MUSCLE (3.8) multiple sequence alignment

KLLA0C03894g       MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPILTLGSTTFQHVIRE
KAFR0C01020        MISAILIYTPRGELIVSKLYRNNIKRSISEIFRIQVINNFNVRSPILTLGSTTFHHIRST
TBLA0F00840        MINAVMIFTPRGELLVFKVFKSSVKRTISDIFRVQVINNDNIRSPILTLGSTTFHFIRTT
ADR315W            MIDAFFVFAPRGSLIVSKLISGEAKESLSEVFRLQVINGLEIRSPVLTLGSTTFQHIRTS
KNAG0K01150        MINAVLVYSARGELIVSKMFKPTLKRSVGDIFRVQVINSLDVRSPILTLGSTTFHYVRTP
TPHA0P00660        MINGVLIYSSRGDLIVCDLLKSSLKRTISDIFKIQVINSLEMKSPILTLGSTTFHHIRSS
Ecym_5239          MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVINNLDVRSPILTLGSTTFHHIRSN
SAKL0C07414g       MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVINNLDVRSPVLTLGSTTFHHIRSS
KLTH0F06534g       MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHVKSP
Kwal_33.14182      MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHIKSA
CAGL0C05203g       MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVINNLDVRSPILTLGSTTFQHIRSN
NDAI0G02920        MINGILIYSPRGELIVSKLFKGTLKRSIADIFRIQVINNLDVRSPILTLGSTTFHHIRSS
NCAS0C03580        MINALLIFTARGELVVSKLFKGSMKRSIADIFRIQVINNLDVRSPILTLGSTTFHHIKST
Suva_15.103        MISGVLVYSSRGELILNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSM
Skud_15.91         MISGVLVYSSRGELILNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSK
Smik_15.96         MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSR
YOL062C            MISGVLVYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSR
Kpol_1045.44       MINGVLVYTGKGELIVSKFSKSNAKRSISDIFRVQVINNLDVRSPILTLGSTTFHHIRSN
ZYRO0B04840g       MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSN
TDEL0D04580        MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSD
                   *:...:::  .*.*:: .         :.::*. ****.  :.**:********:.:   

KLLA0C03894g       S----SDNLPMWLVAVSRSNVDSSMIWEYLHKLYQLMEAFGINDEDVLKDEFMLLYEILE
KAFR0C01020        ANDPTDDEL--WLVCVNRNNANSAAIWEFLQKLNLILQQYGITSESKLKDEFMTVHEILD
TBLA0F00840        A----GSKL--WLVAVTRSNADSGAIWEYLYKLNSLMEVYGLTHEDILKDEFIVCHELLD
ADR315W            G------GL--WMVVVVRGNADSAAIWEFLYHMNKLLDAYAINTEEALLDDFMLCYELLD
KNAG0K01150        G-----EGL--WVVSVSRNNENSAATWEFLYKFATMLAAYRLDSEEVLKEEFMLAWELLD
TPHA0P00660        S----ESKL--WIVAITRSNANSGVIWEFLYKLDSMLTAYDLNNEEKLMEKFMVYYEMID
Ecym_5239          G------GL--WLVTVSRGNTDSAGIWEFLYNFNKLLEVYDINSEDSLQGDFMLCYEILD
SAKL0C07414g       S------NL--WIVAVTRSNADSAAIWEFLYKFNALLEAYGLNSEESLKEEFMTCYELLD
KLTH0F06534g       G------NL--WIVAVSRSNADSAAIWEFLYKLSALLEAFGLHSENELKEDFMTCYELLD
Kwal_33.14182      K------NL--WIVAVSRSNADSAAIWEFLYRLNELLEAFNLYSENELKERFMICYELLD
CAGL0C05203g       VH---GDDL--WLVSVTRSNINCGAVWEFLYKFDHMLELYGLNNEEFLKEEFMVCYELLD
NDAI0G02920        KD---SDNL--WLVAATRNNANSAAIWEFLYKLDSMLIEYGLNKEEYLKEEFMIVHELLD
NCAS0C03580        R----GDNL--WIVAVSRNNVDSAAIWEFLYKLDSLLDSYGLNHEEYLKEEFMIVHELLD
Suva_15.103        R----GDNL--WLVTITRSNANSAAIWEFLYKLDSVMNAYRLDREEALKEEFMIVHEMLD
Skud_15.91         H----GDNL--WLVTITRSNANSAAIWEFLYKLDAVMNAYRLDREEALKEEFMIVHEMLD
Smik_15.96         H----GDNL--WLVTITRSNANSAAIWEFLYKLDFVMNAYRLDREEALKEEFMIVHEMLD
YOL062C            H----GDNL--WLVTITRSNANSAAIWEFLYKLDAVMNAYRLDREEALKEEFMIVHEMLD
Kpol_1045.44       S----RDHL--WLVAVTRSNANSGAIWEFLYKFDSLLNAFGLDNETTLKEEFMTCYELLD
ZYRO0B04840g       G----SDSL--WIVTVSRTNANSGAIWEFLYKFNAILDAYDLTKEEKLKEDFMICYEILD
TDEL0D04580        G----SDSL--WLVAVSRSNANSGAIWEFLYKLNVIMDVYGLTKEGTLKENFMNCYEILD
