MUSCLE (3.8) multiple sequence alignment

ACL019C            ----------------MPREVSWPMWAMFITATYALAGWSAYSCATSFDDPLSALFMASS
Ecym_3048          ----------------MPREVSWSIRLQFIAVTYALAAWSLYNCTSTSLSFLQAMYKATY
KLLA0C05874g       MFGLFNRNPEAGAPGQPQNVFLTQKFIAYSLMSYTAAAWSLHYCVTTSFSYLHAMTKITE
KNAG0E02740        -------------MLVLNLRSRKQQFALLVVVIYLLTAFTVINAFGNSHTFLEWTTGLTQ
CAGL0E02299g       ----------------MLTAIHKREFLIFTAITYVLTIYCVISACQSSVSFLQIALKLSE
NDAI0C02770        -----------MAIQISMLNSKKFQFVIFSISVYLITFFTIINAANSSTSFLHLCLKLNE
NCAS0D02010        -----------------MLQTRRSQLIAFTAIIYVLTISCIINSAIKSTSFLHLSLKLNQ
KAFR0A05240        ----------------MIVQSRKQQLVIFSMIIYLLTIITIFTSYKSSKTFLQCTIKLTQ
SAKL0E01958g       ---------------MPVSQNRRGQFIVYSVFTYSAAIWSVYDSLSSSVTFLQTTIKLCE
KLTH0C10604g       ----------------MALRVQRRQFVGYTVFTYTAAAWSVLDCLQPSLSFLDACLKLCE
Kwal_56.22522      ----------------MAVRVQRRQFAAYVFASYAAAAWAIIGTVQESLSFLELSARLCE
TPHA0F02480        --------------MSSLSVTRKYQLALITFVIYTSTIFVTYLAIQSSSSYLQVTIKLTK
Kpol_1035.50       -------------MLQRLNIPRSYQLLLLSLVVYSATFLSIYFAVLSSTSYLQVTIKLSQ
TBLA0B00560        ---------------MPFYQSRTAQFVLFTLFIYVLTFASVYFAISSSISFLQVTIKLTQ
YOL013C            ----------------MVPENRRKQLAIFVVVTYLLTFYCVYSATKTSVSFLQVTLKLNE
Suva_15.159        ----------------MVPENRRKQLVAFIVVTYLLTFYCVYSATKTSVSFLQVTLKLNE
Skud_15.148        ----------------MVPENRRKQLIVFIVVTYLLTFYCVYSATKTSVSFLQVTLKLNE
Smik_15.157        ----------------MVPENRRKQLVVFIVITYLLTFYCVYSATKTSVSFLQVTLKLNE
ZYRO0C07194g       ---------------MATSDTRRRQVACFALSVYALTIYAVYNSARTSVSFLQATIKLTT
TDEL0G04250        ---------------MAISETRKRQFIVFSIFVYALTIYSVYNATRTSISFLQTVLRLTE
                                                    *  :              *        

ACL019C            GVHFVIWGNFLIVHYCLFVWAIIRVLFGQLTAIEYDHIFERLHVVLVTLASIVITMRKTY
Ecym_3048          GVHLIIWGNFLLVHYFIGGWLVVRMLFGRLTLLEYEHIFERLHLTVLSSLSVLITMDRKN
KLLA0C05874g       GIHAMIWGNLFLLNSVLILKGVIHMLFGQLRLIEYEHILERISYTVITLLLSCSSMNGLI
KNAG0E02740        GVNYVIIAAFSLLNIVLLWKGFTYMVFGDLRLIEEEHIFERIPLTVINLIMISSLLSDKY
CAGL0E02299g       GFNILIITVFTLLNSTLLWQFLTSMLFGELRIIEHEHIFERLPFAVINTIFMFSTFNEKY
NDAI0C02770        GFNIMIITIFILLNSLLSWKLITWFLFNDLRLIEQEHIMERLPFTVINFIVMATMFNERF
NCAS0D02010        GFNVMIITIFILLNALLLWKFLNFLLFKELRLIEQEHIMERLPFTIINFIFISTMFNEKF
KAFR0A05240        GINVLILAIFTALNLFLLWEFLRWILFGELRLIEHEHIFERLPFTIINVLFMISIFNEYQ
SAKL0E01958g       GVNLIILGNFCLLNGVLLWKLLTRLLFGELRLIEYEHVFERLSFTIVNSIFVSSMFKEQD
KLTH0C10604g       GLNLVVLCNFAIVNSILLWKGLTRLLFGELRLLEYEHIFERLSFTIVNCFFMSSAFPEYQ
Kwal_56.22522      GLNLILLCNFAAVNGVLLWKALTHLLFGELRLLEYEHIFERLSFTIVNCFFMSSAFSESE
TPHA0F02480        GLNVIILVLFGLLNVAFIWKGLMYLLFSSLRLIEYEHILERLPFTIINFCLLSSMFNERD
Kpol_1035.50       GFNAIVLVLFAILNGTYVWRFFIWLAFGNLRLIEYEHVMERLPFTILNMVITYSMFNDKS
TBLA0B00560        GFNIIIISIFSIINSIILWKFSNYLLFGELRLIEYEHVLERLPFTVINMVFMSSMFNEHD
YOL013C            GFNLMVLSIFILLNSTLLWQLLTKLLFGELRLIEHEHIFERLPFTIINTLFMSSLFHERY
Suva_15.159        GFNLMVLSIFILLNSTLLWQLLTKLLFGELRLIEHEHIFERLPFTIINTLFMSSMFHERY
Skud_15.148        GFNLMVLSIFILLNSTLLWQLLTKLLFGELRLIEHEHIFERLPFTIINTLFMSSMFHERY
Smik_15.157        GFNLMVLSIFVLLNSTLLWHLLTRLLFGELRLIEHEHIFERLPFTIINTLFMSSMFHERY
ZYRO0C07194g       GFNVVILTVFTILNSAVLWKLSTAILFGNLSLLEYEHIFERLPFTIINTVFMSSMFHEQD
TDEL0G04250        GFNIVIITVFFTLNSVLLWKLSTSLLFGSLRLIEYEHIFERLPFTIINTMLMSSMFSEHD
                   *.: ::   :  ::          . *  *  :* :*::**:  .::.       :    

ACL019C            M--AGHMTILFYTLCLVAHWVLRDRMDFVF-QVHGTDSSLLGILC-SRFMFSLLVLGMVD
Ecym_3048          S-KIGVIAIPFHVLCQVLHWVVRDRMEFVFAPPIGTRMAMKDLLF-SRFMLSIVVLGVVD
KLLA0C05874g       S--VMQIHCVLFVCCRTLHWILKDRMEVTF-QANDMRLTLKDILL-SRFMFNLLVLTAVD
KNAG0E02740        M-FDIVLLGGLLLVLKVSHWILRDRLEGFL-QRINDTTTLTSLLF-SKFSRNLLIFGILD
CAGL0E02299g       F-FTLATCALVLLYMKVFHWILRDRLDLLL-QGINEDTRWKDLLV-NRYICNLLLLVVID
NDAI0C02770        F-FTLTIYGLLLISLRVYHWILKDRLEFII-QTINDSTSMTKIIF-SKFSFNLISLSLIN
NCAS0D02010        F-ITMAFYGFILLYMKIFYWILKDRLEFLI-QS-NTNYSVSRFIF-SKFYLNLIILSTIN
KAFR0A05240        F-FNALVFALILSVLKVFHWILKDRLESLL-QSINDATDLKNLIF-SRYMLNLAIFSVLD
SAKL0E01958g       F-LTVLVFTAVLIFLKVFHWILKDRLEFVF-QNANENTNLKKMLF-SRFNFNLLFLASVD
KLTH0C10604g       F-LTVMILFALLTFIRVFHWVLKDRLEYVF-QHTDERTNIARLLC-SRFFLNVIIFAVVD
Kwal_56.22522      F-MSVMAFSAALIFVKVFHWVLRDRLEHVF-QHTDEHTNFARLLL-SRFFFNIFLLGFLD
TPHA0F02480        IIMSISSYGMILIFMKVAHWVLKDRLESLL-QSMNDNSSIRSLIFSNRFFLNLGLFAVID
Kpol_1035.50       IAFTGSIFGFFLIFMKVLHWILRDRLDAIV-QSFNDSSTLTSIILSNNFFLNLIIFTIVD
TBLA0B00560        I-FTTIILSLLLLYMKVSNWILRDRLESLL-QTVNDSTTIFNLIFSTQFFFNLILFSLID
YOL013C            F-FTVAFFGLLLLYLKVFHWILKDRLEALL-QSINDSTTMKTLIF-SRFSFNLVLLAVVD
Suva_15.159        F-FTVAFFGLLLLYLKVFHWIIKDRLEALL-QSINDSTTLKTLIF-SRFSFNLALLALTD
Skud_15.148        F-FTVAFFGLLLLYLKVFHWILKDRLEALL-QSINDSTTMKNLIL-SRFSFNLVLLAVVD
Smik_15.157        F-FTVAFFGLLLLYLKVFHWILKDRLEALL-QSINDSTTMKTLIF-SRFSLNLVLLAALD
ZYRO0C07194g       F-FTVTLFGLLLLYMKVFHWILKDRLEALL-QSIHESTTLKSLIC-TRFSFNLVLLAILD
TDEL0G04250        F-LTVAIYGLLLLFMKVFHWILRDRLEALL-QTIQESTTLSDLIF-TRFTFNLVLLAIAD
                                      *::.**::  .            ::  ..:  .:  :   :

