYSPEGVSKSNLMIKIDPETYRLEVEPGSFDIFSR
ZYRO0C07524g       -KIIESEQEYDE--DNG-----GDPKFSPEGVSKSSLRIKIDPETYFLEVEPGSCDVFSR
TDEL0G04400        -KVLETEEDYGS--DVD---NFSIDKFSPEGVSKSTLKIKIDPETYLLDIEAGSYDVFSR
                    . :                          .   .   :.:    * : .  .. *  : 

CAGL0J11594g       THITKL--------KSSLKSSRKTQMASLISKIAKNRKQQRARTIGTMK-----------
TBLA0E03160        KSLNQFPVKLTQDSKYGTMPKLKNTVEKFLNSKMGWKRAISKDQMESIESKWDHLSNNGN
CAGL0E02475g       ATIQKYPIVASDESRAANISEKTQEIRKVLSHYDGNSND-------DVNEKFNYILANGT
KNAG0F02920        SSINEYPIRPDSKGYVQMVEKRKETAQKFLDGRFGWKKDLSDDVINTVEPTKKIALLSEE
NDAI0C02660        KSLNKFPTDA--KKIESSIKEKSEAFNKFLSSKRGWNNQFKPDQVAGIEEGWKKFQETGE
KAFR0A05120        KSLNKYPVKVNEDHESLKLNKKKNILNTFLESNNGWKKHLKKQL---------------S
Skud_15.158        KAVNKYPTIANDDVHKEMVVQKTALISRFLENAIRSRNDLNEATKSGMQEKLALLK--GV
Suva_15.171        KAANKYPTVANDDIHKEMVVKKTGLISKFLDNAIRLRNDLNETKKLSMQEKLDSLK--GA
Smik_15.166        KSANKYPTVANDDTHKEVVVQKKELISRFLDCAVHLRNDLNESQKISMQEKFESLK--DT
YOL004W            KATNKYPTIANDNTQKGMVSQKKELISKFLDCAVGLRNNLDEAQKLSMQKKWENLK--DS
KLLA0C06182g       KSVNKFP--------SSQSTQPASKMDKFLNSSKGWKKNLSTEIIGRAESKMKILKEQGK
NCAS0D02130        KSMNVYPT----YSDETKKRKSIDQMTKFLDGKNGWKKNLTTADSTNIEDLVKKSRELSK
KLTH0C10956g       FAVNRFLNSSENNSNTDLKEEKRKTLMSQLDGSRGWKKGMSQELVDKTLTALNYVRLHGK
Kwal_56.22462      STVNKHPTKIGEASGRDAKTMQKS-LADMVNSEHGWKKGLQNESIGKAESIINFVKARGF
SAKL0E01540g       KSINKFPIEINNDTYKSKRGEKAKCLTSYLNGAKGWKRGLVASKVLKAQTEIEYVKTKGT
ACL004W            KSVNKFPTRV--DVKKKKSAELKLVLEGFLNGERGWKRGLTTKRTAEAERRLEYVKNNGT
Ecym_3033          KAVNKFPVRV--DIRKKKSSELKLELERFLNSNSGWKKDLSAKQIAEVEKRLEFVKLNGN
TPHA0J00400        LSMNKYPIDVTSDDYKNKKKLSIDRVNAFLNGKFGWKQSLSEDEINNINLKYSHIKKYGS
Kpol_1037.22       KSVNKFPVDVFSESYKVKKQTRRNRCKNFLNGKHGWKRQLSSDAISKIEQKFNDLKN-GT
ZYRO0C07524g       KAVNKFPLEKNSESHKTKVDKKNELIRGYLDSEKGWKKNLDAKSIQSVEEKLNFVKNYGT
TDEL0G04400        KSVNRFPVIVDSNDYTTKKEKKKNMVIQFLESKKGWKKNLDDDQVKAIQEKLARVKENGS
                                                :.      .                      

CAGL0J11594g       ------------------------------------------------------------
TBLA0E03160        LEGYQEKSILKDVNGTDISKISPMKTFTVTESANGV----------------------PN
CAGL0E02475g       IDGYVRQSAAVVQETEKTYNDDSGRNTSSIKSIIGS------------------------
KNAG0F02920        TKDVGTLSTPVTTEKGAENTVHGLQPVALAENSNAS------------------------
NDAI0C02660        FIPIPKPITTESTTGVIAEPVIKPASNPIVVTPVTAAIEAVATAPIPTDSGALTDNSDHK
KAFR0A05120        LKKNESEPESAETRTIPAVPASTTDKPPSMEQSTGI------------------------
Skud_15.158        TAKVNDENEVKELKTEEDLAAKQEQPKNLPTSDANV----ITSSI-----------SNAP
Suva_15.171        TTKADVDDKITVAKNEKAIEAKEEQQENLPTSDMHV----LPSSI-----------ANVP
Smik_15.166        TAKLNVDGQVVDTKIEEATKTKQEQQENLASSDASV-----FSST-----------SDVP
YOL004W            IAKTSAGNQGIESETEKGKITKQEQSDNLDSSTASV----LPASI-----------TTVP
KLLA0C06182g       LEIDQTLTITAKIEEPNEPISKEDVPEKAV------------------------------
NCAS0D02130        ATGEQI------------------------------------------------------
KLTH0C10956g       HESLNKNPALVQGTRDPRHESSVAKEASSLESHADD------------------------
Kwal_56.22462      LEKATTVSPDPKVEKEHSASNGAIPEGATTEKPGDD------------------------
SAKL0E01540g       LVGLESKDKNDIVKNDIDGENKSYTFSTGQLHDHEE---DKPISH-----------QEEP
ACL004W            LDDYAEEISTDTKAALSTTTDTAGNVSTASFSSQTA---ANAAIS-----------ASSP
Ecym_3033          LEEYSDDSAVASTSAVSGSDLAKEDIARSQSESTVV-----SASM-----------ATCA
TPHA0J00400        LKNYVVPVVAAIPNKPLENKEKTQEEETPDVANLES------------------------
Kpol_1037.22       FQQ-RSRSATSETTSVPLNASDSTQKEQESTGTSETSQPALQKVP-----------INSA
ZYRO0C07524g       LQGYRAQENGLESTTKEAPFSDAVERKADSAAQADG---AANGGP-----------SNTA
TDEL0G04400        LDDFNEASQTQQASEIIAPSKVEQSKESTVADVNSL----------------------PK
                                                                               

CAGL0J11594g       ------------------------
TBLA0E03160        DKADGEERGNDTTAEEVGNESTVC
CAGL0E02475g       -------ATERTEKPLINGSPIID
KNAG0F02920        ------TMGTSTVGDASNNVQ---
NDAI0C02660        GKDDQETEGKPTPIETSAITELQN
KAFR0A05120        ------------------------
Skud_15.158        QYGNAEAGESPGPSEKETKIQY--
Suva_15.171        QDDNTEVTGNTGPFDKETNNKI--
Smik_15.166        QDDNIEVMRSTGLSDTETKI----
YOL004W            QDDNIETTGNTESSDKGAKIQ---
KLLA0C06182g       ------------------------
NCAS0D02130        ------------------------
KLTH0C10956g       ----TELKAGETTAEDIQGNE---
Kwal_56.22462      ----TDLRADETTAEDIQGNE---
SAKL0E01540g       ES-----KGNDTTTEEFEGEIGH-
ACL004W            ESALQSNNGNSEVTSPIANDI---
Ecym_3033          QSTLKTEKDKPDSTFTATNNAESN
TPHA0J00400        ----KVVESSSSTTNEVKA-----
Kpol_1037.22       EPDQEER-GNDTTTEEVESESVVH
ZYRO0C07524g       GV--EERGGNDTTAEDVEA-----
TDEL0G04400        ELVEAEDRGNDTTADEVDPEVVAH
                                           

FASTA FORMAT for MUSCLE Version 3.6

>CAGL0J11594g
------------------------------------------------------------
---------------------------------------MVTLEF--NNVTDSVVKSYN-
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------DLKKNLSHEDYNSLISAIRSDI--------DEFSNGESSPDNSIER
VIKGINEQYPHLSSTIRDIFGKD--------PNE----YTTRTCGQNLNVDLIVDELCGI
LENKQ-------------------------------------------------------
------------------------------------------------------------
------------------------------------------ITYIERV-----------
-----LYSDLSRDEK-----ISKLSIALKDEPKVLEKLLALIPTGVIDPRQSTEKNEE--
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------QISSIRSTLSQNT---------DNRCAKFSMLSSK-------
----------------------------DTF-----------------------------
-------YT---------------------------PIDRPTNMAEFLIYF---RNLVYD
ESIYPEFLKLMNLFAQSLIDLNTFTKRAYIFFGSHNGLKTAFGNIMSEYKDIHQRMKPTL
KSNDFDDIEDFSTESGPSYKRLSGFETRASCHGRDRLCHEVLNDEWVGHPVWASEEVGFI
AHKKNQYEETLFKVEEERHEYDFFLLSVEHLIVKFTEYEKSLQLSKDDGRRRNRVSSPKE
PMISLNSITEKVIRRLYGIEHGNILIDAIKTNPEKVVPTILKTAKEKYQQWNSAKNEWNK
AWREVEQKAYYKSLDHLGLPFKNAEKRFLNDKQLLLEYKSEKQDKLLKEHY-----DNYE
YKYEFFDKSVLYDVKDIILCGLRSNSSTSESQKNLYCQIFEAFFDLLF------------
-------------------------------------------EE-SSFTKHLD------
------------FQFCHNPAISSNSQISEDDVEAMFM--K-GILEEKGLGRWFS----ND
TELKKEFSNRQNINIFCDINIMSLFHYIQTLYERYNDVKIAETTILKDLRTKKRRPSLLA
KSLKLLPMQLSDNGLELGQDDGYEWIKTTSKKFLSGNLDHQWFEESLRINFENKAYKLYT