                           *  *:*   * * :..  **:* .:  ::  : :  *  *   *:   *:::

KLLA0C03894g       LTL--ENGIPQTTDLAQIIPRVSRKPIE--NNTISKSPDLDDFLS----------GSNIL
KAFR0C01020        NML-LGTGIIQNTDLKSIVDKMSVKPIS----------RTNETTS---------------
TBLA0F00840        ITL-GMNGLPMDTELSSVIGKMTLKPAQ----VLTSSADRSDILASSVTTLGH--NSTPI
ADR315W            VVL--DSGLPQDTELSHIVPLLSRKPAT------GESASGDDFLN---------------
KNAG0K01150        TMV-EGGGIPSETDPHRIISAMSVKPAMSPVDVRADARQQQTTTS---------TGAFGH
TPHA0P00660        VML-TSNAMPINTELSSIASKISYRLPK----TISNSPTNEKNNN------------NGL
Ecym_5239          IVL--DNGIPRDTELTHIMPYISKKPLS------------ENLLG----------SDDIL
SAKL0C07414g       VVL--ENGVPVDTELSSVASKMSRRPVV----SLENNPLTDELLM-----SAAANVDLGF
KLTH0F06534g       IVL--EDGVPVDTELSSVASKMSVKPSA-------SAERINTFIE-----SGNGGTNRIL
Kwal_33.14182      IVL--EDGLPVDTELSSVASKMSVKPNA-------GVDNFNMFAE-----NGHGGTNRIL
CAGL0C05203g       VML-GENGTPMDTDPATVIKKMSVKPSK---------ETIENFAI-----SVQNKNSTLP
NDAI0G02920        VML-GSCGIPLETEPSKVIAKMSVKPAK------LHHNNTSSLLD----GHLGSKGNNEI
NCAS0C03580        VMMCGSGGIPMLTENSLVISRMSVKPSK---SILEAQNSGNGSSNTNSNNNNNNVPDLLM
Suva_15.103        IML-GGNGIPIDTELNSVIAQMSVKPIR-NVGGLLESPDSIDMLS---STSSPSSVGGEL
Skud_15.91         IML-GGNGIPIDTELNSVVARMSVKPMR-NTGGLLDGADGSDILS---SSSSPSSAGGEL
Smik_15.96         IML-GGNGIPIDTELNSVIAQMSVKPVR-NTGGLLDSPDGNDMLS---SSSSPSSVSGEL
YOL062C            IML-GGNGIPIDTELNSVIAQMSVKPVR-NMGGLLDSPDGNDVLS---SSSSPTSSAGEL
Kpol_1045.44       LML-NVDGVPLDTELSSVSAKMSTKPLH-----SINSPSDSSLDN----------SSSPL
ZYRO0B04840g       VVI-GAGGIPMDTELGSIASKISVKPPK--SGGTSSEPKSSTVAN----FPGSNLSTSNL
TDEL0D04580        TVL-EEGGIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSS--LNLSTPGDSSSTL
                     :    .    *:   :   :: .                                   

KLLA0C03894g       KAPKLSKRSSSSIA----------LSSLSECPWRPS----GLK--YKKNEVYLDINEKIT
KAFR0C01020        TQTGFLKRRNTIL-----------TTPGANFSLIPT----NRHDAHKKNEIFFFVNESMN
TBLA0F00840        SMPKFLSRNSNRSVTQEFES----QFSPSNIPWRSR----DIK--YKKNEMIVNVIEKIN
ADR315W            --SARLRRTGTKNVSVETLD----HFSRDVCPWRGE----GIK--YKKNEVYLDVIEKLS
KNAG0K01150        AFPQLLHR----------------ASNPGGISILPHATGDGAQ--LKRNEIVMVVQESIS
TPHA0P00660        SIPKFLTRNSRSM--SQEFS----NITQSDIPWRPT----GIK--YKKNEVFLYVNEKIN
Ecym_5239          NTPSWLVKAGARGMSSENLG----LTSKDMCLWRSE----GIR--YKKNEVYLDVFEHIS
SAKL0C07414g       RMPKFLNKGSRSSSSVSSPANGDEHGDPCAYPWRSS----GIK--YKKNEIFLDVNERIN
KLTH0F06534g       PVAQFLRARSSSS-NLHDSH----SKVPSNIPWRMN----GIK--YKKNEVFLNVNERIS
Kwal_33.14182      PVSQFLRGRPSAG-NLQDIA----SEAPSNIPWRMN----GIK--YKKNEVFLNVNERIS
CAGL0C05203g       KIPKFLRRTSSFLNQESSNNSSGAFNMAGELPWRPK----GIS--HKKNEIFLYVNEKIS
NDAI0G02920        SMPKFLKRNDSSQ--SHDS-----NFSFNDFSWRPK----DIK--HKKNEVILHVNEKIN
NCAS0C03580        SGPKLLRRNSASL--SQD------LSILTDFKWRPK----GIV--HKKNEVILHVNERIN
Suva_15.103        HFPKFLKKRSSSFLGQGDSHSD--FSDGNKIAWRPK----GII--HKKDEVFLYVNERMN
Skud_15.91         HFPKFLKKSSSSFLGQGDSTSD--FYDSNKITWRAT----GII--HKKDEVFLYVNERMN
Smik_15.96         HFPKFLKKSSSSFLGQGDSASD--FYDGNKITWRPK----GIT--HKKDEVFLYVNERMN
YOL062C            HFPKFLTKRSSSFLGQGDSTSD--FYDNNKITWRPK----GII--HKKDEVFLYVNERIN
Kpol_1045.44       SISKFLNRNNRSM--SVDTM----NTEPSNYPWRPN----GIK--YKKNEIFLNINEKIS
ZYRO0B04840g       SMPKFLTRNNRSM--SQDLG----TNYPSNFPWRPN----GIK--YKKNEVFLYVNEKIN
TDEL0D04580        SMPKFLTRNNRSM--SQDLG----SNYPSNLSWRPH----GIK--YKKNEVLLNVNEKIS
                     .                                     .     *.:*: . : * :.