ACL019C            YKMLKFC-------------VQNTNVDGKRH----------------------ELYLMLA
Ecym_3048          FKLMMYF-------------YRQHQAEQGYL-------YYLLFSDNGQNTSEDRLSLSLG
KLLA0C05874g       GIIVAYY-------VNKI--LYKSNIDVTYT-------------------------LFII
KNAG0E02740        YFVTKIC-------------FFNHFGNFYHH-----------------GDFSNITQIMFG
CAGL0E02299g       SYVISFC-------VSTAYNIASSIFTAGTN--------SIVLGGGSPLTQRALIYIMQA
NDAI0C02770        LKLIQNC--LTWDDI-NF--WKNNQNLFNSIMNYLINPISSTTISNGINNHSNPVYLMLG
NCAS0D02010        LQLIKTCIPLNYEFLKKL--YLNSTSILQSLINY---SSPSSTHASNFNLGVNPIYLMLA
KAFR0A05240        FWICSNT-------YRAFRGYDNNNSTNNNQNAD---SSNLMNKNNLTPTNKKALFLLFG
SAKL0E01958g       YQMVRYC-------LSNS--ISNDQW--TSS----------------------SVYLMFG
KLTH0C10604g       YQMVRFC-------LRNS--LTNKHDPSPSA----------------------PVYILFC
Kwal_56.22522      FQMTKFC-------IQGTRFFSRSGFYSSSL----------------------SVHLMFA
TPHA0F02480        YQMMMQC-------VTNS--IKNSMG--AST----------------------SIHLLLG
Kpol_1035.50       YKMVSYC-------VSNS--LSNSMG--AST----------------------TVHLLLG
TBLA0B00560        YLMMNFC-------ISNS--LLSNSNIGSSA----------------------SVYLLMG
YOL013C            YQIITRC-------ISSI--YTNQKSDIEST----------------------SLYLIQV
Suva_15.159        YQIITRC-------ISSI--YTNKNIDVVST----------------------SLYLMQV
Skud_15.148        FQILIRC-------ISSI--YTNQNIDIIST----------------------SLYLMQV
Smik_15.157        YQIIVHC-------ISSI--YTNQKIDIVST----------------------SLYLMQV
ZYRO0C07194g       YKIVSGC-------ITNS--LSNSFG--AST----------------------SVHLMVG
TDEL0G04250        YQIISHC-------VSNS--LDNSFG--ASA----------------------SVHLMMG
                     :                                                     :   

ACL019C            LSFAQLILDVLHVVLLTSLNLFEMVRSRRT-------RSANLVYEGG-------------
Ecym_3048          VDFGLLFLDWLQVVLLNCLKFVELFKAGRR-------VQEHQLLDNNE------------
KLLA0C05874g       SQYAILGTDLLQVILRTGLNLFELSTIQNRARIR---RNADHHVDEPVINHEERPNAVA-
KNAG0E02740        LEYAVVFIDLINILCHTVLNFYAFHRTQLQSAR----FNLEMMNDDFS------------
CAGL0E02299g       MEFTNLMIDLVNLILNTGLQFYEFHLSRKF-------SQNNPTFNSISAEDA--------
NDAI0C02770        MEFSILLLEYFNVLFHSLLSLFEFYKSKQFSIQQQQIRQNNLINRAQTTQNDENEINIGL
NCAS0D02010        MEFAILLINFINLFLHSILSLYEIYKSNQY-------DQLNAIIEDIEDE----------
KAFR0A05240        MEFFVLFLDLINLAMHTVLNFYEFYCSQRATAH----HNVNAGTDEESEE----------
SAKL0E01958g       IDFAMLLVDTLSIGLHGVVNFVEVYRLQSH------------------------------
KLTH0C10604g       VDFSMLLVDVAEVAMKSVINLIELIQCKRA------------------------------
Kwal_56.22522      VEFAMLLVDVTEVAMKSIINLVEVYQCKRS------------------------------
TPHA0F02480        VEFTMLLVDLVNLFLHTCLNLYEFHKSIED-------RNLNIVGED--------------
Kpol_1035.50       MEFTMLLIDLLNLFLHTCLNLYEFHLTTLE-------RSSNIIQEDG-------------
TBLA0B00560        MEFTMLLVDLFNILCHSILNIYEFYKSSLVS------LDTHLT-----------------
YOL013C            MEFTMLLIDLLNLFLQTCLNFWEFYRSQQSLSN----ENNHIVHGDPTDENTVESDQSQP
Suva_15.159        MEFTMLLIDLLNLFLQTSLNFWEFYCSQQSQSN----ENNHIVQDEVEDENEVDSGEPHA
Skud_15.148        MEFTMLLIDLLNLFLQTCLNFWEFYRSQQSQSN----ESNHIVHDDTPNGVGFEEAHAV-
Smik_15.157        MEFTMLLIDLLNLFLQTCLNFWEFYRSQQSQSD----DGNHIVHDDLSDGNRVDFDGSQH
ZYRO0C07194g       MEFAMLLIDLLNLAMHTVLNFYEFYRTQVDAHL----SSVDTDTDGGDEE----------
TDEL0G04250        MEFALLLIDLLNTTLHAALCFYEFYQSQTHG------RRN--------------------
                    .:  :  :         : :  .                                    

ACL019C            ----TTDDDADDEVFI-LEGKYIYETVFDLTITVLKVILDIIQEVFVPWS---ITVVYSI
Ecym_3048          ----LENDIEDDGAFI-LEEKFIYEKIVETVLEILKILLNIF--LITSGIHS-FVVFYNI
KLLA0C05874g       ----IEEDEDEDEENAGLEGKFIYEKLIDVFISTVKVIIKFA----SSFSTG-RVMMVTV
KNAG0E02740        ----EDENDSGVNADGGLEGKFIYEKLIDFVAGVLRTGLHFT--MLIPLRFQ-SMLVKDF
CAGL0E02299g       ----DTESEDGDSQFNGLEGKFMYEKLIDVVTRFLQTLVHVV--MAMVLNLP-LMLVKDI
NDAI0C02770        DIDIDDDEEDDDETFNGLEGKFIYEKIIDLFTRFLMTIIHVS--LLLPLNIP-MILVKDI
NCAS0D02010        ----NDDDDDTPADFNGLENKFIYEKIIDLFTRSLMTMIHIS--LALPLNLP-MIVLKDI
KAFR0A05240        ----EADGDDDDANFNGLEGKFMYEKLIDVSTKFFKTIVHIF--VLIQTKLQ-IMVLKDV
SAKL0E01958g       -------NSHYDEEFLGLEGKFMYEKLIDMGARLLKMLLHIA--LLIPFRMP-IMIIKDI
KLTH0C10604g       -------FERDGDDFVGLDGKFMYEKLVQLVCQVLKLGLRVA--SLAPFSMP-LMIAKDI
Kwal_56.22522      -------FARDGEDYTGLEGKFMYEKVVQLICQLTRMGLHIM--LMMPFSMP-LMIAKDI
TPHA0F02480        ----EDGLVDDEEEFNELEGKFMYEKAIDIFTRFLKTLLHLL--MFIPFRMK-IVLLKDV
Kpol_1035.50       ----EDDEEDDELQFNSLEGKFMYEKTIDVFTRFLKTFIHIL--MLIPLRMKFFLLLKDV
TBLA0B00560        ----SEDEEDDESGFNGLEGKFIYEKIIDTFTRFLKTIIHIL--LLIPFAMP-VMLSKDV
YOL013C            VLNDDDDDDDDDRQFTGLEGKFMYEKAIDVFTRFLKTALHLS--MLIPFRMP-MMLLKDV
Suva_15.159        EL--DDDDDDDDRQFTGLEGKFMYEKAIDVFTRFLKTALHLS--MLIPFRMP-MMLLKDV
Skud_15.148        ----LNDDDDDDRQFTGLEGKFMYEKAIDVFTRFLKTALHLS--MLIPFRMP-LMLLKDV
Smik_15.157        ALN-DDGDDDDDRQFTGLEGKFMYEKAIDVFTRFLKTALHLS--MLIPFRMP-MMLLKDV
ZYRO0C07194g       ----NEDEDVNGSSFAGLEGKFMYERVIDVFTRFLKTLIHAI--MLIPFRMS-ILLIKDV
TDEL0G04250        ----AVNDDEDDTQFSGLEGKFIYERVIDISTRFLKTVLHAL--LLVPFRMP-IMLIKDV
                                    *: *::**  .:         :                :   .