IDRVIRNILGVITTISQTPSLLQILDLLVDNMKKLTTTKLQQLTYRTKVRMLMDGVGDMF
RLEIVRDSNAIYGQYIGVDDLLHAQLDKNKLEHSLYCQEYLSADATKYLDTDGLNTPYYS
LNLLKREEQNIP--------------FMNGNIYKPHLSVNINPLDYVVDIAPGSIDICSS
THITKL--------KSSLKSSRKTQMASLISKIAKNRKQQRARTIGTMK-----------
------------------------------------------------------------
------------------------
>TBLA0E03160
--------MSTNNNTNIESSNRNGSGNASISAAVNAT-----TSATTSNSDPASTNSITT
NLNTSNVPSVATTNDLASNVLKQQPS----------QQPFRLPSI--SDLNVESNVMVN-
-QHQQLQHPSI--------------------SPSQNMTS-----------MNTGIMNSNT
SGIS--------RHNSNPTPKSNPLKVSSFDNPLPPLSNKSIGIVNSNSPTNSHAT--IN
TNTNSTSNINSMVNPNPTIPSVAVNSASPI----VHSQSPLLNQQPQEQQQQQHLLQNMQ
PHQQQKQKQQSLQSNSNKLDMSNKENKNIKPNMGMIPVSNLNQETDATTATTTANTMPNN
TQDSPKEDNQYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIAR
V-SSLFHDYPSLIQGFNTFLPQGYRIECSSNPNL--PITVITPMGTTTVSGVLETSVTEN
QNHQLQHSL---PQPSTTASASNVDSKVSSISGIMGPSNITEQSQQQQRHHPQQLINVND
SAPISGSISSTVPSNVEPTNMNAAANAAISAASALPNTNTPKSQT---------------
-TPPIATAGTATQQFPMVSSVSPPLQELPEQRRTQDVEFSQAISYVNKIKNRFANQPYIY
KHFLEILQTYQREQKPINEVYSQVTVLFQEAPDLLEDFKKFLPDSSANNNGSIVTSQEEN
FMY---------------------------ANGFNQQQPHL-------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------TPHSE----------IQAQNLPPLGSFSTQPN
GVFPKQES--QQIVPTSRFDANN--DQLAQQQHRHQ-----QQQQQI-------------
PQQSTMYQNV---HPEVVPVSDLRSQPETMHAPTQAQLHAEAQAQAQAQAQAQVQAQAQA
QAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAEAESHQQQMQMQMQLQMQNNIAPDIN
DHQQQVMYE----ENAVRPEIDLDPSLVPIVPEPTQPIEDTLPLVEETNFFDKVKKYIGN
KTIYAEFLKVLNLYSVDLLEVDELVEKIKYYLNDNEELFSWFKNFVG-YVEKPKHIENIV
HEKHKLDL-DLCEACGPSYKKLPKTDTLMPCSGRDEMCWEILNDEWVGHPVWASEDSGFI
AHRKINTKKPYLRLKKKVHEYDFYIESNLRTIQTLETIASKIANMTENEKCNFKL--PDG
LGHTTSTIYKKVIRKVYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNK
VWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTHKRMHWLTPKPKSQ
LDFNLPDKDIIFDILSFVEIFVEHTSTYSNPEKERLIDFMKYFTSLFFSIPLEEIKEAIS
KRDITEKNDEKLEDKQ-------------KNGEENSKKRTSRDIT-LSLEDILQ-RTKYQ
RLK------------YGDDSDEVDGHGNRHDDQKLLE--EEELLRQEAKKPWLLGTLVEE
ANAQGEIMHRNIFNMFSNTNMYIFIRHLTTMYERLHEIKQMNDKVSREISG--RKISKFA
KDLNLISTQLTEMGLDFSEGDVYQQLLVLCKRLILGDLEHQWFEESLRQAFNNKAFKLYT
LDKVTQALVKHAHTIISDLKTTEIMALFEKDRTKNSTSSKDQILYRLQTRARMTHNENMF
RIEYNNTTKHICIQYIALDDLTVKDAKTLEEKWKYYITSYALSHPTEGIFQENIQIPFLE
-RIIEEEQLYEDEETDDQKQTKSLMKYSPEGISGSTLKIKIDPQNYCLNIEEGSFDIFSR
KSLNQFPVKLTQDSKYGTMPKLKNTVEKFLNSKMGWKRAISKDQMESIESKWDHLSNNGN
LEGYQEKSILKDVNGTDISKISPMKTFTVTESANGV----------------------PN
DKADGEERGNDTTAEEVGNESTVC
>CAGL0E02475g
--------MSNQQGSVNHAIGSGAAETVNVT-----------QNATSNVGINDNQKIDGN
AESSNSINNTSNNNNN--------------------NERIILPSF--SSLKTEDNRIDT-
------------------------------------------------------------
----------------------SMNPIGPKSITTSSSTPA--------------------
---SVGFSVASLDNPL------------PPATKKPEIKLHPLPQQQQPRIYTQQQPQQQQ
ILQQDQQEILQNQRQ---------------------------GSTGASETSTTQSPLVSG
PAQTQGDPMSYRPLNVKDALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQTIDTPGVIER
V-SSLFKGYPNLIQGFNTFLPQGYRIECSNNPND--PIKVTTPMGSSTTVLNTAPQKSPS
PSDIQ--------------------------TNNQQTQAIAQEAQLQSQ-----------
-------------------------------ATPIPTQHDVGQNF---------------
----------------------------GSAKKPADVEFSQAITYVNKIKTRFADQPDIY
KQFLEILQTYQREQKPIHEVYAQVTILFQNAPDLLDDFKKFLPDSSASGSEETQVQQQQH
YQSLSDKMGGNAEAANYA------------ASGMNAQTGYY-------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------EPVKGGVSYNTQQNQHQQQNLPPIGSFSPPTN
GPFVDQTQ------QSANPETQK--GVMSLPSMMNNAEAVKEQAIKQAHSRLISDSHDHN
SQQQVLSQNI--HSNDDIPVSNLRTTVVEQ----------NYHPETIYQQQGNAQQHMV-
----------------------------DGG-----------------------------
-------YVGTPSELVVRPEIDLDPSLVPVVPEPTEPIENSLNLMEETNFFERVKKSIGN
KQIYNEFLKILNLFSLDLLTVDELVDKVEYYIGANKELFDWFKVFVG-YQDKPKRIENIV
HEKHKLDL-DLCEAYGPSYKKLPKTDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFI
AHRKNQYEETLFKIEEERHEYDYYIESNLRTIQTLETIANKIANMTDAEKAQFRL--PPG
LGHTSMTIYKKVIRKVYDKERGFEIIDALHNYPAISVPIILRRLKQKDEEWRRAQREWNK
IWRDLEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEINGIKVDQNSKRIHWLTPKPKNQ
LDYDFPDYDILFDIIALGFVFTINTNLYSNPDKERIKDMLRVFVSQFFSIPLKEVSDALE
RRGFSDDNNNDSDKGSGKMDQIAEEIGETEQDTSSSKKRP-FDND-LNMSDILH-KTKQQ
KTK---------MNKEMDGSKSPSEDLGTDRNVGTIE--D-SGSLSEHRKQWLVGDVVDS
ANKETPMDNRNIYNLFANTNIYIFFRHLVTLYERLSEVKQINDEINKEIKS--RRVTTFA
KDLGLISTQLSELGLDFNSSDAYQQLLTLSKRLIEGDIEHQWFEESIRQAYNNRAFKLYT
IDKVVQSFVKHAHTLISDSKTSEIMLLFENQRNNTLTTTKDQILYRIQCRSHMSSTENMF
RIEYKREKRHASIQYIALDDLTLKTAKSPEEAWNYYVTSYSLSNPTEGVPHENLEVPFLE
-KVIEFDQEYSK--DNG-----NNSTYSLAGISKSNLHIDIDREKYNLILQGGSSDVYSR
ATIQKYPIVASDESRAANISEKTQEIRKVLSHYDGNSND-------DVNEKFNYILANGT
IDGYVRQSAAVVQETEKTYNDDSGRNTSSIKSIIGS------------------------
-------ATERTEKPLINGSPIID
>KNAG0F02920
--------MSYHWNQNQQERSMDRRELLESRPAGDGVKKDVLGVSGDSKSVSPTSHYNIS
NSVSGSQHDTATKAAAAAVTETGTGTGTGT------SKHVTLPSL--SALSHELRNSPGK
QDMARTSGGDG-------------------------------------------------
--------------------QRRKSSNGFSLASLDNPLPASNDAENSS----------LR
APAARGLSIDETTTPA---------VGVPPVVGTNQGKSAVTPPSLHIPTHQQQQQQQQQ
QQQQQQMVASVSAMG---------------------------------------------
----GGIDSPYRPLNVKDALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNIDTPGVIER
V-STLFKGFPALIQGFNTFLPQGYRIECSSNPNE--PIKVTTPMGV-----LENVRGSDI
TADQQPAIG-----------------------------QLPTTQSPIQASLP--------
--------------PPQSA------------HLHLPSTVAAATTV---------------
-------------------QQSANVHAENEPKKANDVEFSQAISYVNKIKNRFSDQPDIY
KNFLEILQTYQREQKPINEVYAQVTVLFHNAPDLLDDFKKFLPDSSASNEQQPKQSPYSP
QVYSGADMA---------------------RGYMYNNTGVY-------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------YPPQVN----------QPQSNLPPIGSFSPPAN
GVAPTTGT------AIPHADEQH--VVAGVPAMAPH-----EQQHAP-------------
-------SMI---NNDGIQISNMRGGGTV----PALNQYGMISPHDYTQQQAKQVQQFQE
DQQQQQQQSMMM----------------DEQ-----------------------------
-------YG--SGDMQVRPEIDLDPSIVPVVPEPTEPIENNLSLSEETSFFEKVKKNIGN
RQIYIEFLKVLNLFSQDLIAVDELVTKVENYLAGQPELFEWFKNFVG-YQDKPKIIENVI
HEKHRLDL-DLCEAYGPSYKKLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFI
AHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKNMFKL--PPG
LGHTSLTIYKKIIRKVYDKERGFEIIDELHEHPAITVPIVLKRLKQKDEEWRRAQREWNK
VWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQNNKRMHWLTPKPKKQ
LDYQFNDMDIIFDIVGLTDVFVDHCSTYSNPDKERLKDLFRVFISLFFFIPRDLISAALD