KLLA0C03894g       ILVGKDGSIVKSFVDGSVDCVSHLSGMPLCQLGLNDTYS----IHGNEKSELSIVEMMSE
KAFR0C01020        LLVSKDGSILKNYVDGKIEIKSHLNGNPTCQFELVDDQT---------------------
TBLA0F00840        VLVGKDDNILRAYVDGTIDITAHLSGMPMCQIGMNDLST----IQGGENAHWTNEDRA--
ADR315W            LLVNRDGTILKAYVDGTVQCTAHLSGMPLCHFGFNDSQS----LRQRSPRRQ--------
KNAG0K01150        ILVSKDGSILKAYVDGGIDLTTKLEGAAVCQFGLNDSLS----TDNSSNSKWDPLRSKET
TPHA0P00660        ILVSKDQTILKAYVDGSIDLVSHLSGTPICQFGLNDYLS----MTGNNISNRGDEFRHDF
Ecym_5239          ILVNKDGAILKSYVDGSVQCVAHLSGMPVCQFGFNDYLSPSSNTQSSGNDGWAEEE----
SAKL0C07414g       ILVSKDGSILKSYVDGSVDLTTHLSGTPLCQFGLNDSLS----LDGGTLSRDLDFISEYE
KLTH0F06534g       ILVSKDGSILKSYVDGTVEATTHLSGMPVCRFGLNDSLS----VSTPFGDNESPT-----
Kwal_33.14182      ILVSKDGSILKSYVDGTVEATTHLSGMPVCRFGLNDALS----VSTPFGDDDEYQV----
CAGL0C05203g       ILVSKEGSILKSYVDGTIDLVTHLSGTPVCQFGLNDSLS----VKNDDYGDSFDYI----
NDAI0G02920        ILVAKDGSILKAYVDGSIDLQTRLSGTPVCQFGLNDSLT----LGSNDSEYSSRNGRTGN
NCAS0C03580        ILVSKDGSVLKAYVDGSIDLETHLSGTPICQFGLNDSLS----VSGVDSDMYGSHNHNHH
Suva_15.103        ILVSRDGSILKSYVDGTIDITTHLSGTPVCRFGLNDSLG----MQSEDQENWLSQQDQHS
Skud_15.91         ILVSRDGSILKSYVDGTIDIVTHLNGTPVCRFGLNDSLG----MQSEDEKNWLAQQHQHS
Smik_15.96         ILVSRDGSILKSYVDGTIDITTHLSGTPICRFGLNDSLG----MQSEDEKKWLAQQQHHS
YOL062C            ILVSRDGSILKSYVDGTIDITTHLSGTPICRFGLNDSLG----MQSEDEKKWLAQQQRHS
Kpol_1045.44       ILVSKDETILKAYVDGTVDLTSHLSGTPTCQFGLNDSLS----VDEPNYYNSDDNGF---
ZYRO0B04840g       ILVSRDGSILKAYVDGTIDMTTHLSGTPICQFGLNDSPS----VEFGDS-LWLDTQ----
TDEL0D04580        ILVSRDGSILKSYVDGTIDLTTHLSGMPICQFGLNDSLS----VEFGDDSISEVEDF---
                   :** .:  ::. :*** ::  :.*.* . *.: : *                        

KLLA0C03894g       YDI------KNKKAIPNAAAGSVILEDCKFHQCVQLNKYEANHVIQFVPPDGPFQLMQYR
KAFR0C01020        -----------------------KITDFKFDQCIEK---VQSRTVRVAATDGELEIVNYH
TBLA0F00840        ---------SNRDAMPDVSGDRVILEGSKFHQCVALDKYNKDNVIWFIPPDGQFELMKYH
ADR315W            ---------YAPRVFGTDERESVVLEDCKFHQCVQLNKFDQERVIRFVPPDGEFELMKYH
KNAG0K01150        Q--------GTNLEMKNAHVGTVLLRDCKFHQCVSLERFDRDRIIRFTPPEGTIELMKYH
TPHA0P00660        MD-------DEDLSTGRSSSSSVKIEDCTFHQCVSLDKFNDERLINFVPPDGSFELMRYH
Ecym_5239          ---------NGTKAIKNAITGSVILEDCKFHQCVQLDKFDQERVIRFVPPDGLFELMKYH
SAKL0C07414g       V--------KNKKAIPKAAAGSVQLEDCKFHQCVQLNRFNTDRIIRFVPPDGSFELMRYH
KLTH0F06534g       ---------TNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSERTINFIPPDGSFELMKYH
Kwal_33.14182      ---------TNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSERTINFIAPDGSFELMKYH
CAGL0C05203g       ---------KNKKAIPKAAAGSVLLEDCKFHQCVSLEKFDKDRIIKFVPPDGSMELMKYH
NDAI0G02920        NKSSMLDSNLSNKVLSKASVGNVILEDCKFHQCVSLDKFDRERIIKFVPPDGSVELMKYH
NCAS0C03580        FGDVNFDK-TDKKQLSMASVGSVILEDCKFHQCVSLDKFDKDRIIKFVPPDGSMELMKYH
Suva_15.103        HNGF-----ENKNCFPKAAAGSVLLEDCKFHECVSIDKFNKNHIIEFVPPDGSMELMKYH
Skud_15.91         RSDF-----GNKNFLPKAAAGSVLLEDCKFHECVSIEKFNKNHIIEFIPPDGSMELMKYH
Smik_15.96         RGNF-----ESKNFIHKAAAGSVLLEDCKFHECVSLDKFNKNHTIEFVPPDGSMELMKYH
YOL062C            GSDF-----GNKNFIPKAAAGSVLLEDCKFHECVSLDKFNRNHIIEFVPPDGSMELMKYH
Kpol_1045.44       ---------RNQQNIPRATAGTVVLEDCKFHECVSLDKFNRDRIIKFVPPDGHIELMKYH