ACL019C            FVRSIKAGESFLLVYNYWKNNKKLYEKLSDVSEEQLDDT---DSMCIICMDDML------
Ecym_3048          FIKSIETCERCVLLFNYWKNNRRLHEKLLDVTAGHLDGV---DITCTICMDDML------
KLLA0C05874g       LWEAITTFKSARGLWKNWKSSKSLDASLMDATDIQIESG--EIDICIVCMEDFL------
KNAG0E02740        VWDLFNLVNNGNSLWKIYKNNRQLNKKLPNIAIEDLLDH---DNMCIVCMDDLVLVHHPT
CAGL0E02299g       FVDVWVLYMNSKSLLAIWKNSKQLDTKLPTMTSDDLNNDPNFDNVCIVCMDELV------
NDAI0C02770        LWDFFSLYRNAMSLYKIWKNNQKLESALPNMTPDDLQHS---DNVCIICMDDLL------
NCAS0D02010        IWDLISLYQNCKILFQILKNNKNLDSKLPDMIPEDLQDS---DNVCIVCMDDLL------
KAFR0A05240        VWDCLTLYQDSISLWKIYKNNKQLDDKLPTLSVNDVEND--NDNICIVCMDDLV------
SAKL0E01958g       IWDAISLYQTATSLWKTWKNAKKLDEKLPDVTEEELNQG---NNMCIVCMDDML------
KLTH0C10604g       IWDGIALFHTGKSVWRTWKSNRQIDEKLPDVTEAQLNAS--EDKMCIVCMEDML------
Kwal_56.22522      LWDAFAVFHTAKSLLLTWKSNRQIDEKLPDVSEAQLAAS--DDKMCIVCMDDML------
TPHA0F02480        IWDVITLYQSTVSLWKTWRNSKQLDEKLPTVSLEELKSS--DNDMCIVCMDSLI------
Kpol_1035.50       IWNVISLYKHTGSLWKTWKNNKQLDDKLPTASIEELKNT--DNNICIVCMDDLL------
TBLA0B00560        VIDLVTLSQNINTIWKIWVNNRKLDDQLPTVTQHQLDSM--EDKICIICMDDLS------
YOL013C            VWDILALYQSGTSLWKIWRNNKQLDDTLVTVTVEQLQNSANDDNICIICMDELI------
Suva_15.159        VWDVLALYQSATTLWKIWRNNKQLDDTLITVTIEQMQNSANEDNICIICMDELI------
Skud_15.148        VWDVLALYQSGTSLWKIWRNNKQLDDALITVTAEQLQNSANEDNICIICMDELM------
Smik_15.157        IWDILALYQSATGLWKIWRNNKQLDDSLLTVTVEQLQNSANEDNICIICMDELI------
ZYRO0C07194g       FWDVLTLCQIVSSLWRIWQNNKQLDDKLKTMSPVELSAT---DNICIVCMDELC------
TDEL0G04250        LWDCLTLHQNAKGLWKIWRNNKQLDDKLPTMSEDQLRNI---DNMCIICMDELI------
                   .            :     . . :   *       :         * :**:.:       

ACL019C            --------------------PTTETTKM-------------------NRRAKMLPCGHML
Ecym_3048          --------------------PSKDVKVN-------------------NKKAKMLPCGHML
KLLA0C05874g       --------------------PSHQRKSD-------------------GKKVKILPCTHAL
KNAG0E02740        KRRQSVQEECDDEKNTEKDKPSTTEEDL----SEVEPTQGDIDRMADSKKPKKLPCGHML
CAGL0E02299g       --------------------SENPHHHQ-----------------SDGKKPKKLPCGHVL
NDAI0C02770        --------------------PSLETLEHATNVSSTTPSSNHYLNIKKKKKPKKLPCGHFL
NCAS0D02010        -----------------------SEEHK-------------------KKKAKRLPCGHFL
KAFR0A05240        --------------------PSLHGKEA------VEMTQADIDSISKSKRPKKLPCGHML
SAKL0E01958g       --------------------PNSETRNA-------------------NLKPKKLPCGHIL
KLTH0C10604g       --------------------PPSEATSA-------------------KHKPKKLPCNHCL
Kwal_56.22522      --------------------APSECTNA-------------------KQKPKRLPCNHCL
TPHA0F02480        ----------------NIDFNSTEETEN-----KEKEEQIYNAAIHSKQKPKKLPCCHIL
Kpol_1035.50       --------------------PRINSEKY----DSQREKELYDHIMKSKQKPKKLPCGHIL
TBLA0B00560        --------------------INSIQKNF------------------EKRKPKMLPCGHIL
YOL013C            --------------------HSPNQQTW----------------KNKNKKPKRLPCGHIL
Suva_15.159        --------------------HSANQQAW----------------KNKNKKPKRLPCGHIL
Skud_15.148        --------------------HSQADQTW----------------KNKNKKPKRLPCGHIL
Smik_15.157        --------------------HSTNQQTW----------------KNKNKKPKRLPCGHIL
ZYRO0C07194g       --------------------ADLEEVVQ--------GPDREKVAKTGKYKPKRLPCGHVL
TDEL0G04250        --------------------PEQDEGHT-----------RNT-----KNKPKRLPCGHVL
                                                                    . * *** * *

ACL019C            HFGCLKSWMERSQTCPICRLSVF----------ANDSNSHAT------TQAREQTPPDLL
Ecym_3048          HFGCLKSWMQRAQTCPICRFPVFGSSNPRAGQNANSNGIVPTQSEQQQQLQQQQQQQQQQ
KLLA0C05874g       HLSCLKNWIARSPTCPICRLPIF----------DENGNVMPY------------QDHSQS
KNAG0E02740        HFSCLKNWMERSQTCPICRVPVF----------DKDGNVRPS---IAKTRRSPPMSSSRS
CAGL0E02299g       HLSCLKNWMERSQTCPICRLPVF----------DENGEILAP--------SSANVSQTNL
NDAI0C02770        HFSCLKNWMERSQTCPICRLDVF----------DKNGNVKVY----PNTNTNTNVNDSSH
NCAS0D02010        HLSCLKNWMERSQTCPICRLPVF----------DESGNVKES------------------
KAFR0A05240        HLSCLKNWMERSQTCPICRLPVF----------DENGNVKPF----LHTTTNNNMQPNND
SAKL0E01958g       HLSCLKSWMERSQTCPICRLPVF----------DERGNVTRM------------DSSSQE
KLTH0C10604g       HLGCLKSWMERSQTCPICRVSVF----------DSKGNVALP---------NQNAAQQPI
Kwal_56.22522      HLGCLKSWMERSQTCPICRVPVF----------DKKGNVVVT------------------
TPHA0F02480        HLGCLKNWMERSQTCPICRLSVF----------DSNGNILPFNNTRSDTMRNTELTATNS
Kpol_1035.50       HLNCLKNWMERSQTCPICRLPVF----------DDKGNVMPSTHSQNQTETQQQQPQTQT
TBLA0B00560        HMNCLKNWMERSQTCPMCRLPVF----------NEKGEVLPT------------------
YOL013C            HLSCLKNWMERSQTCPICRLPVF----------DEKGNVVQT---------TFTSNSDIT
Suva_15.159        HLSCLKNWMERSQTCPICRLPVF----------DEKGNVVQT-----PFTSNSTTTRNNT
Skud_15.148        HLSCLKNWMERSQTCPICRLSVF----------DEKGNVVQS--------TFTSNTGTTS
Smik_15.157        HLSCLKNWMERSQTCPICRLPVF----------DDKGNVVQT---------TFTSETNSS
ZYRO0C07194g       HLFCLKNWMERSQTCPICRLPVF----------DENGNVVQSQSSTTNRTTQATNQSTNV
TDEL0G04250        HLYCLKNWMERSQTCPICRLAVF----------DEMGNVVQS------------------
                   *: ***.*: *: ***:**. :*           . .                       