----TKSDEGKSTDTK-------------FEKADDSKKRPRPDVE-LSLSDILH-RAKYQ
KLK--------------NGEGLGMSEDDDEEKLAKEA--E-EMSEKNASKPWLVGDIVER
ANSHGLVTDRAVYNLFGNTNVYIFIRHWSTLYGRLLELKQMDERVTKEINN--RKVVQFA
EDLNLLSTQLRDMGLDFDGKNAYQETLKLSKRLIRNELEHQWFEESLRQAYNNKAFKLYT
VDKVVHSLVKHAHTLMTDNKSSELMELFEKDRLQSSTCVKDQILYRLLTRSHMSSTENMF
RVQYNKDTRHVSIQYIGLDDVTLEDAKDDNERWNYYMTSYALPHPTEGIMQDKLVVPFLE
-RILEFENDMLD--VEA-----GSDRYNPVGTSYSKLKINIDPKTYKLIIQDGSYDIFSR
SSINEYPIRPDSKGYVQMVEKRKETAQKFLDGRFGWKKDLSDDVINTVEPTKKIALLSEE
TKDVGTLSTPVTTEKGAENTVHGLQPVALAENSNAS------------------------
------TMGTSTVGDASNNVQ---
>NDAI0C02660
--------MSGIWNNPSTQDNTGSANVDRNNNRS--------NNSTEKRGLPGSASSDKE
IQDSASNR----------------------------NEQITLPSINSQSFAHVVSNTNN-
SSNNISDNNSDNKHNKNSNNNNNGATPASITATTPSIFPANSNNINKNNMPVLHSVQTHQ
S-----------PMNNPSVSPARAARAANTSTTTATATTNNNIVESNRNNNVSQSHPQRN
NSASAGFSVASFDNPL------------PS-SNNNEVPPPVAPTVPQFQYIQPQPPVIQP
PNIQQQQQQQSLPHQ--------------------------------LIQSQQPQLQQQP
QQQQSEEDPEYRPLNVKDALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIER
V-STLFKGYPVLIQGFNTFLPQGYTIHCSDNPDD--PVRVTTPMGTSTYTNLPNVDNTNV
SPTL---------------------------PTVQPLLQQPQPQGNNDTTNVINNAANQP
QQVHAQTHLQEQTQAQTPA------------DADAQAQAEVQAQV---------------
--------------QAHAQAQAQAQAQMQAQNQNPEVEFSQAINYVNKIKTRYADQPFIY
KHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLLEDFKKFLPE-TPANNQPVQQPHAHP
QLQQL-------------------------QPRIPSISQQQ-------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------QPSQLYPFSNNGPVPSGFYQIPQQNLPPIGSFSPPTA
TNANATTTPAAGTVVNNFRHGIS--MQTALPSMMTP-----DTEAIP-------------
ISNLRSVDGFPPSSGGVIPMPNNQTADFQYQQQQPQPPLTNRLPDQFPLDQQQSQQQQAQ
QQAQQQ----------------------QQQ-----------------------------
-------LI---SEAPTRPEIDLDPSIVPIIPEPTEPIENNITLVEETSFFEKVKKFISS
KPIYMEFLKVLNLYSQDLLSTNELVTRVDYYIGSNKELFDWFKTFVG-YSEIPSTIENII
HEKHKLDL-DLCEAYGPSYKKLPKTDTFMPCSGRDAMCWEVLNDEWVGHPVWASEDSGFI
AHRKNQYEETLFKIEEERHEYDFHIESNLRTIQTLETIANKINNMTAEEKKNFKL--PVG
LGHTSSTIYKKVIRKVYDKERGFEIIDALHEHPAFAVPIILRRLKEKDEEWRRAQREWNK
VWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLISEISSIQVDQNNKRIHWLTPKPKSQ
LDFTFNDHDILVDILDLANVFIDHTSTYSNSEKERLKDFLRVFIGLFFSIPSSEIDKKLS
GKNDEKFEKGSSSSSS------------TSNSTPSAKKRS-LELD-IPLADVLR-KYKYQ
KIKEKVINELENNSNEYDERDEEFDEELKRQQQEQEE--EDHMIDEEMKKPWLLGSVIDK
TSEHGLIENRHIFNLFANTNIYVFFRHWTTIYERLLELKQINDKVTREINS--RKVTPFA
KDLGLISTQLTMMGLDFKTSDSYKELLNLTKRLIKNDIEHQWFEESLRQAYNNKAFKLYT
ADKVIQALVKHANSILTDSKASEIMALFEKDRLRSSTTTRDQIIYRLQTRTHMTNTENMF
RIEFNENTNHVCIQYIAVEDLTLKPSPTTKETWEYYVTSYALPHPTEGVPQEGLKVPFLE
-KNLNLELENAQDLDNETEKNEFIEKISPEGISTSKLKIKIDQETYNLDVEPGSFDVFSR
KSLNKFPTDA--KKIESSIKEKSEAFNKFLSSKRGWNNQFKPDQVAGIEEGWKKFQETGE
FIPIPKPITTESTTGVIAEPVIKPASNPIVVTPVTAAIEAVATAPIPTDSGALTDNSDHK
GKDDQETEGKPTPIETSAITELQN
>KAFR0A05120
--------MNQGNSSTNIPQGTATNNPASAASTSSVTPPVAPGSQHQLASIQAPTTIVNA
NTIPPSHVNTGEN-----------------------KNAVVLPSL--STLNNSTEQKEQ-
-------------------------------QEQQHFNP----------LNILNTNGSNR
KNSTMDSIMNPEPPTSMVSKASTTNTQTTPSSSSVPPINNGNVKVKNE----------RA
PFFGTGVSVASFDNPL------------PP---------------LNQQQSQPSFPAMHM
RDQQQQQQMAAAPAA---------------------------------------------
----AEDDASYRPLNVKDALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIER
V-STLFRGYPSLIQGFNTFLPTGYRIDCPSNPND--PIKVTTPIGSSTLHEMTRSVQRAN
SNLQQQQALSQ--------------------NNMMQQAQIPIGSISNNANL---------
-------------------------------NAAVQSVDDQAKQA---------------
------------------------------NKKPADVEFSQAINYVNKIKNRFADQPDIY
KNFLEILQTYQREQKPINEVYAQVTILFQNAPDLLDDFKKFLPDSSKEQQYTGQLPQQIP
N-----------------------------QEQLEEFSGSY-------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------ARPPNAP-------LDMVAQQSLPPIGSFSPPAN
TGI----S-------MHDQSQRP--HMMALPSMLQH-----EQIIDM----------NNH
PKPAVSTQGI---SNDEIPVSDVRMAQYPNGAVPDYGQY-PTHPQMKPDLATQRHILQQQ
EIQQQQLMLQQQQEQELLEQQ-------QQQ-----------------------------
-------YV----EAPVRPEIDLDPSIVPVVPEPTEPIESNFTLIEETSFFDKAKKFINN
KQIYTEFLKVLNLFSQDLISVDDLVNKVEYYIGSSKELFEWFRNFVG-YQGNPKIIENIV
HEKHRLDL-DLCEACGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFI
AHRKNQYEETLFKIEEERHEYDYYIESNLRTIQTLEAIVNKISNMSEEEKKNFKL--EPG
LGHTSLTIYKKVIRKVYDKERGFEIIDALHEHPAIAAPIVLKRLKQKDEEWRRAQREWNK
VWRELEQKVYFKSLDHLGLTFKQADKKLLTIKQLISEISSIKVDQNNKRIHWLTPKPKSQ
LNFDIKDFEILFDILSLSENFINHSSTYSTSDKERLNDFLKSFISLFFSVPLNEINNALD
KRNNQKNSEKVTDSAL-------------PDGTENQKKRSIHDIE-LSMSDILH-RTKYQ
KMK------LSNRGSDSQEENNIDTIIDEESDERLAE--EADLIRQDAKRPWLLGDIIDK
TNTQGIITDRKKFNLFANTNIYVFLRHWTTLYERLLELKEMNGEVTKEINN--RKSVKFA
EDLGLVSTQLKNMGLDFVDKDSYEELLRLSKRLIENDIEHQWFEESLRQAYNNRAFKLYT
VDKVVQALVKHGHTLMTDYKTTEVMKLFEKDRLSSATSAKDQILYRLQARSHMSNTEYMF
RIEYNKDDRNICIQYIALDDLTLKEGNTEEEKWKYYVTSYSLPHPTEGIDHESLQIPFLQ
-KILEFDQEELENNDEE---NKSNGKYSPEGVSNSMYKIKIHPGNYALDIQTGSFDIFSR
KSLNKYPVKVNEDHESLKLNKKKNILNTFLESNNGWKKHLKKQL---------------S
LKKNESEPESAETRTIPAVPASTTDKPPSMEQSTGI------------------------
------------------------
>Skud_15.158
--------MSQVWHNSNSQPN---------------------DVATSNDAAASNERSDKE
PPLQGRQPSFPGQQQQ--------------------QQRITLPSL--SALNANDEDRRD-
------YNGAQ--------------------PLASHATH------------ILGYSPVHS
NIIP--------SISTDSALKQSHEYHPHPKSSSSSPSLKTAVVDTAPATTLAPALAPLP
TAGGASFSLSRFDNPL------------PI------NTSVCTKDSKSYNGVQEEEKANQQ
QIQDQRPAAHSANAS-------------------------------EPSSNYVDTSYSVN
NENSNDEDPDYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIER
V-STLFRGYPILIQGFNTFLPQGYRIECSTNPDD--PIRVTTPMGTTTVNNNVSPSGRGT
VDGQEPSSL---SEPDG--------------NAIQPFHNLPMVPSNVYRSEQS-------
-------QDQKQSLPLSAN------------SVGLSSIHPPEIPP---------------
---------------HHQILQGQSLPVQEDAKKNVDVEFSQAISYVNKIKTRFADQPDIY
KHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKFLPDSSASANQQVQHAQQHA
QQQQEAQMHAQTQAQAQVQAHA--------QAEVEQQQQKH-------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------QQKQQPQFLYPASS-YYNHSTNRGVPQQNLPPIGSFSPPTN
GST-------------VHDNYQD--QQHMQPPHLVP-----LPSMVQ-------------
HGPNMVHQGI---ANENLPISDLRTSLTD-----------QYAPSTFQQQQQNPPSISPI
T---------------------------DLQ-----------------------------
-------YG----DVPVRPEIDLDPSIVPVVPEPTEPIEDNISLNEEVTFFEKAKRYIGN
KHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVG-YQEKTKCIENIV
HEKHRLDL-DLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEILNDEWVGHPVWASEDSGFI
AHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTESEKSDFKL--PPG
LGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNK
VWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEINSIKVDQTNKKIHWLTPKPKSQ
LDFDFPDKDIFYDILYLADSFISHTTAYSNPDKERLKDLLKYFISLFFSIPLEKIEKALQ
FHKENVSESSGSDDGG----------------SSTSRKRP-YQQE-MSLLDILH-RNRYQ
KLK---------RSNDEEGKIPQLSEPLDEESNTIEE--E-ELISEEARNPWLTGNLVEE
ANSQGIIQNRSIFNLFANTNIYIFFRHWTTIYERLLEIKQMNGKITKEVNT--RSTVTFA
KDLDLLSNQLPEMGLDFIGEDAYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAFKLYT
IDKVTQSLVKHAHTLMADVKTAEIMALFVKDRNAFTTSAKDQIIYRLQVRSYMSNIENMF
RIELNKRSLHVSVQYIALDDLTLKEPKADEDKWKYYVTSYGLPHPTEGISHEKLKIPFLE
-RLIEFGQDTDG--REV------DEEFSPEGISLSTLRIKIQPITYKLHIENGSYDVFTR
KAVNKYPTIANDDVHKEMVVQKTALISRFLENAIRSRNDLNEATKSGMQEKLALLK--GV
TAKVNDENEVKELKTEEDLAAKQEQPKNLPTSDANV----ITSSI-----------SNAP
QYGNAEAGESPGPSEKETKIQY--
>Suva_15.171
--------MNALGRT---------------------------EDRKSFNGLPEEEKANQP
VQDHKRAPAA--------------------------VQPADAAEV--SNVYADTKDEIN-
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
AENTNDEDPDYRPLNVKDALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAIDTPGVIER
V-STLFRGYPILIQGFNTFLPQGYRIECSTNPDD--PIRVTTPMGTTTVNNNVSPPARSA
LEPQEPSSL---PEADG--------------STIPQSHNVPMVPSNVYHSEQS-------
------QDQQQQPLPLLAN------------PSGLPSIHQPELPI---------------
-------------------PQSQPLTAQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIY
KHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKFLPDSSASANEQVQHAQQHA
QQQQEAQMHAQAQAQAQAQAQAHAQAQAQAQAQAQAQAEAEQQQQQQQQQQQQQQQQQQQ
QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ
QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ
QQQQQQQQQQQQQQQQQQQQQQQQQQFLYPASN-YYSHSTNGGIPQQNLPPIGSFSPPTN
GST-------------THEGFQD--QQHMQPPHLMP-----LPSMVQ-------------
QGPNMVHQGI---VNENIPLSDLRTSLTD-----------QYAPSNFQQQQQQQPSISPI
I---------------------------DSQ-----------------------------
-------YG----DVPVRPEIDLDPSIVPVVPEPTEPIEDNISLNEEVTFFEKAKRYIGN
KHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVG-YQEKIKSIENVV
HEKHRLDL-DLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFI
AHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKANFKL--PPG
LGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNK
VWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQ
LDFDFPDKDIFYDILYLADSFIAHTTAYSNPDKERLKDLLNYFISLFFSIPLEKIEEALQ
SYKQNLSDSSGSDDGD----------------SSTPRKRP-YQQE-MSLLDILH-RSKYQ
KLK---------RSNDEDGKVPQLSEPLDEESNAIEE--E-ELINEEAKNPWLTGNLVEE
ANSQGIIQNRNIFNLFANSNIYIFFRHWTTIYERLLEIKQMNEKVTKEISK--RSMVTFA
KDLDLLSSQLSEMGLDFNGEDAYKQVLKLSRRLINGELEHQWFEEGLRQAYNNKAFKLYT
IDKVIQLLVKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQIIYRLQARSYMSNTENMF
RMEFDRRNLHVSVQYIALDDLTLKEPRADEDKWKYYVTSYALPHPTEGISHEKLKIPFLE
-RLIEYGQDTDG--REV------DEKFSPEGLSVSTLKIKIQPVTYKLHIESGSYDVFTR
KAANKYPTVANDDIHKEMVVKKTGLISKFLDNAIRLRNDLNETKKLSMQEKLDSLK--GA
TTKADVDDKITVAKNEKAIEAKEEQQENLPTSDMHV----LPSSI-----------ANVP
QDDNTEVTGNTGPFDKETNNKI--
>Smik_15.166
--------MSQVWHNPNSQSNDVA------------------TSNDAAGSNERNERNEKE
PLLQGNQSSFVQQ-----------------------QQRITLPSL--SALNNKEENGRD-
------SNGQL--------------------PLASHGTH------------ILGYPPTHP
NIIP--------SITSDSTFKQSHEYQPHPKSSSSSPSINTSVMNAASASAPAP----LP
TAGGASFSLSRFDNPL------------PI----NAPVH--TEGSQSYNCPQEEEKASQQ
TQDHKEVSAGAQPTDATK----------------------SANDHIDTNDDNNNNNSNNN
NENFNEEDPDYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIER
V-STLFRGYPILIQGFNTFLPQGYRIECSTNPDD--PIRVTTPMGTTTVNNNISPPERGT
IDAQEPSSL---PEADG--------------NGTQRSHNVPMVPSNVYHSEQN-------
-------QDQQQVLPLSAT------------STGLPSIQQSEIPV---------------
---------------HHQIPQIQPLAVQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIY
KHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKFLPDSSASANQQVQHAQQHA
QQQQDAQMQAQAQAQMQAQAQAQAQAQVQAQAQAQAQAQAQ-------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------AEQQQQQFLYPASS-YYGHSNNRGIPQQNLPPIGSFSPPTN
GST-------------VHENYQD--QQHMQPPHLMP-----LPSMVQ-------------
HGANIVHQGI---ANENLPLSDLRTSLTE-----------QYAPSNIQQQQQQHPQSISP
IA--------------------------NSQ-----------------------------
-------YG----DVPVRPEIDLDPSIVPVVPEPTEPIEDNISLNEEVTFFEKAKRYIGN
KHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVG-YQERTKFIENIV
HEKHRLDL-DLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFI
AHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKVNFKL--PPG
LGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNK
VWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQ
LDFDFPDKNIFCDILYLADSFISHTTAYSNPDKERLKDLLKYFISLFFSISLEEIEESLQ
AYKQSVSESSGSDDGG----------------SSVSRKRS-YQQE-MTLLDILH-RSRYQ
KLK---------RSKDEDGKVPQLSEAPDEESNIIEE--E-ELINEEAKNPWLTGNLVEE
ANSQGMIQNRGIFNLFANTNIYIFFRHWTTIYERLLEIKQMNEKVTKEINT--RSTVTFA
KDLDLLSNQLSEMGLDFIGEDAYKQVLKLSRRLINGDLEHQWFEESLRQAYNNRAFKLYT
IDKVTQSLVKHAHTLMTDAKTAEIMALFVKDRNVTTTSAKGQIIYRLQVRSHMSNTENMF
RIEFDKRTLHVSIQYIALDDLTLKEPKEDEDKWKYYVTSYALPHPTEGVLHEKLKIPFLE
-RLIEFGQDIDG--KDV------DEKFSPEGISVSTLKIKIQPTTYKLDIENGSYDVFTR
KSANKYPTVANDDTHKEVVVQKKELISRFLDCAVHLRNDLNESQKISMQEKFESLK--DT
TAKLNVDGQVVDTKIEEATKTKQEQQENLASSDASV-----FSST-----------SDVP
QDDNIEVMRSTGLSDTETKI----
>YOL004W
--------MSQVWHNSNSQSN---------------------DVATSNDATGSNERNEKE
PSLQGNKPGFVQQ-----------------------QQRITLPSL--SALSTKEEDRRD-
------SNGQQ--------------------ALTSHAAH------------ILGYPPPHS
NAMP--------SIATDSALKQPHEYHPRPKSSSSSPSINASLMNAGPAP--------LP
TVGAASFSLSRFDNPL------------PI----KAPVH--TEEPKSYNGLQEEEKATQR
PQDCKEVPAGVQPAD----------------------------APDPSSNHADANDDNNN
NENSHDEDADYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIER
V-STLFRGYPILIQGFNTFLPQGYRIECSSNPDD--PIRVTTPMGTTTVNNNISPSGRGT
TDAQELGSF---PESDG--------------NGVQQPSNVPMVPSSVYQSEQN-------
-------QDQQQSLPLLAT------------SSGLPSIQQPEMPA---------------
---------------HRQIPQSQSLVPQEDAKKNVDVEFSQAISYVNKIKTRFADQPDIY
KHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKFLPDSSASANQQVQHAQQHA
QQQHEAQMHAQAQAQAQA------------QAQVEQQKQQQ-------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------QFLYPASG-YYGHPSNRGIPQQNLPPIGSFSPPTN
GST-------------VHEAYQD--QQHMQPPHFMP-----LPSIVQ-------------
HGPNMVHQGI---ANENPPLSDLRTSLTE-----------QYAPSSIQHQQ-QHPQSISP
IA--------------------------NTQ-----------------------------
-------YG----DIPVRPEIDLDPSIVPVVPEPTEPIENNISLNEEVTFFEKAKRYIGN
KHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFTWFKNFVG-YQEKTKCIENIV
HEKHRLDL-DLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFI
AHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKANFKL--PPG
LGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNK
VWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQ
LDFDFPDKNIFYDILCLADTFITHTTAYSNPDKERLKDLLKYFISLFFSISFEKIEESLY
SHKQNVSESSGSDDGS----------------SIASRKRP-YQQE-MSLLDILH-RSRYQ
KLK---------RSNDEDGKVPQLSEPPEEEPNTIEE--E-ELIDEEAKNPWLTGNLVEE
ANSQGIIQNRSIFNLFANTNIYIFFRHWTTIYERLLEIKQMNERVTKEINT--RSTVTFA
KDLDLLSSQLSEMGLDFVGEDAYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAFKLYT
IDKVTQSLVKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQIIYRLQVRSHMSNTENMF
RIEFDKRTLHVSIQYIALDDLTLKEPKADEDKWKYYVTSYALPHPTEGIPHEKLKIPFLE
-RLIEFGQDIDG--TEV------DEEFSPEGISVSTLKIKIQPITYQLHIENGSYDVFTR
KATNKYPTIANDNTQKGMVSQKKELISKFLDCAVGLRNNLDEAQKLSMQKKWENLK--DS
IAKTSAGNQGIESETEKGKITKQEQSDNLDSSTASV----LPASI-----------TTVP
QDDNIETTGNTESSDKGAKIQ---
>KLLA0C06182g
--------MSAPWNQQPDGPQQQQQQQQQQIP----------PSTGMINGVQGQSENSPN
LLPQLAPPAVNIQIKPEHDQQ---------------QHHVTLPSI--STISGSNQPSQG-
-------QGQE--------------------QVQGQQNA--------------RSHSHSH
SHVH--------PHIHGPLSGVSNRMDNINLQNGGTPINS--------------------
AAGSNGPVSTNSEGAI------------PT----PSINNIVQQPDITHQQQQQQLLQGHN
VQVENAMTVGQDPLQ---------------------------------------------
----QAQYSSYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQR
V-TTLFQGFPNLIQGFNTFLPHGYKIECSTNPND--PIKVTTPFGTTGEVSAGPPTQYQL
APVAGQNVENQNIEMQQQVSQPQFNN-----GDQIQHQQLQDQLQNQSATSAAMLVS---
-QPQSQTQPQQLHSQQSPQ------------QQGQPPQRQAQQQP---------------
---QPPQLENQFVNQKIVAAGGGMLGALPGQQKTGEVEFSHAISYVNKIKTRFADQPDIY
KQFLEILQTYQREQKPIHEVYAQVTILFQNNPDLLDDFKKFLPDSSVSQQQQEQQQEPQQ
QQQDQQQEHQQDQEQQHHEQKQQPLPQDQNQQAMLPPQPYL-------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------QQNQSMQGQGFYPQSG--------VLMQPTNLPPLGNFSASGQ
ASP------------------AE--NSHMLPSMHQH-----IAGGHV-------------
IPQHVVTQGM---SNQDIPVSEMRSTMNG-----------TYNQVEYIQGAPGYPQPLE-
----------------------------GVQ-----------------------------
-------YM---EAPMARPEIDLDPSLVPVVPEPIQPPEDAIALGDEVTFFERVKRFIGN
KQVYAEFLKILNLYSQDLLTTSELVSKVEFYLHSSKELFDWFKSFVG-YQEKPKHIENIV
HEKHRLDL-DLCEACGPSYKKLPKDDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFI
AHRKNQYEDTLFKVEEERHEYDFYIESNLRTIQTLETIANKIANMTNEEKNNFKL--PPG
LGHTSLTIYKKVVRKVYDKDRGFEIIDALHEHPAVTVPIVLKRLKQKDEEWRRAQREWNK
VWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLLSEISSIKVDQTNKRIHPLTPKPKSQ
LDFEINDREVLYDILDLVFTFVKTNASYSNSDKIKLDHFFKAFISLFFSYPIKDVNEAVS
ERSSITDQENGEEDSN-------------KSDSEKSNKRTLSDEDSYLMKDILR-RTKNA
KTS---------NSEENQNSSSVKSNEEDET----------ELLAKEAAKPWLLGSLIDE
ANNSGIVSDRHIFNLFTNTTIYVFFRHLNTLYERLLEVKKIDAEVTDEIKN--RKIVQFA
SDLNLISTQLADMGLAFKDTKAYGELLRLSKRLITGDLDHQWFEESLRQAYKNKAFKIYT
IDKVVQSLVKHAHSIITDPKNAMVMVLFEQDRLKRDTTAKDQILYRLKVRNTMGESENMF
RIEYNTDSSHVSIQYVAVDDLTLKEPQNMKEKWDYYVTSYSLSHPTEGITQEDISQPFLG
-KIIEKEAEYLD--DEE-----QNDKFSPEGVSQSKLKVNIHPETYELTFECGSTDVFTR
KSVNKFP--------SSQSTQPASKMDKFLNSSKGWKKNLSTEIIGRAESKMKILKEQGK
LEIDQTLTITAKIEEPNEPISKEDVPEKAV------------------------------
------------------------
>NCAS0D02130
--------MSNAWNQHQTESETHNVDSVNLNQV---------DQTAERDHIPQETNFANQ
EQQQTNMKAEPS------------------------SEHVILPSL--SSIGGVQTSSEN-
-----------------------------------------------------NITNPTQ
NQIP------TTGVNTATTSQSSSQMLPSVSSTFATPPNSTNITVPAQNQEQP-----KR
NSASTGFSVASFDNPL------------PAVQNQQPLPVQPQPQPQPHPQPQPQPQSQQS
QQAQQAQQAQPQPQQ--------------------------------------------P
REQDQFQDLAYRPLNVKDALSYLEQVKYQFSQRPDIYNQFLDIMKDFKSQSIDTPGVIER
V-SALFRGYPMLVQGFNTFLPQGYRIECTTDPDG--PIRVTTPMGTSTLSGGPAMEAPSS
SESN---------------------------LQQQQHHQSPTIPSLAAS-----------
-------------------------------TFQESNFQQTPQPE---------------
----------------------------DQSAKNAEVEFSQAINYVNKIKNRFADQPDIY
KRFLEILQTYQREQKPINEVYSQVTVLFQHAPDLLDDFKKFLPESSGTTSTSELPQNAGI
QQRAAIPT----------------------PNPKHQQYGYP-------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------NNYYPNGT----------GTQQNLPPIGSFAPPNG
TAS------------REYAPGNQFVGPGGLPSMIPN-----DQALQQ-------------
QQQPGLVHGY---TNEAIPVSNLRSPLTD-----------QQYPNLLNMQNQMTPGQMDI
NNATAPM---------------------AQQ-----------------------------
-------YT---NEAPIRPEIDLDPSIVPVIPEPTEPLEYNVSLVEETNFFEKAKKFIGT
KQVYTEFLKILNLYSQDLLTTDELCVKVEYYLGSNEELFTWFKNFVG-FQEKPLIIENIV
HEKHKLDL-DLCEACGPSYKKLPKTDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFI
AHRKNQYEESLFKTEEERHEYDFCIESNLRTIQTLETIANKIGNMTNEEKKNFKL--PPG
LGHTSSTIYKKVIRKVYDKDRGFEIIDLLHEEPALTVPVVLKRLKQKDEEWRRAQREWNK
VWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLLSEISSIKVDQTNKRIHWLTPKPKSQ
LEFQFDDNDIFVDILGLTSVFINHSSTYSNPEKERMKDFLRVFVSLFFSIPLDKVNEALS
DRSHWLQEKEKKTKES---SRNIDSTTSSSSSGSNSKKRP-LNID-IPLADILR-KHKYQ
KIR-----KQAKESNEENAQEEDDENIVGDSNEELNEQDENEIILEEIKRPWLLGNIIET
ASNHGTISNRKVFNMFANTNIYVFFRLWTVIYERLYEMKQINEKVTKEVNS--RRISQFA
KDLNLISTQLKDMGLDFVGVNSYQELLVLSKRLIQNDIEHQWFEESLRQAFNNKAFKLYT
VDKVIQSLVKHAHTILGDVKTSEIMVLFEKDRLCSSTSAKEQILYRLQTRAHMTNTENMF
RIEFNEEKNHVCIQYIALEDLTIKQPKSMEKNWEYYVTSYSLPHPTEGVPQDELKIPFLE
-KTLELEVDEEG--DNK---------SSPEGVSSSKLKIKIDPKSYALEIEPGSFDLFSR
KSMNVYPT----YSDETKKRKSIDQMTKFLDGKNGWKKNLTTADSTNIEDLVKKSRELSK
ATGEQI------------------------------------------------------
------------------------
>KLTH0C10956g
--------MPPSWTNQPASQTGTKSSVESPSL----------SEQQPVSGGMQGQAANST
GESKANAPVDASQQ----------------------PHQFVLPSL--SGLDAGTRAEYG-
------------------------------------------------------------
---------------------SEPQRLPSLQGAQPQSISS--------------------
-GGSKGFSVASLNNPL------------PA-----------------------QQQMLHS
QQQQQLLQQGVLPLE---------------------------------------------
----HVQDPSYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIER
I-STLFKGYPILIQGLNTFLPQGYKIECTLNPNDPHSIKVTTPFDNARELNLATMATGNG
IVEGHPSLMPS--------------------DDVSPPKLVGHEPAAVQPKLENAPTN---
------LPVPTTFNQNLPQ------------HEQQNQQHGSQSPA---------------
-----------------MPQQQRQDQQFMGNRPSGDVEFSHAISYVNKIKTRFADQPEIY
KHFLEILQTYQREQKPIHEVYAQVTSLFQNAPDLLDDFKKFLPDATAAHEQQQLLLQQQQ
QQQQQLQ-----------------------QQQIQQHQSHY-------------------
------------------------------------------------------------
------------------------------------------------------------