ZYRO0B04840g       --EF-----HNKKAVPKAAAGSVMLEDCKFHQCVSLDKFNKERIIKFVPPDGNMELMKYC
TDEL0D04580        ---------ANKKAIPKAAAGRVMLEDCKFHQCVSLDKFNKDRVIKFVPPDGSMELMKYC
                                           : . .* :*:       .. : . ..:* .:::.* 

KLLA0C03894g       VIDN-INIPFNVIPEVEIV-KNSTLNYKVTLRSLFPSNVSAKDVTVKIPVPPTTIKCDFN
KAFR0C01020        VRDDKINIPFKITPIVSTV--KDTVDYRISLKSLFPKNLSATDVVLTIPVPPNTIDCKIN
TBLA0F00840        VSNN-LNLPFRITPQVTLTSHGTALSYAIKLKSLFPRKLSAENVVLRIPVPPGTLDCKIN
ADR315W            IRDD-LRPPFKVTPVVSKV-NERSIEYRITLQSLFPTKLSAKDVELYIPAPPYTISAKVN
KNAG0K01150        VRDN-LNLPFKVTSMVIPT-ANNETDYRVTIKSLFPGKLSAKNVTMRIPVPPGTLDCKIN
TPHA0P00660        VRDD-LNIPFKVTPRVSISSSRCSMRYKIILKSLFPTSLSAADAMLKIPLPPGTVDCKIN
Ecym_5239          VRDN-LNLPFKVTPMVTTL-KGKSVEYRITLKSLFPSKLCAKDVELYIPAPPDTVNAKIN
SAKL0C07414g       VRDN-LNLPFKITPIFSVRSNNGAVEYRVALKSLFPSKLTAKDVVLRIPVPPGTVDCKIN
KLTH0F06534g       VREN-LNLPFKITPVVTLF-KANSIDYRVTIKSLFPSKLTAKDVQLRIPVPPETVDCHIS
Kwal_33.14182      VREN-LNLPFKVTPIVTVV-RSNSIDYQITIKSLFPSKLTAKDVQLRIPVPPETVSCHIS
CAGL0C05203g       VRSN-INLPFKVSPIVTYSSSGTAVEYRITLKSLFPSKLTAKNVTMKIPVPPETLDCKID
NDAI0G02920        IRNN-LNLPFKITPIVTNSVTGDALDYRIALKSLFPGRLSAKGVVLHIPVPPGVMDCNIS
NCAS0C03580        VRDN-LNLPFKVSPIVTNTRNGTALEYRITMKSLFPGRLSAKNVALHIPVPPNTMDCKIN
Suva_15.103        VRDN-INLPFKITPIVAHSARDNEVDYRITLKSLFPGKLSAKDVILHIPVPPSTVDCKIS
Skud_15.91         VRDN-INLPFKITPIVSHSTRDNEIDYRITLKSLFPGKLSAKDVILHIPVPPSTVDCKIS
Smik_15.96         VRDN-INLPFKITPIVTHSTRDNEIDYRITLKSLFPGKLSAKDVTLHIPVPPSTVDCKIS
YOL062C            VRDN-INLPFKVTPIVTHSTRDNEIDYRITLKSLFPGKLSAKDVVLHIPVPPSTVDCKIS
Kpol_1045.44       VRDN-INLPFKVTPNVINSRSRTGLDYRITLKSLFPSKLSANDVVLKIPVPSSTVDCKLN
ZYRO0B04840g       VRDN-LNLPFKITPVVTPC--GSTVEYRITLKSLFPNKLSAKDVALHIPVPPGTVDCKIN
TDEL0D04580        VRDN-LNLPFKVTPIVTSIGRGNTIDYRVTLKSLFPGKLSAKDVSLRIPVPPGTVDCEIN
                   : .: :. **.: . .          * : :.****  : * .. : ** *. .:.. ..

KLLA0C03894g       VSGGKCKYDAGEKCMVWKYNKYKGSTENTLSGKVAIPATS-HDLSDLLRWSRPPISMGFE
KAFR0C01020        VSNGHCKFKAEQNAVIWTFNKFNGSTENTLSA-ITIADGR--QIMNLESWTRPSIQLTFE
TBLA0F00840        ASDGKCKFIPEENCMVWSFHRFNGSTENHLNA-QTVPTQS-IASQSIKQWTRPPMSLDFK
ADR315W            VSCGKCKFVPEENAIIWKIHKFHGLTENTLSA-VTIADEQGHYAQVLDQWPRPPISMKLE
KNAG0K01150        VSNGNCKFLPEENAMVWKFHKYNGLTENKLSA-ITVPTRD-TTQLALQQWSRPPISLDFE
TPHA0P00660        ASSGKCNFSTSDNCAIWKFNKYKGLTENELIL-ETVPSSS-TDILSLQQWTRPPMSMNFE
Ecym_5239          VSSGKGKFIPEENAIVWKIHKYHGLTENVFSA-VIVPMGNGNDSLNLEQWSRPPISVRFE
SAKL0C07414g       TSNGRCRFVPEENAVLWKFAKYQGLTENTLSA-LTVPMDN-QSSLNLQQWSRPPMSLTFE
KLTH0F06534g       TSNGRCKFVPEESAIIWKFSKYQGLTENSLSA-TAVPMKD--SALNIDQWSKPPMSLKFE
Kwal_33.14182      TSNGKCKFVPEESAIVWKFSKYQGLTENSISA-TAVPMKD--STLNIEQWPRPPISLKFE
CAGL0C05203g       VSNGSCKFAPEEKAMLWTFNKYNGLTENTLSA-VTITSKD-APRLNIQQWQKPPISLDFE
NDAI0G02920        VSNGTCKFVPAENAMVWKFNKYNGLTENTLSA-VTVPSKE-VNQTTLQQWARPPMSLDFE
NCAS0C03580        VTNGSCKFIPEESAMIWRFNKFNGLTENTLSA-VTIPTKD-NTQLSLQQWSKPPMSLDFE
Suva_15.103        VSNGNCKFVPEENAMIWRFNKFNGLTENTLSA-VTVSTSD-TTQLSLQQWTRPPMSLDFE
Skud_15.91         VSNGHCKFVPEENAMIWRFNKYNGLTENTLSA-ATVSTSD-TTQLSFQQWTRPPMSLDFE
Smik_15.96         VSNGHCKFVPEENAMMWRFNKYNGLTENTLSA-VTVSTSD-TTQLNLQQWTRPPMSLDFE