ACL019C            QERGIDEHIDVIGMQDMSVQSISLHEGTAVRRGTTGNCMN--------------------
Ecym_3048          QQQQQQQQQQQRRSSWHSENEIPHDPAHPVRNSEQSGFSAT-------------------
KLLA0C05874g       TDPNTTAQEISPGIAVETNSQTNINTLETTNQNITLSPD---------------------
KNAG0E02740        ANRSRASPAPIPTPTLTPTPTQTQAQTQPQTTPTSTAPT---------------------
CAGL0E02299g       NPGENPDQRDEADDELEDDTSIADLPITDNISAIPLTSDY--------------------
NDAI0C02770        DQTSENRPPSTSTSNIIPGSNTNITTNTPIPRNIDASNGSHEVS----------------
NCAS0D02010        -----ERPATAADADVDVDVAAAQPPSTSSSPSIPHSPI---------------------
KAFR0A05240        ADVTSTTATNSRTDTSTPMTDVPTPTRTSASALTTSSIIT--------------------
SAKL0E01958g       QQLPHNLQRQEAEGEVVQMTTSPFHTTSASVGPTSTTPT---------------------
KLTH0C10604g       SEDASVAQQPLSAANESNSTSLASTHTGSLGAVSSSNPN---------------------
Kwal_56.22522      --------SDQTNNQPGTSSAVESTADETSTAATTSVSS---------------------
TPHA0F02480        NDAADESTENDTEMDALLSSQVQESVGDTLARDINFRSSIGDADVEGENNDNYDLDNELE
Kpol_1035.50       QSTTELQPQTEVQPDLNQRQETNIQHNVQNVIETPGRDSAQDASRGGTG-----------
TBLA0B00560        --------RRERATTPEPSTSTSSDSEE--------------------------------
YOL013C            TQTTVTDSTGIATDQQGFANEVDLLPTRTTSPDIRIVPT---------------------
Suva_15.159        STTDTTRTATTATNQYISTNDTELIPTRTIPHDAGIASS---------------------
Skud_15.148        TNTTVTGATSATINRQVFTNQTELLPTRTTSPDVGIIPN---------------------
Smik_15.157        ITMAATDNTRTIVNSQDFANETELLPTRTTSPDVRILPN---------------------
ZYRO0C07194g       TTTAATTTTTTTTTTTTSTTEMDSSGGSTASTPSSRQST---------------------
TDEL0G04250        --------TVPTTAEVTPTDEINVPETVVERSQEQIQDN---------------------
                                                                               

ACL019C            -QAYDGGLLSHEERD-----------------QAGWVAFPIEFR--ADNKV-------FF
Ecym_3048          -NNNDGDDPNNQLRPVNNSNQQKN--------EPSWISFPTQYQ--ANGKL-------YF
KLLA0C05874g       -NSTAQNLAFLPT-------------------RNTSLIIPIQRE--DEHKH-------KF
KNAG0E02740        -LPVQVSLMDIPNR------------------TKSRFAIEKDTADDQERNI-------TI
CAGL0E02299g       -PFSIRNVGQEVCKELGG--------------TSEEMTHDV-----DEEIL-------EF
NDAI0C02770        -PAASPSPSPSPSLPILKHEQHDGNPINNFNETKNWYEFKIDS---DKSTYANNSQTISF
NCAS0D02010        -QETLEPEEASID-------------------NNTWYSFPITHINKDKSVI-------SF
KAFR0A05240        -QDFKNGITPID--------------------SVEWYAFEIDSISDARNEV-------KF
SAKL0E01958g       -QANRSVIMPQVPRV-----------------PQDWYAFPIEATQTTKDKV-------VF
KLTH0C10604g       --------------------------------FPTWYTFPVTLSD-NDGAV-------DF
Kwal_56.22522      -QSSSIAVTDVPSH------------------QRGWYAFPTVQVH-DEGSI-------DI
TPHA0F02480        IPNSDNPSQLLNSESQNAECEFN---------NVKWKSFLIKSV--NKESI-------SF
Kpol_1035.50       -SNSDHNLTNTQVSSEGSSNEQQGNVTNSILNTSSWYSFPIKTS--SDSSI-------TF
TBLA0B00560        --------------------------------NEEWVSFPIETI--DDSTI-------TF
YOL013C            -QNIDTLAMRTRSTSTP---------------SPTWYTFPLHKT--GDNSVGSSRSAYEF
Suva_15.159        -QNMNMSASMSAS-------------------SNTWYTFPLQQT--GNTSGESKCSTYEF
Skud_15.148        -HNINTLASRSTSTSTS---------------STMWYTFPLQQT--DDDSNESKCSTYEF
Smik_15.157        -QNTNTFASRATSTSTS---------------STTWCKFPLQQT--EDNDV-ESRSTYEF
ZYRO0C07194g       -QQTLGDLTPTPTTADSNSNI-----------ANLWYSYPIQEA--KDGVV-------TF
TDEL0G04250        -QQQMGEGQVAV--------------------LDSWYSFPVEET--SENLV-------TF
                                                                              :

ACL019C            NLNDSQGDRQWMASYTSYPRQNMVNSDDPDNASESHSRIPSPSLPGSLEGTSSQVDVTVS
Ecym_3048          KLQEFQSDKEWEAVFTS--------RPNPIINKQQVQMQSDAQPYLGLQDHRQRQQLQQQ
KLLA0C05874g       KILTE--------------------SGKEIEGSLILRNNIDTTK----------GSV---
KNAG0E02740        RFRDLND------------------PSKSFKATVNVQRNP--------------------
CAGL0E02299g       EIEDST-------------------TGRALPARMTIKKRSHT------------NKV---
NDAI0C02770        PIEFEKDNNSNNNNNNNN-------NNDTIIANLLIEDKIQNDSHS--------PVI---
NCAS0D02010        ELRDD--------------------KESSETVQLIRETKTENV-----------------
KAFR0A05240        NVRNASS------------------NNRSIPMKLLIERMEETAE----------GQI---
SAKL0E01958g       KLVDS--------------------DNNEITANLLTKTRPQFQKVTEVSGG---QRI---
KLTH0C10604g       KVRDI--------------------NGVEINAKLIIKKRPGFDVPKEQDQES--QRV---
Kwal_56.22522      KVTDT--------------------SGAEIKATLVCKDRHEFEAIETDAQGP--RKV---
TPHA0F02480        ELTDLKN------------------PDQTILTKLIIKEKPILKDSKNI------KQV---
Kpol_1035.50       DISDAHD------------------PAKVYPAKLSVEEKVSSRTLNSDGGM---LQV---
TBLA0B00560        NLAND--------------------DGRILKSRLLINSTTDTT-----------------
YOL013C            LITNSDE------------------KENGIPVKLTIENHEVNSLHGDGGEQIA-KKI---
Suva_15.159        LISSSNE------------------KDNSIPVKLTVESHELNSEQGREEEQGAQKRI---
Skud_15.148        LMTNSNE------------------KEDRIPVKLTVESHEVNSLQGGEEVQGTQKRI---
Smik_15.157        LMTSSDE------------------KESSIPVKLTIESHEIDYLQGDGEGQTAQKKI---
ZYRO0C07194g       SLRDSV-------------------SGNPVRAKLTLNNDNET------------QRI---
TDEL0G04250        SMKNSA-------------------TNETVPASLLIERTNASERYDDDDDQV--ETI---
                    .                                                          