-------------QNASQDLDQRQQHTHQPFGN-TVPFYQTQQGRPQNLPPLGSFSPPIN
GRE------------------ND--PQLNLPAVQPPAMEFASQQVPH-------------
HPSHVVPQVI---PGGTLPLSDLRGAMDG-----------NFAPQPLQSQ----------
----------------------------DVQ-----------------------------
-------FI----EPTSRPEIDLDPSLVPVIPEPIKPLENDLTLIEETSFFDRAKKYMGN
KQVYTEFLKILNLFSQDLIGTEELVDKVEHYLGGSPELFDWFKSFVN-YVEKPKHIENVI
HEKHRLDL-DLCEACFPSYKKLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFI
AHRKNQYEETLFKIEEERHEYDYYIEANLRTIQLLETIANKISNMTPEEKQAFKL--PPG
LGHTSMTIYKKVIRKVYDKDRGFEIIDALHENPAVSVPIILKRLKQKDEEWRRAQREWNK
VWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQTNKRIYPFTPKPKSQ
LDYDLKDKGVLFDILCLVNNFIDHSSTYSNPDKEKLAAFFKGFLSVFFSISYQEIE----
-----NSTPADSDAVS----------------NSNPRKRL-WESE-QPLKELLRSKHKHH
KKR---------DTSAEDDSISDDQNSPEKSPQEIED--E-EVIRQEAKKPWLLGNILDE
ANDHGYVSNRKIFNLFANTNVYVFFRHLTTMYQRLSEVKNMNEEVTREINS--RNVVQFA
KDLNLVSTQLSDMGLDFKGKDAYDQLLTLCKRLIRNDMDHQWFEESLRQAYKNKAFKIYT
VDKVIQSLVKHAHSIITDAKSAEIMILFEKDRRCTATSTKEQILYRLQVRSYMGLTENMF
RVEINKDSCHVCIQYVAIDDLTLKEPESLKDRWHYYLTSYALSHPTEGIPHEEIKVPFLE
-KTLQDDEEADE--GSE--------ERSPSGHSLSNLRIQVNPESYELQIEPGSKDIFTR
FAVNRFLNSSENNSNTDLKEEKRKTLMSQLDGSRGWKKGMSQELVDKTLTALNYVRLHGK
HESLNKNPALVQGTRDPRHESSVAKEASSLESHADD------------------------
----TELKAGETTAEDIQGNE---
>Kwal_56.22462
MWQLSLPNHFVKFVNFPSFFMEFVDVYLHDRRDCRSFMKTPFLVKMKKNLSLVTSSTHKQ
YFIRSSRSSAYRSIELSCDPLLQQSPESYVEERFA-KRSVRMPQSWSNQATGQTGLKSS-
------AEGHG------------MVEQQAGSGGSMEQLPGIASEAKGAVPNGMGQPPQLP
QQHVVLPSLSGLETGGRAEYGASAQRLPFMQGAAPQSASS--------------------
-GGSKGFSVASLNNPL------------PM--------------------QQQQQQQQQQ
QQQQQLLQQGVLPLE---------------------------------------------
----HVQDASYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIER
I-STLFKGYPVLIQGLNTFLPQGYKIECTSNPHDPHSIKVTTPFDTTRELSLDHNTGGSA
VGGHLAGPA----------------------TVSTSPSQIPRQETAVSETKQEETPV---
-----DLPASAAFAQDQVH------------HAESDTQREIQKSA---------------
-----------------QLQQSQQDQQYATNRPNGDVEFSHAISYVNKIKTRFADQPDIY
KHFLEILQTYQREQKPIHEVYTQVTSLFQNAPDLLDDFKKFLPDATAAHEQHQQLLQQQQ
QQQQLQHQIQL-------------------QQQQSQQYQSF-------------------
------------------------------------------------------------
------------------------------------------------------------
-------------QSSPQELDQRQQQSNSPFNH-PASFYQHQQARAQNLPPLGNFSPPIN
GRD------------------NE--AQVNLPAVQPPALDFPPQQQSQ-------------
SHRHVVAQGM---TNNSLPVSDMRGPVDG-----------GFAPQPLYSQ----------
----------------------------DVQ-----------------------------
-------YM----EPTSRPEIDLDPSLVPVIPEPIRPLENDSTLIEETSFFDKAKKYMGN
KQVYTEFLKILNLFSQDLIDTDELVDKVEHYLGGNSELFDWFKSFVN-YVERPKHIENVV
HEKHRLDL-DLCEACCPSYKKLPKADTFMPCCGRDEMCWEVLNDEWVGHPVWASEDSGFI
AHRKNQYEETLFKIEEERHEYDYYIEANLRTIQLLETIANKISNMTVEEKKTFKL--PPG
LGHTSTTIYKKVIRKVYDKDRGFEIIDALHENPAVSVPIVLRRLKQKDEEWRRAQREWNK
VWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIKIDQANKRIYPFTSKPKSQ
LDFDISDKGVLFDILNLVDTFIDHSTTYSNPDKEKLSAFFRGFLSIFFSIPLTDLD----
----NPSEEHKVENGD------------------STRKRS-RDDD-QFFRDLLKSKHKQA
KKK---------TSQQEDESTSDDQDTAAKTSPDLEY--E-EAVRLDAKKPWLLGNILDE
ANNHGFVSNRKTYNMFANTNIYVFFRHLTTMYQRLSEAKNINEEVTKEINS--RKVVQFA
KDLNLASTQLSDMGLDFKGADAYEQLLALCKRLIQSDIEHQWFEESLRQAYKNKAFKIYT
VDKVIQSLVKHAHSIITDAKTAEIMILFEKDRKAPTTSTREQILYRLQVRSCMGLTENMF
RIELNSTSAHVSIQFVAVDDLTLNQPNSLKDQWQYYLTSYSLSHPTEGVPHEEIKAPFLE
-KTLRDDGDSDE--DSE--------WYSPGGQSVSQLRIQINPESYALQIEPNSKDLFTR
STVNKHPTKIGEASGRDAKTMQKS-LADMVNSEHGWKKGLQNESIGKAESIINFVKARGF
LEKATTVSPDPKVEKEHSASNGAIPEGATTEKPGDD------------------------
----TDLRADETTAEDIQGNE---
>SAKL0E01540g
--------MSQGWNHPSVQSTGNSTDSTHFLDQQPQQLQQSQTVLPPTSSLDHKIGGSTG
DAIKNSIEQTQPQV----------------------QVPYTLPSI--SGLNSTHSDSGI-
------------------------------------------------------------
----------------------GQQMLPSVQSSLPPPPPPALQPTH------------RH
TPSGTGFSVASLNNPL------------PE---------------------QQQQQQQQQ
QQQQQQQQQQQQP-----------------------------------------------
------QDPSYRPLNVKDALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIER
V-SNLFQGYPNLIQGFNTFLPQGYKIECSSNPNDPHPIKVTTPFGTTGSVTLNTAPLEQR
YPSNENVLL----SPDH--------------LQLQQHHSVLQQEQQQPQ-----------
------PQPQQQPQPQTQT------------QTQTQTQTQQQHYP---------------
----------------------DQQDQHYLAKKGGDVEFSHAISYVNKIKTRFAEQPDIY
KHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKFLPDASAPQSTTTPAPVNG-
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------GTFYPQAA-----------PQQNLPPLGSFSPPSS
GSA-----------------REG--EHVGLPAVQPP-----SMDISG------------Q
PQQHIITQGM---SNDDIPISEVRNTADG-----------AYRSDLRNSG----------
----------------------------EVQ-----------------------------
-------YM----EPVARPEIDLDPSLVPVIPEPIEPMENEVSLVEETSFFDKAKKFIGN
KQIYTEFLKILNLYSQDLLDRDELVEKVEYYLGGNKELFDWFKNFVG-YEKKPKHIENIV
HEKHRLDL-DLCEACGPSYKKLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFI
AHRKNQYEETLFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKATFKL--SPG
LGHTSVTIYKKVIRKVYDKDRGFEIIDALHETPSIAVPIVLKRLKQKDEEWRRAQREWNK
VWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLVSEISTIKVDQANKRIHPLTPKPKSQ
LDYHFKDREVLYDILNLAKVFIDCNTTYSNPDKEKMFDFLKSFLVLFFSYPMYEVETAFA
RRRGDIGVQDGEENSG-------------QENSDLSRKRT-REEE-NLLKDVLR-RNKYQ
KGR----------NFAEEEPIPEESEFAEKTVEEKEE--E-EIIRQEAKKPWLLGSIVDE
ANEHGFVENRKTFNMFANTNIYVFFRHLATLYTRLSEVKDINEAVTEEIKN--RKVVQFA
KDLNLISTQLSDMGLDFEGADAYGQVLTLSKRLIEGDIEHQWFEESLRQAYKNKAFKIYT
IDKVVQSLVKHAHTIITDPKTVEIMILFEKDRTCLNTSAKEQILYRLQVRSHMTTAENMF
RIEYNRQSTHASIQFVAVDDLTLEEPKSLEDRWKYYVTSYSLSHPTEGISHEELQPPFLE
-KILEKEEEFQC--ENG--------EYSPEGVSSSNLKVKINPETYSLDVQPGSYDFFSR
KSINKFPIEINNDTYKSKRGEKAKCLTSYLNGAKGWKRGLVASKVLKAQTEIEYVKTKGT
LVGLESKDKNDIVKNDIDGENKSYTFSTGQLHDHEE---DKPISH-----------QEEP
ES-----KGNDTTTEEFEGEIGH-
>ACL004W
--------MSQSWSQHHQVDHAGSGRPV--------------GQAGPGPAGGTPQMGGGA
GLLPGRRGSEGL------------------------KTHYTLPSI--SAAGLPGAGEPH-
------------------------------------------------------------
----------------------GGSRLPPMQNALGVGGGG-------------------P
GSIANGFAVGRLEGAV------------PV-----------------------------S
GTGGPGSPGPQVPAQ---------------------------------------------
------DGSAYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIER
V-STLFHGYPALIQGFNTFLPHGYNIECPSDPND--PIKVTTPFGT---IGEIPITGAGG
NHAHGANTE----------------------PRLQSTQNVPTVYRS--------------