YOL062C            VSNGHCKFVPEENAMIWRFNKYNGLTENTLSA-VTVSTSD-TTQLNLQQWTRPPISLEFE
Kpol_1045.44       VSNGKCRFVPEESCIIWKFAKYNGLTENKLSA-VTVSSND-TTQLMLQQWARPPISLDFE
ZYRO0B04840g       ISNGKCKFESEENAMVWRFNKYHGLTENTLSA-VTVPTSD-TTQLTLQQWPRPPMSLGFE
TDEL0D04580        VSNGKCKFVPEESAMIWKFTKYTGLTENTLSA-VTVPSSD-TTQLTVQQWPRPPMSLNFE
                    : *  .: . :.. :*   .: * *** :     :.         .  * .*.:.: ::

KLLA0C03894g       IVMFSNSGLVV------RHLKCQEP---QLNYQPVKWIKYISHSGAYEIRY---------
KAFR0C01020        ITMYSISGLLL------RNLMITDKD--KRRYKASRWIKYISRAGSYEMRF---------
TBLA0F00840        VLMFSNTGLIV------RYLKVQEK---NMHYNTIKWIKYISAAGSYEVRY---------
ADR315W            IMMFSTAALSSATSRSWRKTSSTTPSSGSSTSRALAPTRFATDAEADASAFLSATLSSKT
KNAG0K01150        ILMYSNTGLVV------RYFTVLDKHNNNTKFKTVKWIKYVSHSGSYEVRY---------
TPHA0P00660        IIMFSNSGLVV------KYLKVMER---VQKYRPVKWIKYVSKSGSYEIRY---------
Ecym_5239          ISMFSNSGLVV------RYLKVMEK---DLNYNTVKWVKYISKSGAYEVRY---------
SAKL0C07414g       ILMFSNSGLVV------RFFKVSER---DHSYHTVKWVKYISRSGAYEVRY---------
KLTH0F06534g       IVMFSNSGLVV------RFFDVSEG---DRNYKMVKWIKYLSKSGAYEVRY---------
Kwal_33.14182      IVMFSNSGLVV------RFFNVSER---DRNYKMVKWIKYLSKSGAYEVRY---------
CAGL0C05203g       IMMFSNSGLVV------RYFTIKE----SERYKTVKWIRYVSKSGSYEIRY---------
NDAI0G02920        ILMFSNSGLVV------RYFTISEG---HQNYKAVKWIKYVSKSGSYEVRF---------
NCAS0C03580        ILMFSNSGLVV------RYFTITER---DQKYKAVKWIKYISRSGSYEIRY---------
Suva_15.103        VMMFSNSGLVV------RYFTISSR---DSKHRAVKWIKYISKSGSYEVRY---------
Skud_15.91         VMMFSNSGLVV------RYFTISGK---DSKHRAVKWIKYISKSGSYEVRY---------
Smik_15.96         VMMFSNSGLVV------RYFTIFGK---DSKHRAVKWIKYISRSGSYEVRY---------
YOL062C            VMMFSNSGLVV------RYFTISGK---DSKHRAVKWIKYISKAGSYEVRY---------
Kpol_1045.44       IMMFSNSGLVV------RYLKIMEK---DQKYRTVKWIKYISRSGSYEVRY---------
ZYRO0B04840g       IMMFSNSGLVV------RYFRVSDK---DEKYRVVKWIKYISKSGSYEVRY---------
TDEL0D04580        IMMFSNSGLVV------RYFKVSDK---DERYRTAKWIKYISKSGSYEIRY---------
                   : *:* :.*        .              .     .: : : :    :         

KLLA0C03894g       -------------------
KAFR0C01020        -------------------
TBLA0F00840        -------------------
ADR315W            IALHTTTTHIELGCSKNVD
KNAG0K01150        -------------------
TPHA0P00660        -------------------
Ecym_5239          -------------------
SAKL0C07414g       -------------------
KLTH0F06534g       -------------------
Kwal_33.14182      -------------------
CAGL0C05203g       -------------------
NDAI0G02920        -------------------
NCAS0C03580        -------------------
Suva_15.103        -------------------
Skud_15.91         -------------------
Smik_15.96         -------------------
YOL062C            -------------------
Kpol_1045.44       -------------------
ZYRO0B04840g       -------------------
TDEL0D04580        -------------------
                                      

FASTA FORMAT for MUSCLE Version 3.6

>KLLA0C03894g
MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPILTLGSTTFQHVIRE
S----SDNLPMWLVAVSRSNVDSSMIWEYLHKLYQLMEAFGINDEDVLKDEFMLLYEILE
LTL--ENGIPQTTDLAQIIPRVSRKPIE--NNTISKSPDLDDFLS----------GSNIL