ACL019C            AKDAPA------------------------------------------------------
Ecym_3048          ESQEHSAEQGKEEKHEKQQQVQQQQVQQQQVQQQQVQQQQVQQQQVQQQGLRFFNSFRNG
KLLA0C05874g       ------------------------------------------------------------
KNAG0E02740        ------------------------------------------------------------
CAGL0E02299g       ------------------------------------------------------------
NDAI0C02770        ------------------------------------------------------------
NCAS0D02010        ------------------------------------------------------------
KAFR0A05240        ------------------------------------------------------------
SAKL0E01958g       ------------------------------------------------------------
KLTH0C10604g       ------------------------------------------------------------
Kwal_56.22522      ------------------------------------------------------------
TPHA0F02480        ------------------------------------------------------------
Kpol_1035.50       ------------------------------------------------------------
TBLA0B00560        ------------------------------------------------------------
YOL013C            ------------------------------------------------------------
Suva_15.159        ------------------------------------------------------------
Skud_15.148        ------------------------------------------------------------
Smik_15.157        ------------------------------------------------------------
ZYRO0C07194g       ------------------------------------------------------------
TDEL0G04250        ------------------------------------------------------------
                                                                               

ACL019C            -------NACFVIATSKLEQT---KEVEHLKRKVEELESRVEELSKRIKTDQV---
Ecym_3048          LDTRHTIDSLPVIPTSRLEQT---EELERLKRRISELENTVGDLLKRIKTD-----
KLLA0C05874g       -----------VLPQDLLID----QDASQLKRKIADLESKLEELSKKVKRE-----
KNAG0E02740        -----------YLHEAAFTSS-----------------------------------
CAGL0E02299g       -----------SVPSESIIAS---HPEQDNNEKMHNM-------------------
NDAI0C02770        -----------IIPKESINYP---DTN-----------------------------
NCAS0D02010        -----------IIPDDHIHT------------------------------------
KAFR0A05240        -----------VIPDSAFSRE-----------------------------------
SAKL0E01958g       -----------TIPQSCIEQK---EEIESLKRKISEMENKLDALTKRVRTE-----
KLTH0C10604g       -----------VINDPPATQY---QDIERLKRRISELENKVDELTKKARTE-----
Kwal_56.22522      -----------VVKNDCVYQN---QDIERLKRRISELENKVDELSKKARTE-----
TPHA0F02480        -----------VIKDEDIWMATEPKTIKSLNDKINELERKLKDISSKIDEKETVEQ
Kpol_1035.50       -----------VIKDKDIKTVTDSKTIDLLKKRITELEEKVDSLAANVQNVE----
TBLA0B00560        -----------QNSDDILGLK---QKINQLQDQINQLNKNMKPIDEKENILLSHTE
YOL013C            -----------VIPDKFIQHI-----------------------------------
Suva_15.159        -----------VIPDQFIQHI-----------------------------------
Skud_15.148        -----------VIPDKFIQHI-----------------------------------
Smik_15.157        -----------VIPSKFIQHT-----------------------------------
ZYRO0C07194g       -----------TIPNECIHHL---ESIQGLKRRISELEAQVREMSEH---------
TDEL0G04250        -----------IIPDEVVDQA---QTIENLKRRVSELESQVEHLNKRVRKD-----
                                                                           