-------------------------------AEGSPAAIATPATT---------------
-----------------------QEQYGTGPKKAGDVEFSHAISYVNKIKTRFAEQPDIY
KHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKFLPDSSAPQLQSHQQIN---
------------------------------GAMVAPGFGHA-------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------QSGLQQALPGTQ--------PLMHQQNLPPLGNFSTPGD
H------------------------HPMSLPSVQGP-----NVGLSQ------------G
QSGHIVTQGV---SNQHIPVSDLRGAPDA-----------SFRASEYNQVQ---------
----------------------------DVQ-----------------------------
-------YM----EPTVRPEIDLDPSLVPVIPEPIKPLEDELNLVEEATFFDKAKKFIGN
KQIYTEFLKILNLYSQDLLEKEKLVEDVSHYLSGSPELFDWFKSFVG-YQERPKHIENVI
HEKHRLDL-DLCEACGPSYKRLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFI
AHRKNQYEDTLFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKAAFKL--PPG
LGHTSVTIYKKVIRKVYDKDRGFEIIDALHEHPAITVPLVLKRLKQKDEEWRRAQREWNK
VWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQSNKRIHPLTPKAKSQ
LSYDFKEPEVFQDILSLVMVFLANNNTYSPSDNERLKDFFKGFISLFFSYPLHEIEEGLL
KRSSQNGTISHGDDTR-------KSKEDPKTEKHSARKRVRDDTE-HLLRDILY-RNKQQ
KV--------------NKGPQNDQSSEEFEKESDIEE--K-EIVRQEAKKPWLLGSIVDE
ADNHGHVSDRVTFNMFANTNIYVFFRHLTTMYERLVEVKKINGEVTKEISN--RKVVQFA
KDLNLISTQLTDMGLDFKGADAYEELLRLSRSLISGELEHQWFEESLRQAYKNKAFKLYT
IDKVIQALVKHAHTILMDHKTVEIMLLFDNDRTSTSTSTKDQILYRLQVRSNMSNIENMF
RIEYNTTTSHASIQFVAVEDLTLDEPKSLRDKWQYYLTSYSLSHPTEGISHDNLRTPFLE
-KIIERDEGYID--DGD-------ERYSPEGVASSNMKVKIDPLTYSMEVEPGCHDIFSR
KSVNKFPTRV--DVKKKKSAELKLVLEGFLNGERGWKRGLTTKRTAEAERRLEYVKNNGT
LDDYAEEISTDTKAALSTTTDTAGNVSTASFSSQTA---ANAAIS-----------ASSP
ESALQSNNGNSEVTSPIANDI---
>Ecym_3033
--------MSQSWNQHHQVDHVGGSGSVSGAGGQQPQ-----GKQHSDQGQQGQLAVGGG
GLLGKRRSDGM-------------------------KGHYTLPSI-SAGLPGSGEHQHQ-
------------------------------------------------------------
--------------------QHDGSRLPPMQNTLAAAASA-----------PPGGGGGGG
GGVSNGFSMSSLDNPL------------PQ------------------QEFQEQSQHQQQ
QHHHHQLDQLQSPA----------------------------------------------
----HQDGSSYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIER
V-STLFQGYPTLIQGFNTFLPQGYNIECSSDPND--PIKVTTPFGTTGEVAIGGGGGSGV
CGHVVPRAE-----PLQ--------------QQLRQHQQPATVAEAAAAAAAAAGGGGGG
AIAGGGPPPQAQTLVVYQS------------TDGSPTM--PQRQP---------------
-----------------------QDQFGTGGKKTGDVEFSHAISYVNKIKTRFADQPDIY
KHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKFLPDASAPQAQQQHLAQSHP
QLNGALTPSSFYHSQQQQGP----------QPQQDQSQSQH-------------------
------------------------------------------------------------
------------------------------------------------------------
------------------PVQQQQQQQQQQQQQ--------TVIHQQNLPPLGSFSTPGD
H------------------------HPMNLPLVQAP-----NMNLNQ------------G
HPAHIITQGM---SNQKIPISDLRTTADT-----------SYRPAEYSQGQ---------
----------------------------DTQ-----------------------------
-------YM----ETNARPEIDLDPSLVPVIPEPIKPLEDELNLVEEASFFDKAKKYIGN
KQIYTEFLKILNLYSQDLLDKERLVEKVGHYLSGCPELFDWFKSFVG-YQEKPKHIENIV
HEKHRLDL-DLCEACGPSYKRLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFI
AHRKNQYEDTLFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKATFKL--PPG
LGHTSVTIYKKVIRKVYDKDRGYEIIDALHEYPAITVPIVLKRLKQKDEEWRRAQREWNK
VWRELEQKVFFKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQNNKRIHPLTPKAKSQ
LDHDFTDPEVFYDILNLAIVFLENNNTYSAPDKERLKDFFKGFISLFCSYPVPQIEKALA
KRDAASSSQSSNSNTE-----TYSEKQQEDGDMKLPKKRNREDSD-RLLRDVLF-RNKQQ
KG--------------GRNSPRGDSSISAEKESDMEE--E-EIIRQEAKNPWLLGSIVDE
ADNHGHVENRKTFNLFANTNIYVFFRHLATIYERLVEVKKMNDEVTKEIAN--RKVVQFA
KDLNLISTQLTDMGLDFKGEDAYEKLLQLSRSLIAGDLEHQWFEESLRQAYKNKAFKIYT
VDKVIQALVKHAHAIITDNKTVEIMMLFEKDRTSLSTSTKDQILYRLQVRSNMSNIENMF
RIEYNRLTAHVCIQFVAVDDLTLEEPKSLKDKWQYYLTSYSLSHPTEGISHDNLRSPFLE
-KIIESEEDIIE--DKD-------EKYSPEGVATSNLKVKIDPITYSMEVEFGSHDIFSR
KAVNKFPVRV--DIRKKKSSELKLELERFLNSNSGWKKDLSAKQIAEVEKRLEFVKLNGN
LEEYSDDSAVASTSAVSGSDLAKEDIARSQSESTVV-----SASM-----------ATCA
QSTLKTEKDKPDSTFTATNNAESN
>TPHA0J00400
--------MSQVWNQSQ-------------------------NSNGSANGSATPGPATNA
MDVDGNEA----------------------------NKPVVLPSF--SKLNNNSSNGSV-
------------------------------------------------------------
----------------------NSNANASTSSNTTTQTPLHHFPNS------------NA
NVNSNSLSVASFDNPL------------PV--------KTETTPAISAETSIPNVNTTYS
ATAGTTASANDSKES---------------------------------------------
------DEQFYRPLNVKDALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIER
V-STLFRGYPSLIQGFNTFLPQGYTIECTNNPND--PIKVTTPIGSETIPYAKPIPSAAT
NTNVPGPTTSTSPPTAATTTGTTT-------PVAANTTAIPNITRNKETNAIENVATAAQ
PSLLPNLGTPSHTEVTKSE------------SVIQSSANAPIQPN---------------
-------------------MHNMTQDTMKITEKPADVEFSQAVSYVNKIKNRFVDEPDIY
KTFLEILQTYQKEQKPIHEVYSQVTILFQNAPDLLDDFKKFLPDNNNSAGAETNQNIQAN
AMQYQQLHQNNVAI----------------PQHIYENNTYY-------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------QNNVPTAAAAAANAAGNVVTIQSLPPLGNFLPPSN
KNN-------------NTTAVNN--NLMGISSIMHP-----KVDHIQSQQYIADQKQAYT
PAQQQSTTQL---TNEAMQISELRGSPMMDGQTARNLANVNYSPAELNQLQAQQHISIQQ
QQQQQQQQQQQLQMQMQMQM--------DGG-----------------------------
-------YP---QDISVRPEIDLDPSIVPVIPEPVEPIEDSLSLVEETNFFDKAKKFINN
KQIYMEFLKILNLYSQNILNVNELVEKVQYYLGSNKELFDWFKGFVG-YQDKPKHIENIV
HEKHKLDL-DLCEAYGPSYKKLPKTDTFMPCSGRDEMCWEVLNDDWVGHPVWASEDSGFI
AHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEERANFKL--PIG
LGHTSVTIYQKVIRKVYGKERGFELIDALHEYPAVAVPIILKRLKQKDEEWRRAQREWNK
VWRELQQKVYYKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKLHWLTPKPKSQ
LDYKVADRQILYDILKLTDVFINHTSNYSNPDKERLRDFLQSFISLFFFIPLADIKAAIK
IRSPLDDTKTDSEESS-------------GDSDKFPKKRSIEDDD-ISFHDILD-KVKYQ
KVK---------QGLDKNETFSNDISSATSVDDD-------ELIRQEAQKPWLLGSIVDD
ANSLGIIQNRSKYNIFGNTNIYVFIRHLITLYERLNEAKQMNAEVTEEIKN--RSIVPFA
KDLNLVSTQLKNMGLDFEGTDSYKQLLDLSTRLIEGNLEHHWFEESLRQAFRNKAFKLYT
IDKVTQSIVKHAHTIMSDTKTAEIMMLMEKDRSCATTSSKDQILYRLQARSHMSTTDNMF
RIEFNKSSDNISIQYIGMDDLTLGEPKTAEEKWKYYITSYALSHPTEGVPQEEIQIPFLE
-KILETEEAYAE--EEE----VINDKYSPKGVSQSDLKIKISPENYALEIEPGSFDTFSR
LSMNKYPIDVTSDDYKNKKKLSIDRVNAFLNGKFGWKQSLSEDEINNINLKYSHIKKYGS
LKNYVVPVVAAIPNKPLENKEKTQEEETPDVANLES------------------------
----KVVESSSSTTNEVKA-----
>Kpol_1037.22
--------MSQIWNQN--------------------------GTSNTSNNENQQQQ----
------------------------------------QQHVVLPSF--SNINPENTTNIS-
-------------------------------QQSNNKST--------------NTTPSST