KAPKLSKRSSSSIA----------LSSLSECPWRPS----GLK--YKKNEVYLDINEKIT
ILVGKDGSIVKSFVDGSVDCVSHLSGMPLCQLGLNDTYS----IHGNEKSELSIVEMMSE
YDI------KNKKAIPNAAAGSVILEDCKFHQCVQLNKYEANHVIQFVPPDGPFQLMQYR
VIDN-INIPFNVIPEVEIV-KNSTLNYKVTLRSLFPSNVSAKDVTVKIPVPPTTIKCDFN
VSGGKCKYDAGEKCMVWKYNKYKGSTENTLSGKVAIPATS-HDLSDLLRWSRPPISMGFE
IVMFSNSGLVV------RHLKCQEP---QLNYQPVKWIKYISHSGAYEIRY---------
-------------------
>KAFR0C01020
MISAILIYTPRGELIVSKLYRNNIKRSISEIFRIQVINNFNVRSPILTLGSTTFHHIRST
ANDPTDDEL--WLVCVNRNNANSAAIWEFLQKLNLILQQYGITSESKLKDEFMTVHEILD
NML-LGTGIIQNTDLKSIVDKMSVKPIS----------RTNETTS---------------
TQTGFLKRRNTIL-----------TTPGANFSLIPT----NRHDAHKKNEIFFFVNESMN
LLVSKDGSILKNYVDGKIEIKSHLNGNPTCQFELVDDQT---------------------
-----------------------KITDFKFDQCIEK---VQSRTVRVAATDGELEIVNYH
VRDDKINIPFKITPIVSTV--KDTVDYRISLKSLFPKNLSATDVVLTIPVPPNTIDCKIN
VSNGHCKFKAEQNAVIWTFNKFNGSTENTLSA-ITIADGR--QIMNLESWTRPSIQLTFE
ITMYSISGLLL------RNLMITDKD--KRRYKASRWIKYISRAGSYEMRF---------
-------------------
>TBLA0F00840
MINAVMIFTPRGELLVFKVFKSSVKRTISDIFRVQVINNDNIRSPILTLGSTTFHFIRTT
A----GSKL--WLVAVTRSNADSGAIWEYLYKLNSLMEVYGLTHEDILKDEFIVCHELLD
ITL-GMNGLPMDTELSSVIGKMTLKPAQ----VLTSSADRSDILASSVTTLGH--NSTPI
SMPKFLSRNSNRSVTQEFES----QFSPSNIPWRSR----DIK--YKKNEMIVNVIEKIN
VLVGKDDNILRAYVDGTIDITAHLSGMPMCQIGMNDLST----IQGGENAHWTNEDRA--
---------SNRDAMPDVSGDRVILEGSKFHQCVALDKYNKDNVIWFIPPDGQFELMKYH
VSNN-LNLPFRITPQVTLTSHGTALSYAIKLKSLFPRKLSAENVVLRIPVPPGTLDCKIN
ASDGKCKFIPEENCMVWSFHRFNGSTENHLNA-QTVPTQS-IASQSIKQWTRPPMSLDFK
VLMFSNTGLIV------RYLKVQEK---NMHYNTIKWIKYISAAGSYEVRY---------
-------------------
>ADR315W
MIDAFFVFAPRGSLIVSKLISGEAKESLSEVFRLQVINGLEIRSPVLTLGSTTFQHIRTS
G------GL--WMVVVVRGNADSAAIWEFLYHMNKLLDAYAINTEEALLDDFMLCYELLD
VVL--DSGLPQDTELSHIVPLLSRKPAT------GESASGDDFLN---------------
--SARLRRTGTKNVSVETLD----HFSRDVCPWRGE----GIK--YKKNEVYLDVIEKLS
LLVNRDGTILKAYVDGTVQCTAHLSGMPLCHFGFNDSQS----LRQRSPRRQ--------
---------YAPRVFGTDERESVVLEDCKFHQCVQLNKFDQERVIRFVPPDGEFELMKYH
IRDD-LRPPFKVTPVVSKV-NERSIEYRITLQSLFPTKLSAKDVELYIPAPPYTISAKVN
VSCGKCKFVPEENAIIWKIHKFHGLTENTLSA-VTIADEQGHYAQVLDQWPRPPISMKLE
IMMFSTAALSSATSRSWRKTSSTTPSSGSSTSRALAPTRFATDAEADASAFLSATLSSKT
IALHTTTTHIELGCSKNVD
>KNAG0K01150
MINAVLVYSARGELIVSKMFKPTLKRSVGDIFRVQVINSLDVRSPILTLGSTTFHYVRTP
G-----EGL--WVVSVSRNNENSAATWEFLYKFATMLAAYRLDSEEVLKEEFMLAWELLD
TMV-EGGGIPSETDPHRIISAMSVKPAMSPVDVRADARQQQTTTS---------TGAFGH
AFPQLLHR----------------ASNPGGISILPHATGDGAQ--LKRNEIVMVVQESIS
ILVSKDGSILKAYVDGGIDLTTKLEGAAVCQFGLNDSLS----TDNSSNSKWDPLRSKET
Q--------GTNLEMKNAHVGTVLLRDCKFHQCVSLERFDRDRIIRFTPPEGTIELMKYH
VRDN-LNLPFKVTSMVIPT-ANNETDYRVTIKSLFPGKLSAKNVTMRIPVPPGTLDCKIN
VSNGNCKFLPEENAMVWKFHKYNGLTENKLSA-ITVPTRD-TTQLALQQWSRPPISLDFE
ILMYSNTGLVV------RYFTVLDKHNNNTKFKTVKWIKYVSHSGSYEVRY---------
-------------------
>TPHA0P00660
MINGVLIYSSRGDLIVCDLLKSSLKRTISDIFKIQVINSLEMKSPILTLGSTTFHHIRSS
S----ESKL--WIVAITRSNANSGVIWEFLYKLDSMLTAYDLNNEEKLMEKFMVYYEMID
VML-TSNAMPINTELSSIASKISYRLPK----TISNSPTNEKNNN------------NGL
SIPKFLTRNSRSM--SQEFS----NITQSDIPWRPT----GIK--YKKNEVFLYVNEKIN
ILVSKDQTILKAYVDGSIDLVSHLSGTPICQFGLNDYLS----MTGNNISNRGDEFRHDF
MD-------DEDLSTGRSSSSSVKIEDCTFHQCVSLDKFNDERLINFVPPDGSFELMRYH
VRDD-LNIPFKVTPRVSISSSRCSMRYKIILKSLFPTSLSAADAMLKIPLPPGTVDCKIN