FASTA FORMAT for MUSCLE Version 3.6

>ACL019C
----------------MPREVSWPMWAMFITATYALAGWSAYSCATSFDDPLSALFMASS
GVHFVIWGNFLIVHYCLFVWAIIRVLFGQLTAIEYDHIFERLHVVLVTLASIVITMRKTY
M--AGHMTILFYTLCLVAHWVLRDRMDFVF-QVHGTDSSLLGILC-SRFMFSLLVLGMVD
YKMLKFC-------------VQNTNVDGKRH----------------------ELYLMLA
LSFAQLILDVLHVVLLTSLNLFEMVRSRRT-------RSANLVYEGG-------------
----TTDDDADDEVFI-LEGKYIYETVFDLTITVLKVILDIIQEVFVPWS---ITVVYSI
FVRSIKAGESFLLVYNYWKNNKKLYEKLSDVSEEQLDDT---DSMCIICMDDML------
--------------------PTTETTKM-------------------NRRAKMLPCGHML
HFGCLKSWMERSQTCPICRLSVF----------ANDSNSHAT------TQAREQTPPDLL
QERGIDEHIDVIGMQDMSVQSISLHEGTAVRRGTTGNCMN--------------------
-QAYDGGLLSHEERD-----------------QAGWVAFPIEFR--ADNKV-------FF
NLNDSQGDRQWMASYTSYPRQNMVNSDDPDNASESHSRIPSPSLPGSLEGTSSQVDVTVS
AKDAPA------------------------------------------------------
-------NACFVIATSKLEQT---KEVEHLKRKVEELESRVEELSKRIKTDQV---
>Ecym_3048
----------------MPREVSWSIRLQFIAVTYALAAWSLYNCTSTSLSFLQAMYKATY
GVHLIIWGNFLLVHYFIGGWLVVRMLFGRLTLLEYEHIFERLHLTVLSSLSVLITMDRKN
S-KIGVIAIPFHVLCQVLHWVVRDRMEFVFAPPIGTRMAMKDLLF-SRFMLSIVVLGVVD
FKLMMYF-------------YRQHQAEQGYL-------YYLLFSDNGQNTSEDRLSLSLG
VDFGLLFLDWLQVVLLNCLKFVELFKAGRR-------VQEHQLLDNNE------------
----LENDIEDDGAFI-LEEKFIYEKIVETVLEILKILLNIF--LITSGIHS-FVVFYNI
FIKSIETCERCVLLFNYWKNNRRLHEKLLDVTAGHLDGV---DITCTICMDDML------
--------------------PSKDVKVN-------------------NKKAKMLPCGHML
HFGCLKSWMQRAQTCPICRFPVFGSSNPRAGQNANSNGIVPTQSEQQQQLQQQQQQQQQQ
QQQQQQQQQQQRRSSWHSENEIPHDPAHPVRNSEQSGFSAT-------------------
-NNNDGDDPNNQLRPVNNSNQQKN--------EPSWISFPTQYQ--ANGKL-------YF
KLQEFQSDKEWEAVFTS--------RPNPIINKQQVQMQSDAQPYLGLQDHRQRQQLQQQ
ESQEHSAEQGKEEKHEKQQQVQQQQVQQQQVQQQQVQQQQVQQQQVQQQGLRFFNSFRNG
LDTRHTIDSLPVIPTSRLEQT---EELERLKRRISELENTVGDLLKRIKTD-----
>KLLA0C05874g
MFGLFNRNPEAGAPGQPQNVFLTQKFIAYSLMSYTAAAWSLHYCVTTSFSYLHAMTKITE
GIHAMIWGNLFLLNSVLILKGVIHMLFGQLRLIEYEHILERISYTVITLLLSCSSMNGLI
S--VMQIHCVLFVCCRTLHWILKDRMEVTF-QANDMRLTLKDILL-SRFMFNLLVLTAVD
GIIVAYY-------VNKI--LYKSNIDVTYT-------------------------LFII
SQYAILGTDLLQVILRTGLNLFELSTIQNRARIR---RNADHHVDEPVINHEERPNAVA-
----IEEDEDEDEENAGLEGKFIYEKLIDVFISTVKVIIKFA----SSFSTG-RVMMVTV
LWEAITTFKSARGLWKNWKSSKSLDASLMDATDIQIESG--EIDICIVCMEDFL------
--------------------PSHQRKSD-------------------GKKVKILPCTHAL
HLSCLKNWIARSPTCPICRLPIF----------DENGNVMPY------------QDHSQS
TDPNTTAQEISPGIAVETNSQTNINTLETTNQNITLSPD---------------------
-NSTAQNLAFLPT-------------------RNTSLIIPIQRE--DEHKH-------KF
KILTE--------------------SGKEIEGSLILRNNIDTTK----------GSV---
------------------------------------------------------------
-----------VLPQDLLID----QDASQLKRKIADLESKLEELSKKVKRE-----
>KNAG0E02740
-------------MLVLNLRSRKQQFALLVVVIYLLTAFTVINAFGNSHTFLEWTTGLTQ
GVNYVIIAAFSLLNIVLLWKGFTYMVFGDLRLIEEEHIFERIPLTVINLIMISSLLSDKY
M-FDIVLLGGLLLVLKVSHWILRDRLEGFL-QRINDTTTLTSLLF-SKFSRNLLIFGILD
YFVTKIC-------------FFNHFGNFYHH-----------------GDFSNITQIMFG
LEYAVVFIDLINILCHTVLNFYAFHRTQLQSAR----FNLEMMNDDFS------------
----EDENDSGVNADGGLEGKFIYEKLIDFVAGVLRTGLHFT--MLIPLRFQ-SMLVKDF
VWDLFNLVNNGNSLWKIYKNNRQLNKKLPNIAIEDLLDH---DNMCIVCMDDLVLVHHPT
KRRQSVQEECDDEKNTEKDKPSTTEEDL----SEVEPTQGDIDRMADSKKPKKLPCGHML
HFSCLKNWMERSQTCPICRVPVF----------DKDGNVRPS---IAKTRRSPPMSSSRS
ANRSRASPAPIPTPTLTPTPTQTQAQTQPQTTPTSTAPT---------------------
-LPVQVSLMDIPNR------------------TKSRFAIEKDTADDQERNI-------TI
RFRDLND------------------PSKSFKATVNVQRNP--------------------
------------------------------------------------------------
-----------YLHEAAFTSS-----------------------------------
>CAGL0E02299g
----------------MLTAIHKREFLIFTAITYVLTIYCVISACQSSVSFLQIALKLSE
GFNILIITVFTLLNSTLLWQFLTSMLFGELRIIEHEHIFERLPFAVINTIFMFSTFNEKY
F-FTLATCALVLLYMKVFHWILRDRLDLLL-QGINEDTRWKDLLV-NRYICNLLLLVVID
SYVISFC-------VSTAYNIASSIFTAGTN--------SIVLGGGSPLTQRALIYIMQA
MEFTNLMIDLVNLILNTGLQFYEFHLSRKF-------SQNNPTFNSISAEDA--------
----DTESEDGDSQFNGLEGKFMYEKLIDVVTRFLQTLVHVV--MAMVLNLP-LMLVKDI
FVDVWVLYMNSKSLLAIWKNSKQLDTKLPTMTSDDLNNDPNFDNVCIVCMDELV------
--------------------SENPHHHQ-----------------SDGKKPKKLPCGHVL
HLSCLKNWMERSQTCPICRLPVF----------DENGEILAP--------SSANVSQTNL
NPGENPDQRDEADDELEDDTSIADLPITDNISAIPLTSDY--------------------
-PFSIRNVGQEVCKELGG--------------TSEEMTHDV-----DEEIL-------EF
EIEDST-------------------TGRALPARMTIKKRSHT------------NKV---
------------------------------------------------------------
-----------SVPSESIIAS---HPEQDNNEKMHNM-------------------
>NDAI0C02770
-----------MAIQISMLNSKKFQFVIFSISVYLITFFTIINAANSSTSFLHLCLKLNE
GFNIMIITIFILLNSLLSWKLITWFLFNDLRLIEQEHIMERLPFTVINFIVMATMFNERF
F-FTLTIYGLLLISLRVYHWILKDRLEFII-QTINDSTSMTKIIF-SKFSFNLISLSLIN
LKLIQNC--LTWDDI-NF--WKNNQNLFNSIMNYLINPISSTTISNGINNHSNPVYLMLG
MEFSILLLEYFNVLFHSLLSLFEFYKSKQFSIQQQQIRQNNLINRAQTTQNDENEINIGL
DIDIDDDEEDDDETFNGLEGKFIYEKIIDLFTRFLMTIIHVS--LLLPLNIP-MILVKDI
LWDFFSLYRNAMSLYKIWKNNQKLESALPNMTPDDLQHS---DNVCIICMDDLL------
--------------------PSLETLEHATNVSSTTPSSNHYLNIKKKKKPKKLPCGHFL
HFSCLKNWMERSQTCPICRLDVF----------DKNGNVKVY----PNTNTNTNVNDSSH
DQTSENRPPSTSTSNIIPGSNTNITTNTPIPRNIDASNGSHEVS----------------
-PAASPSPSPSPSLPILKHEQHDGNPINNFNETKNWYEFKIDS---DKSTYANNSQTISF
PIEFEKDNNSNNNNNNNN-------NNDTIIANLLIEDKIQNDSHS--------PVI---
------------------------------------------------------------
-----------IIPKESINYP---DTN-----------------------------
>NCAS0D02010
-----------------MLQTRRSQLIAFTAIIYVLTISCIINSAIKSTSFLHLSLKLNQ
GFNVMIITIFILLNALLLWKFLNFLLFKELRLIEQEHIMERLPFTIINFIFISTMFNEKF
F-ITMAFYGFILLYMKIFYWILKDRLEFLI-QS-NTNYSVSRFIF-SKFYLNLIILSTIN
LQLIKTCIPLNYEFLKKL--YLNSTSILQSLINY---SSPSSTHASNFNLGVNPIYLMLA
MEFAILLINFINLFLHSILSLYEIYKSNQY-------DQLNAIIEDIEDE----------
----NDDDDDTPADFNGLENKFIYEKIIDLFTRSLMTMIHIS--LALPLNLP-MIVLKDI
IWDLISLYQNCKILFQILKNNKNLDSKLPDMIPEDLQDS---DNVCIVCMDDLL------
-----------------------SEEHK-------------------KKKAKRLPCGHFL
HLSCLKNWMERSQTCPICRLPVF----------DESGNVKES------------------