SNTP----------------NTGVKLENSSSLSRPNLPKT--------------------
---STTLSVASFDNPL------------PP------------------------APAAHL
QQQQQQQQQQQQA-----------------------------------------------
------DGSYYRPLNVKDALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIER
V-STLFRGYPNLIQGFNTFLPQGYTIECSSNPDD--PIKVTTPLGSQIVTNSSIAKPASA
SPSAPSTTV--APTSTATTPATTATASTATVTATAPTAAANNTAATTTTTAPAPAPAP--
-APAPAAGPTVAPAPVVAT-----------AHAAVTTADAESKKPAVLQVSNTNTGISSP
SSTIPA-------GTVPGTTVANNIQGTTQIEKPADVEFSQAVSYVNKIKNRFADQPDIY
KHFLEILQTYQREQKPISEVYAQVTVLFQNAPDLLDDFKKFLPDSSPSVTTQQPVQPQQQ
ALPQQQ------------------------QPMYGVNNGYY-------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------QAGKIPSAN-------------QNLPPLGNFSPPSN
GAVPGRPE-------EFSTEAQH--HMMALPSMLQA-----PTEHAQ-----------LH
AQQHIAP--M---TNEAIPISDLRSQIIDNNHVH------NYTPIELAQLQQQQQQQQQQ
QQQQQQQQMQL-----------------EAA-----------------------------
-------YA---TEGIVRPEIDLDPSIVPVIPEPTEPIEESLSLVEEANFFDKAKKFIGN
KQVYVEFLKILNLYSQDILSLDDLIEKVDYYLGSNKELFDWFKNFVG-FQDKPKHIENVV
HEKHKLDL-DLCEACGPSYKKLPKTDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFI
AHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKQAFKL--PIG
LGHTSTTIYQKVIRKVYDKERGFEIIDALHEYPSVAVPVVLKRLKQKDKEWRRAQREWNK
VWRELEQKVFFKSLDHLGLTFKQSDKKLLTTKQLLAEISSIKVDQTNKRIHWLTPKPKSQ
LDYEVKDKRVLFDILRLADVFINHTSSYSNPDKERLRDFLQSYIGLFFSIPIREIKDAVE
--AAIDNGKQLDENEQ-------------NSSKKNSNKRP-RDVE-ICLSDILN-RSRYQ
RLK---------HSLDSSEASLGAVSPGQNEQDDMD-----EMIRQEAKKPWLLGSLVEE
ANSQGLIQNRKIYNMFANVNMYVFMRNLITIYDRLHEVKDINDVVTKEING--RKVVQFA
KDLNLISAQLKNMGLDFSGGDSYTQLLLLSKRLIEGDLEHQWFEESLRQAYRNRAFKLYT
IDKVIQSLVKHAHAIMTDSKSSDVMALFEKDRISSSTTSKDQILYRLQTRSHMSTTEHMF
RIEYNTKKSSISIQYIALDDLTLEEPKTLEDKWKYYITSYSLSHPTEGIPQEEIKIPFLD
-KVIESEQVHME--DED-----DNPKYSPEGVSKSNLMIKIDPETYRLEVEPGSFDIFSR
KSVNKFPVDVFSESYKVKKQTRRNRCKNFLNGKHGWKRQLSSDAISKIEQKFNDLKN-GT
FQQ-RSRSATSETTSVPLNASDSTQKEQESTGTSETSQPALQKVP-----------INSA
EPDQEER-GNDTTTEEVESESVVH
>ZYRO0C07524g
--------MSQTWDRSPPTGSNSAHDTDTNNMNNNNSNANSQNATNNNQGSNKGSEVDSD
NNENNNNPASRNGVELPLPQQQQQNSGTEIKQESGSKPHFVLPSI--SDLSGETGSSPS-
------HGGSGTTNTTNVNTSGSQNPNATGAGVNSTMAPGVPSMLSQQSLPRLSSVQATY
PSAP--------PVLPRFSTATAGEVQGPTTLTSSSSIPTTQQQQQQQPPDDKSRIGVKP
RSGSAGMSVASFDNPL------------PP----SQPS---V-PSLHYQMLSSQQQQEQK
GQDQQQQHQQQQQQI---------------------------------------------
----PLHDQYYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIER
V-STLFRGYPNLIQGFNTFLPQGYRIDCSQNPDE--PIKVTTPMGSSTVAGVAEMNQAAL
FQGQQPRIQ-QHLQPLSFPPSQDYQLQ----QQQQPQQQVPFEQARGQQVLPATFPPPAE
NAPQQQLQHQQQQQQASST------------HVQPPTVGPPSQQP---QQQQPQHGSPQP
APQPTSAVSSGTGPTQPEVPAPVQPQLADQTKKAADVEFSQAISYVNKIKNRFSDQPDIY
KHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKFLPDSSASAAQQQRQQLQPV
MQHQ--------------------------QAAAATGYGYY-------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------GENQPVAR-------------QNLPPLGSFSPPPN
GTA-------------PRDYYQEPSQGMALPPMTHL-----ETQAAK-----------VT
PSHYVMTQGM---SNDAIPLSNMRSPTVGAPGAQTPVETAPQHPQQYSPQQAPQPQLPQQ
QLPPQQQEQSLPPQTIPLTQPSQLGPQQEVQ-----------------------------
-------YV----DIAVRPEIDLDPSIVPVVPEPTEPIEDSLSLVEETSFFDKAKKFIGN
KQLYTEFLKILNLYSQDLLDIDGLVEKVEHYLGGSKELFTWFKNFVG-YQDRPKNIENVI
HEKHRLDL-DMCEASGPSYKKLPKSDTFMPCSGRDEMCWEVLNDEWIGHPVWASEDSGFI
AHRKNQYEETLFKVEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKANFKL--PPG
LGHTSLTIYKKVIRKVYDKERGFEIIDALHEHPAVAVPVVLKRLKQKDEEWRRAQREWNK
VWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKRIHWLTPKPKSQ
LDYDFPDREIFCDILSLTEVFLNHTGNYSNSDKERLKDFLKSFLSLFFSIPVSEVNDGLR
RRSPSNKEEHEANKKE-------------NGTALAHGKRP-REIE-LPLRDILH-RNKYQ
KLK---------LRSDGEEGSIGQSEEGLDEQEEVDE--EEEIIKQEAKKPWLLGNIVEE
ANAQGIISNRKSFNLFANTSIYVFFRHLTTLYERLIEVKSIDQEVTQEINS--RKVSQFA
KDLNLISEQLKNMGLDFAGLDAYEQLLHLSKRLIEGDIEHQWFEESLRQAYNNRAFKFYT
VDKVVQALVKHAHTILTDIKCSEIMVLFEKDRTLATTSAKDQILYRMQARSHMSNTENMF
RIEFNRISKHVCIQYIAIDDLTLAEAKSLEDKWKYYVTSYSLSHPTEGISHEDLQVPFLE
-KIIESEQEYDE--DNG-----GDPKFSPEGVSKSSLRIKIDPETYFLEVEPGSCDVFSR
KAVNKFPLEKNSESHKTKVDKKNELIRGYLDSEKGWKKNLDAKSIQSVEEKLNFVKNYGT
LQGYRAQENGLESTTKEAPFSDAVERKADSAAQADG---AANGGP-----------SNTA
GV--EERGGNDTTAEDVEA-----
>TDEL0G04400
------MSGTQGWSQQASSLSAGAGAASASASGGNATT----ETHNNENGMNQAVETSTV
GLTGGKTPEMTKQEIKVES-----------------KPHVTLPSI--SDLSGESAHNGK-
------------------------------DGLTSSNTP-----------LRLPSVQSTY
GSKA---------------PGAGQEVNGTIMESTVNPAPA------------------QG
RQNSVGLSFASFDNPL------------PP---------------QQQTILSSSHFQVLP
PHQQQQEQQQQMQQQ---------------------------------------------
----MQHDAYYRPLNVKDALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDR
V-STLFKGYPGLIQGFNTFLPQGYRIECSANPDE--PIRVTTPMGSSSVAGTIENAVAGF
PAQPRIQQLQQLGQQQ---------------EQSLPEHVLPGVQVTTSATTTPTLNN---
------QQPQPQPRPQLPA------------DYQLPLQPAAGQQS---------------
-----------------------QLPSNDQGKKTADVEFSQAINYVNKIKNRFAEQPDIY
KHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKFLPDSSPSANRQQQQPGVLQ
Q-----------------------------QSPAFGLSAYY-------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------NETSPPTSR-------------QNLPPLGSFSPPPN
GAVPH----------NYYRDQQP--QTLGLPPVAQV-----ENHIDQ------------R
SPPHIATQGI---AGEPMPVSNLRSQIT------------AQSPSELAQLHQQQQIPSQP
TANIP-----------------------DGQ-----------------------------
-------YL----DIAVRPEIDLDPSIVPVVPEPTAPIEDSLTLVEETSFFDRAKKFIGN
KQIYTEFLKILNLFSQDLLDVDELVGRVEHYLGGNKELFVWFKNFVG-FQDKPKHIENIV
HEKHRLDL-DLCEACGPSYKKLPKSDTFMPCSGRDEMCWAVLNDEWVGHPVWASEDSGFI
AHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMSEEEKATFKL--PPG
LGHTSLTIYKKVIRKVYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNK
VWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLISEIGSIKTDQTNKRMHWLTPKPKDQ
LDYYVPDKSVFFDILSLTDTFINHNSSYSNPDKIRLKDLFKIFVSLFFSIPMYEVNEAVS
RRGNLDDDKEDSTQKM-------------ESDNLNNSKRP-REDE-ISLSEVLH-RAKNQ
RFK---------SRAADETS----EESAAEPEPELNE--EEETIRQEAKKPWLLGNLVEE
VNAQGLINNRKTFNMFANTNIYVFFRHLTTLYERLEEVKKMNDAVTKEINS--RKVVQFA
KDLNLISQQLKEMGLDFEGADAYEQLRHLCKRLIEGDIEHQWFEESLRQAYNNKAFKLYT
VDKVIQSLVKHAHTILTDSKTSEIMTSFEKDRTQINTSAKDQILYRLQVRSYMSSTENMF
RIEYNKQSKNVRIQFIAVDDLTLAEPRSLEEKWRYYVTSYSLSHPTEGISQEELQLPFLE
-KVLETEEDYGS--DVD---NFSIDKFSPEGVSKSTLKIKIDPETYLLDIEAGSYDVFSR
KSVNRFPVIVDSNDYTTKKEKKKNMVIQFLESKKGWKKNLDDDQVKAIQEKLARVKENGS
LDDFNEASQTQQASEIIAPSKVEQSKESTVADVNSL----------------------PK
ELVEAEDRGNDTTADEVDPEVVAH