ASSGKCNFSTSDNCAIWKFNKYKGLTENELIL-ETVPSSS-TDILSLQQWTRPPMSMNFE
IIMFSNSGLVV------KYLKVMER---VQKYRPVKWIKYVSKSGSYEIRY---------
-------------------
>Ecym_5239
MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVINNLDVRSPILTLGSTTFHHIRSN
G------GL--WLVTVSRGNTDSAGIWEFLYNFNKLLEVYDINSEDSLQGDFMLCYEILD
IVL--DNGIPRDTELTHIMPYISKKPLS------------ENLLG----------SDDIL
NTPSWLVKAGARGMSSENLG----LTSKDMCLWRSE----GIR--YKKNEVYLDVFEHIS
ILVNKDGAILKSYVDGSVQCVAHLSGMPVCQFGFNDYLSPSSNTQSSGNDGWAEEE----
---------NGTKAIKNAITGSVILEDCKFHQCVQLDKFDQERVIRFVPPDGLFELMKYH
VRDN-LNLPFKVTPMVTTL-KGKSVEYRITLKSLFPSKLCAKDVELYIPAPPDTVNAKIN
VSSGKGKFIPEENAIVWKIHKYHGLTENVFSA-VIVPMGNGNDSLNLEQWSRPPISVRFE
ISMFSNSGLVV------RYLKVMEK---DLNYNTVKWVKYISKSGAYEVRY---------
-------------------
>SAKL0C07414g
MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVINNLDVRSPVLTLGSTTFHHIRSS
S------NL--WIVAVTRSNADSAAIWEFLYKFNALLEAYGLNSEESLKEEFMTCYELLD
VVL--ENGVPVDTELSSVASKMSRRPVV----SLENNPLTDELLM-----SAAANVDLGF
RMPKFLNKGSRSSSSVSSPANGDEHGDPCAYPWRSS----GIK--YKKNEIFLDVNERIN
ILVSKDGSILKSYVDGSVDLTTHLSGTPLCQFGLNDSLS----LDGGTLSRDLDFISEYE
V--------KNKKAIPKAAAGSVQLEDCKFHQCVQLNRFNTDRIIRFVPPDGSFELMRYH
VRDN-LNLPFKITPIFSVRSNNGAVEYRVALKSLFPSKLTAKDVVLRIPVPPGTVDCKIN
TSNGRCRFVPEENAVLWKFAKYQGLTENTLSA-LTVPMDN-QSSLNLQQWSRPPMSLTFE
ILMFSNSGLVV------RFFKVSER---DHSYHTVKWVKYISRSGAYEVRY---------
-------------------
>KLTH0F06534g
MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHVKSP
G------NL--WIVAVSRSNADSAAIWEFLYKLSALLEAFGLHSENELKEDFMTCYELLD
IVL--EDGVPVDTELSSVASKMSVKPSA-------SAERINTFIE-----SGNGGTNRIL
PVAQFLRARSSSS-NLHDSH----SKVPSNIPWRMN----GIK--YKKNEVFLNVNERIS
ILVSKDGSILKSYVDGTVEATTHLSGMPVCRFGLNDSLS----VSTPFGDNESPT-----
---------TNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSERTINFIPPDGSFELMKYH
VREN-LNLPFKITPVVTLF-KANSIDYRVTIKSLFPSKLTAKDVQLRIPVPPETVDCHIS
TSNGRCKFVPEESAIIWKFSKYQGLTENSLSA-TAVPMKD--SALNIDQWSKPPMSLKFE
IVMFSNSGLVV------RFFDVSEG---DRNYKMVKWIKYLSKSGAYEVRY---------
-------------------
>Kwal_33.14182
MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHIKSA
K------NL--WIVAVSRSNADSAAIWEFLYRLNELLEAFNLYSENELKERFMICYELLD
IVL--EDGLPVDTELSSVASKMSVKPNA-------GVDNFNMFAE-----NGHGGTNRIL
PVSQFLRGRPSAG-NLQDIA----SEAPSNIPWRMN----GIK--YKKNEVFLNVNERIS
ILVSKDGSILKSYVDGTVEATTHLSGMPVCRFGLNDALS----VSTPFGDDDEYQV----
---------TNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSERTINFIAPDGSFELMKYH
VREN-LNLPFKVTPIVTVV-RSNSIDYQITIKSLFPSKLTAKDVQLRIPVPPETVSCHIS
TSNGKCKFVPEESAIVWKFSKYQGLTENSISA-TAVPMKD--STLNIEQWPRPPISLKFE
IVMFSNSGLVV------RFFNVSER---DRNYKMVKWIKYLSKSGAYEVRY---------
-------------------
>CAGL0C05203g
MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVINNLDVRSPILTLGSTTFQHIRSN
VH---GDDL--WLVSVTRSNINCGAVWEFLYKFDHMLELYGLNNEEFLKEEFMVCYELLD
VML-GENGTPMDTDPATVIKKMSVKPSK---------ETIENFAI-----SVQNKNSTLP
KIPKFLRRTSSFLNQESSNNSSGAFNMAGELPWRPK----GIS--HKKNEIFLYVNEKIS
ILVSKEGSILKSYVDGTIDLVTHLSGTPVCQFGLNDSLS----VKNDDYGDSFDYI----
---------KNKKAIPKAAAGSVLLEDCKFHQCVSLEKFDKDRIIKFVPPDGSMELMKYH
VRSN-INLPFKVSPIVTYSSSGTAVEYRITLKSLFPSKLTAKNVTMKIPVPPETLDCKID
VSNGSCKFAPEEKAMLWTFNKYNGLTENTLSA-VTITSKD-APRLNIQQWQKPPISLDFE
IMMFSNSGLVV------RYFTIKE----SERYKTVKWIRYVSKSGSYEIRY---------
-------------------
>NDAI0G02920