-----ERPATAADADVDVDVAAAQPPSTSSSPSIPHSPI---------------------
-QETLEPEEASID-------------------NNTWYSFPITHINKDKSVI-------SF
ELRDD--------------------KESSETVQLIRETKTENV-----------------
------------------------------------------------------------
-----------IIPDDHIHT------------------------------------
>KAFR0A05240
----------------MIVQSRKQQLVIFSMIIYLLTIITIFTSYKSSKTFLQCTIKLTQ
GINVLILAIFTALNLFLLWEFLRWILFGELRLIEHEHIFERLPFTIINVLFMISIFNEYQ
F-FNALVFALILSVLKVFHWILKDRLESLL-QSINDATDLKNLIF-SRYMLNLAIFSVLD
FWICSNT-------YRAFRGYDNNNSTNNNQNAD---SSNLMNKNNLTPTNKKALFLLFG
MEFFVLFLDLINLAMHTVLNFYEFYCSQRATAH----HNVNAGTDEESEE----------
----EADGDDDDANFNGLEGKFMYEKLIDVSTKFFKTIVHIF--VLIQTKLQ-IMVLKDV
VWDCLTLYQDSISLWKIYKNNKQLDDKLPTLSVNDVEND--NDNICIVCMDDLV------
--------------------PSLHGKEA------VEMTQADIDSISKSKRPKKLPCGHML
HLSCLKNWMERSQTCPICRLPVF----------DENGNVKPF----LHTTTNNNMQPNND
ADVTSTTATNSRTDTSTPMTDVPTPTRTSASALTTSSIIT--------------------
-QDFKNGITPID--------------------SVEWYAFEIDSISDARNEV-------KF
NVRNASS------------------NNRSIPMKLLIERMEETAE----------GQI---
------------------------------------------------------------
-----------VIPDSAFSRE-----------------------------------
>SAKL0E01958g
---------------MPVSQNRRGQFIVYSVFTYSAAIWSVYDSLSSSVTFLQTTIKLCE
GVNLIILGNFCLLNGVLLWKLLTRLLFGELRLIEYEHVFERLSFTIVNSIFVSSMFKEQD
F-LTVLVFTAVLIFLKVFHWILKDRLEFVF-QNANENTNLKKMLF-SRFNFNLLFLASVD
YQMVRYC-------LSNS--ISNDQW--TSS----------------------SVYLMFG
IDFAMLLVDTLSIGLHGVVNFVEVYRLQSH------------------------------
-------NSHYDEEFLGLEGKFMYEKLIDMGARLLKMLLHIA--LLIPFRMP-IMIIKDI
IWDAISLYQTATSLWKTWKNAKKLDEKLPDVTEEELNQG---NNMCIVCMDDML------
--------------------PNSETRNA-------------------NLKPKKLPCGHIL
HLSCLKSWMERSQTCPICRLPVF----------DERGNVTRM------------DSSSQE
QQLPHNLQRQEAEGEVVQMTTSPFHTTSASVGPTSTTPT---------------------
-QANRSVIMPQVPRV-----------------PQDWYAFPIEATQTTKDKV-------VF
KLVDS--------------------DNNEITANLLTKTRPQFQKVTEVSGG---QRI---
------------------------------------------------------------
-----------TIPQSCIEQK---EEIESLKRKISEMENKLDALTKRVRTE-----
>KLTH0C10604g
----------------MALRVQRRQFVGYTVFTYTAAAWSVLDCLQPSLSFLDACLKLCE
GLNLVVLCNFAIVNSILLWKGLTRLLFGELRLLEYEHIFERLSFTIVNCFFMSSAFPEYQ
F-LTVMILFALLTFIRVFHWVLKDRLEYVF-QHTDERTNIARLLC-SRFFLNVIIFAVVD
YQMVRFC-------LRNS--LTNKHDPSPSA----------------------PVYILFC
VDFSMLLVDVAEVAMKSVINLIELIQCKRA------------------------------
-------FERDGDDFVGLDGKFMYEKLVQLVCQVLKLGLRVA--SLAPFSMP-LMIAKDI
IWDGIALFHTGKSVWRTWKSNRQIDEKLPDVTEAQLNAS--EDKMCIVCMEDML------
--------------------PPSEATSA-------------------KHKPKKLPCNHCL
HLGCLKSWMERSQTCPICRVSVF----------DSKGNVALP---------NQNAAQQPI
SEDASVAQQPLSAANESNSTSLASTHTGSLGAVSSSNPN---------------------
--------------------------------FPTWYTFPVTLSD-NDGAV-------DF
KVRDI--------------------NGVEINAKLIIKKRPGFDVPKEQDQES--QRV---
------------------------------------------------------------
-----------VINDPPATQY---QDIERLKRRISELENKVDELTKKARTE-----
>Kwal_56.22522
----------------MAVRVQRRQFAAYVFASYAAAAWAIIGTVQESLSFLELSARLCE
GLNLILLCNFAAVNGVLLWKALTHLLFGELRLLEYEHIFERLSFTIVNCFFMSSAFSESE
F-MSVMAFSAALIFVKVFHWVLRDRLEHVF-QHTDEHTNFARLLL-SRFFFNIFLLGFLD
FQMTKFC-------IQGTRFFSRSGFYSSSL----------------------SVHLMFA
VEFAMLLVDVTEVAMKSIINLVEVYQCKRS------------------------------
-------FARDGEDYTGLEGKFMYEKVVQLICQLTRMGLHIM--LMMPFSMP-LMIAKDI
LWDAFAVFHTAKSLLLTWKSNRQIDEKLPDVSEAQLAAS--DDKMCIVCMDDML------
--------------------APSECTNA-------------------KQKPKRLPCNHCL
HLGCLKSWMERSQTCPICRVPVF----------DKKGNVVVT------------------
--------SDQTNNQPGTSSAVESTADETSTAATTSVSS---------------------
-QSSSIAVTDVPSH------------------QRGWYAFPTVQVH-DEGSI-------DI
KVTDT--------------------SGAEIKATLVCKDRHEFEAIETDAQGP--RKV---
------------------------------------------------------------
-----------VVKNDCVYQN---QDIERLKRRISELENKVDELSKKARTE-----
>TPHA0F02480
--------------MSSLSVTRKYQLALITFVIYTSTIFVTYLAIQSSSSYLQVTIKLTK
GLNVIILVLFGLLNVAFIWKGLMYLLFSSLRLIEYEHILERLPFTIINFCLLSSMFNERD
IIMSISSYGMILIFMKVAHWVLKDRLESLL-QSMNDNSSIRSLIFSNRFFLNLGLFAVID
YQMMMQC-------VTNS--IKNSMG--AST----------------------SIHLLLG
VEFTMLLVDLVNLFLHTCLNLYEFHKSIED-------RNLNIVGED--------------
----EDGLVDDEEEFNELEGKFMYEKAIDIFTRFLKTLLHLL--MFIPFRMK-IVLLKDV
IWDVITLYQSTVSLWKTWRNSKQLDEKLPTVSLEELKSS--DNDMCIVCMDSLI------
----------------NIDFNSTEETEN-----KEKEEQIYNAAIHSKQKPKKLPCCHIL
HLGCLKNWMERSQTCPICRLSVF----------DSNGNILPFNNTRSDTMRNTELTATNS
NDAADESTENDTEMDALLSSQVQESVGDTLARDINFRSSIGDADVEGENNDNYDLDNELE
IPNSDNPSQLLNSESQNAECEFN---------NVKWKSFLIKSV--NKESI-------SF
ELTDLKN------------------PDQTILTKLIIKEKPILKDSKNI------KQV---
------------------------------------------------------------
-----------VIKDEDIWMATEPKTIKSLNDKINELERKLKDISSKIDEKETVEQ
>Kpol_1035.50
-------------MLQRLNIPRSYQLLLLSLVVYSATFLSIYFAVLSSTSYLQVTIKLSQ
GFNAIVLVLFAILNGTYVWRFFIWLAFGNLRLIEYEHVMERLPFTILNMVITYSMFNDKS
IAFTGSIFGFFLIFMKVLHWILRDRLDAIV-QSFNDSSTLTSIILSNNFFLNLIIFTIVD
YKMVSYC-------VSNS--LSNSMG--AST----------------------TVHLLLG
MEFTMLLIDLLNLFLHTCLNLYEFHLTTLE-------RSSNIIQEDG-------------
----EDDEEDDELQFNSLEGKFMYEKTIDVFTRFLKTFIHIL--MLIPLRMKFFLLLKDV
IWNVISLYKHTGSLWKTWKNNKQLDDKLPTASIEELKNT--DNNICIVCMDDLL------
--------------------PRINSEKY----DSQREKELYDHIMKSKQKPKKLPCGHIL
HLNCLKNWMERSQTCPICRLPVF----------DDKGNVMPSTHSQNQTETQQQQPQTQT
QSTTELQPQTEVQPDLNQRQETNIQHNVQNVIETPGRDSAQDASRGGTG-----------
-SNSDHNLTNTQVSSEGSSNEQQGNVTNSILNTSSWYSFPIKTS--SDSSI-------TF
DISDAHD------------------PAKVYPAKLSVEEKVSSRTLNSDGGM---LQV---
------------------------------------------------------------
-----------VIKDKDIKTVTDSKTIDLLKKRITELEEKVDSLAANVQNVE----
>TBLA0B00560
---------------MPFYQSRTAQFVLFTLFIYVLTFASVYFAISSSISFLQVTIKLTQ
GFNIIIISIFSIINSIILWKFSNYLLFGELRLIEYEHVLERLPFTVINMVFMSSMFNEHD
I-FTTIILSLLLLYMKVSNWILRDRLESLL-QTVNDSTTIFNLIFSTQFFFNLILFSLID
YLMMNFC-------ISNS--LLSNSNIGSSA----------------------SVYLLMG
MEFTMLLVDLFNILCHSILNIYEFYKSSLVS------LDTHLT-----------------
----SEDEEDDESGFNGLEGKFIYEKIIDTFTRFLKTIIHIL--LLIPFAMP-VMLSKDV
VIDLVTLSQNINTIWKIWVNNRKLDDQLPTVTQHQLDSM--EDKICIICMDDLS------
--------------------INSIQKNF------------------EKRKPKMLPCGHIL
HMNCLKNWMERSQTCPMCRLPVF----------NEKGEVLPT------------------
--------RRERATTPEPSTSTSSDSEE--------------------------------
--------------------------------NEEWVSFPIETI--DDSTI-------TF
NLAND--------------------DGRILKSRLLINSTTDTT-----------------
------------------------------------------------------------
-----------QNSDDILGLK---QKINQLQDQINQLNKNMKPIDEKENILLSHTE
>YOL013C
----------------MVPENRRKQLAIFVVVTYLLTFYCVYSATKTSVSFLQVTLKLNE
GFNLMVLSIFILLNSTLLWQLLTKLLFGELRLIEHEHIFERLPFTIINTLFMSSLFHERY
F-FTVAFFGLLLLYLKVFHWILKDRLEALL-QSINDSTTMKTLIF-SRFSFNLVLLAVVD
YQIITRC-------ISSI--YTNQKSDIEST----------------------SLYLIQV
MEFTMLLIDLLNLFLQTCLNFWEFYRSQQSLSN----ENNHIVHGDPTDENTVESDQSQP
VLNDDDDDDDDDRQFTGLEGKFMYEKAIDVFTRFLKTALHLS--MLIPFRMP-MMLLKDV
VWDILALYQSGTSLWKIWRNNKQLDDTLVTVTVEQLQNSANDDNICIICMDELI------
--------------------HSPNQQTW----------------KNKNKKPKRLPCGHIL
HLSCLKNWMERSQTCPICRLPVF----------DEKGNVVQT---------TFTSNSDIT
TQTTVTDSTGIATDQQGFANEVDLLPTRTTSPDIRIVPT---------------------
-QNIDTLAMRTRSTSTP---------------SPTWYTFPLHKT--GDNSVGSSRSAYEF
LITNSDE------------------KENGIPVKLTIENHEVNSLHGDGGEQIA-KKI---
------------------------------------------------------------
-----------VIPDKFIQHI-----------------------------------
>Suva_15.159
----------------MVPENRRKQLVAFIVVTYLLTFYCVYSATKTSVSFLQVTLKLNE
GFNLMVLSIFILLNSTLLWQLLTKLLFGELRLIEHEHIFERLPFTIINTLFMSSMFHERY
F-FTVAFFGLLLLYLKVFHWIIKDRLEALL-QSINDSTTLKTLIF-SRFSFNLALLALTD
YQIITRC-------ISSI--YTNKNIDVVST----------------------SLYLMQV
MEFTMLLIDLLNLFLQTSLNFWEFYCSQQSQSN----ENNHIVQDEVEDENEVDSGEPHA
EL--DDDDDDDDRQFTGLEGKFMYEKAIDVFTRFLKTALHLS--MLIPFRMP-MMLLKDV
VWDVLALYQSATTLWKIWRNNKQLDDTLITVTIEQMQNSANEDNICIICMDELI------
--------------------HSANQQAW----------------KNKNKKPKRLPCGHIL
HLSCLKNWMERSQTCPICRLPVF----------DEKGNVVQT-----PFTSNSTTTRNNT
STTDTTRTATTATNQYISTNDTELIPTRTIPHDAGIASS---------------------
-QNMNMSASMSAS-------------------SNTWYTFPLQQT--GNTSGESKCSTYEF
LISSSNE------------------KDNSIPVKLTVESHELNSEQGREEEQGAQKRI---
------------------------------------------------------------
-----------VIPDQFIQHI-----------------------------------
>Skud_15.148
----------------MVPENRRKQLIVFIVVTYLLTFYCVYSATKTSVSFLQVTLKLNE
GFNLMVLSIFILLNSTLLWQLLTKLLFGELRLIEHEHIFERLPFTIINTLFMSSMFHERY
F-FTVAFFGLLLLYLKVFHWILKDRLEALL-QSINDSTTMKNLIL-SRFSFNLVLLAVVD
FQILIRC-------ISSI--YTNQNIDIIST----------------------SLYLMQV
MEFTMLLIDLLNLFLQTCLNFWEFYRSQQSQSN----ESNHIVHDDTPNGVGFEEAHAV-
----LNDDDDDDRQFTGLEGKFMYEKAIDVFTRFLKTALHLS--MLIPFRMP-LMLLKDV
VWDVLALYQSGTSLWKIWRNNKQLDDALITVTAEQLQNSANEDNICIICMDELM------
--------------------HSQADQTW----------------KNKNKKPKRLPCGHIL
HLSCLKNWMERSQTCPICRLSVF----------DEKGNVVQS--------TFTSNTGTTS
TNTTVTGATSATINRQVFTNQTELLPTRTTSPDVGIIPN---------------------
-HNINTLASRSTSTSTS---------------STMWYTFPLQQT--DDDSNESKCSTYEF
LMTNSNE------------------KEDRIPVKLTVESHEVNSLQGGEEVQGTQKRI---
------------------------------------------------------------
-----------VIPDKFIQHI-----------------------------------
>Smik_15.157
----------------MVPENRRKQLVVFIVITYLLTFYCVYSATKTSVSFLQVTLKLNE
GFNLMVLSIFVLLNSTLLWHLLTRLLFGELRLIEHEHIFERLPFTIINTLFMSSMFHERY
F-FTVAFFGLLLLYLKVFHWILKDRLEALL-QSINDSTTMKTLIF-SRFSLNLVLLAALD
YQIIVHC-------ISSI--YTNQKIDIVST----------------------SLYLMQV
MEFTMLLIDLLNLFLQTCLNFWEFYRSQQSQSD----DGNHIVHDDLSDGNRVDFDGSQH
ALN-DDGDDDDDRQFTGLEGKFMYEKAIDVFTRFLKTALHLS--MLIPFRMP-MMLLKDV
IWDILALYQSATGLWKIWRNNKQLDDSLLTVTVEQLQNSANEDNICIICMDELI------
--------------------HSTNQQTW----------------KNKNKKPKRLPCGHIL
HLSCLKNWMERSQTCPICRLPVF----------DDKGNVVQT---------TFTSETNSS
ITMAATDNTRTIVNSQDFANETELLPTRTTSPDVRILPN---------------------
-QNTNTFASRATSTSTS---------------STTWCKFPLQQT--EDNDV-ESRSTYEF
LMTSSDE------------------KESSIPVKLTIESHEIDYLQGDGEGQTAQKKI---
------------------------------------------------------------
-----------VIPSKFIQHT-----------------------------------
>ZYRO0C07194g
---------------MATSDTRRRQVACFALSVYALTIYAVYNSARTSVSFLQATIKLTT
GFNVVILTVFTILNSAVLWKLSTAILFGNLSLLEYEHIFERLPFTIINTVFMSSMFHEQD
F-FTVTLFGLLLLYMKVFHWILKDRLEALL-QSIHESTTLKSLIC-TRFSFNLVLLAILD
YKIVSGC-------ITNS--LSNSFG--AST----------------------SVHLMVG
MEFAMLLIDLLNLAMHTVLNFYEFYRTQVDAHL----SSVDTDTDGGDEE----------
----NEDEDVNGSSFAGLEGKFMYERVIDVFTRFLKTLIHAI--MLIPFRMS-ILLIKDV
FWDVLTLCQIVSSLWRIWQNNKQLDDKLKTMSPVELSAT---DNICIVCMDELC------
--------------------ADLEEVVQ--------GPDREKVAKTGKYKPKRLPCGHVL
HLFCLKNWMERSQTCPICRLPVF----------DENGNVVQSQSSTTNRTTQATNQSTNV
TTTAATTTTTTTTTTTTSTTEMDSSGGSTASTPSSRQST---------------------
-QQTLGDLTPTPTTADSNSNI-----------ANLWYSYPIQEA--KDGVV-------TF
SLRDSV-------------------SGNPVRAKLTLNNDNET------------QRI---
------------------------------------------------------------
-----------TIPNECIHHL---ESIQGLKRRISELEAQVREMSEH---------
>TDEL0G04250
---------------MAISETRKRQFIVFSIFVYALTIYSVYNATRTSISFLQTVLRLTE
GFNIVIITVFFTLNSVLLWKLSTSLLFGSLRLIEYEHIFERLPFTIINTMLMSSMFSEHD
F-LTVAIYGLLLLFMKVFHWILRDRLEALL-QTIQESTTLSDLIF-TRFTFNLVLLAIAD
YQIISHC-------VSNS--LDNSFG--ASA----------------------SVHLMMG
MEFALLLIDLLNTTLHAALCFYEFYQSQTHG------RRN--------------------
----AVNDDEDDTQFSGLEGKFIYERVIDISTRFLKTVLHAL--LLVPFRMP-IMLIKDV
LWDCLTLHQNAKGLWKIWRNNKQLDDKLPTMSEDQLRNI---DNMCIICMDELI------
--------------------PEQDEGHT-----------RNT-----KNKPKRLPCGHVL
HLYCLKNWMERSQTCPICRLAVF----------DEMGNVVQS------------------
--------TVPTTAEVTPTDEINVPETVVERSQEQIQDN---------------------
-QQQMGEGQVAV--------------------LDSWYSFPVEET--SENLV-------TF
SMKNSA-------------------TNETVPASLLIERTNASERYDDDDDQV--ETI---
------------------------------------------------------------
-----------IIPDEVVDQA---QTIENLKRRVSELESQVEHLNKRVRKD-----