MINGILIYSPRGELIVSKLFKGTLKRSIADIFRIQVINNLDVRSPILTLGSTTFHHIRSS
KD---SDNL--WLVAATRNNANSAAIWEFLYKLDSMLIEYGLNKEEYLKEEFMIVHELLD
VML-GSCGIPLETEPSKVIAKMSVKPAK------LHHNNTSSLLD----GHLGSKGNNEI
SMPKFLKRNDSSQ--SHDS-----NFSFNDFSWRPK----DIK--HKKNEVILHVNEKIN
ILVAKDGSILKAYVDGSIDLQTRLSGTPVCQFGLNDSLT----LGSNDSEYSSRNGRTGN
NKSSMLDSNLSNKVLSKASVGNVILEDCKFHQCVSLDKFDRERIIKFVPPDGSVELMKYH
IRNN-LNLPFKITPIVTNSVTGDALDYRIALKSLFPGRLSAKGVVLHIPVPPGVMDCNIS
VSNGTCKFVPAENAMVWKFNKYNGLTENTLSA-VTVPSKE-VNQTTLQQWARPPMSLDFE
ILMFSNSGLVV------RYFTISEG---HQNYKAVKWIKYVSKSGSYEVRF---------
-------------------
>NCAS0C03580
MINALLIFTARGELVVSKLFKGSMKRSIADIFRIQVINNLDVRSPILTLGSTTFHHIKST
R----GDNL--WIVAVSRNNVDSAAIWEFLYKLDSLLDSYGLNHEEYLKEEFMIVHELLD
VMMCGSGGIPMLTENSLVISRMSVKPSK---SILEAQNSGNGSSNTNSNNNNNNVPDLLM
SGPKLLRRNSASL--SQD------LSILTDFKWRPK----GIV--HKKNEVILHVNERIN
ILVSKDGSVLKAYVDGSIDLETHLSGTPICQFGLNDSLS----VSGVDSDMYGSHNHNHH
FGDVNFDK-TDKKQLSMASVGSVILEDCKFHQCVSLDKFDKDRIIKFVPPDGSMELMKYH
VRDN-LNLPFKVSPIVTNTRNGTALEYRITMKSLFPGRLSAKNVALHIPVPPNTMDCKIN
VTNGSCKFIPEESAMIWRFNKFNGLTENTLSA-VTIPTKD-NTQLSLQQWSKPPMSLDFE
ILMFSNSGLVV------RYFTITER---DQKYKAVKWIKYISRSGSYEIRY---------
-------------------
>Suva_15.103
MISGVLVYSSRGELILNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSM
R----GDNL--WLVTITRSNANSAAIWEFLYKLDSVMNAYRLDREEALKEEFMIVHEMLD
IML-GGNGIPIDTELNSVIAQMSVKPIR-NVGGLLESPDSIDMLS---STSSPSSVGGEL
HFPKFLKKRSSSFLGQGDSHSD--FSDGNKIAWRPK----GII--HKKDEVFLYVNERMN
ILVSRDGSILKSYVDGTIDITTHLSGTPVCRFGLNDSLG----MQSEDQENWLSQQDQHS
HNGF-----ENKNCFPKAAAGSVLLEDCKFHECVSIDKFNKNHIIEFVPPDGSMELMKYH
VRDN-INLPFKITPIVAHSARDNEVDYRITLKSLFPGKLSAKDVILHIPVPPSTVDCKIS
VSNGNCKFVPEENAMIWRFNKFNGLTENTLSA-VTVSTSD-TTQLSLQQWTRPPMSLDFE
VMMFSNSGLVV------RYFTISSR---DSKHRAVKWIKYISKSGSYEVRY---------
-------------------
>Skud_15.91
MISGVLVYSSRGELILNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSK
H----GDNL--WLVTITRSNANSAAIWEFLYKLDAVMNAYRLDREEALKEEFMIVHEMLD
IML-GGNGIPIDTELNSVVARMSVKPMR-NTGGLLDGADGSDILS---SSSSPSSAGGEL
HFPKFLKKSSSSFLGQGDSTSD--FYDSNKITWRAT----GII--HKKDEVFLYVNERMN
ILVSRDGSILKSYVDGTIDIVTHLNGTPVCRFGLNDSLG----MQSEDEKNWLAQQHQHS
RSDF-----GNKNFLPKAAAGSVLLEDCKFHECVSIEKFNKNHIIEFIPPDGSMELMKYH
VRDN-INLPFKITPIVSHSTRDNEIDYRITLKSLFPGKLSAKDVILHIPVPPSTVDCKIS
VSNGHCKFVPEENAMIWRFNKYNGLTENTLSA-ATVSTSD-TTQLSFQQWTRPPMSLDFE
VMMFSNSGLVV------RYFTISGK---DSKHRAVKWIKYISKSGSYEVRY---------
-------------------
>Smik_15.96
MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSR
H----GDNL--WLVTITRSNANSAAIWEFLYKLDFVMNAYRLDREEALKEEFMIVHEMLD
IML-GGNGIPIDTELNSVIAQMSVKPVR-NTGGLLDSPDGNDMLS---SSSSPSSVSGEL
HFPKFLKKSSSSFLGQGDSASD--FYDGNKITWRPK----GIT--HKKDEVFLYVNERMN
ILVSRDGSILKSYVDGTIDITTHLSGTPICRFGLNDSLG----MQSEDEKKWLAQQQHHS
RGNF-----ESKNFIHKAAAGSVLLEDCKFHECVSLDKFNKNHTIEFVPPDGSMELMKYH
VRDN-INLPFKITPIVTHSTRDNEIDYRITLKSLFPGKLSAKDVTLHIPVPPSTVDCKIS
VSNGHCKFVPEENAMMWRFNKYNGLTENTLSA-VTVSTSD-TTQLNLQQWTRPPMSLDFE
VMMFSNSGLVV------RYFTIFGK---DSKHRAVKWIKYISRSGSYEVRY---------
-------------------
>YOL062C
MISGVLVYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSR
H----GDNL--WLVTITRSNANSAAIWEFLYKLDAVMNAYRLDREEALKEEFMIVHEMLD
IML-GGNGIPIDTELNSVIAQMSVKPVR-NMGGLLDSPDGNDVLS---SSSSPTSSAGEL
HFPKFLTKRSSSFLGQGDSTSD--FYDNNKITWRPK----GII--HKKDEVFLYVNERIN
ILVSRDGSILKSYVDGTIDITTHLSGTPICRFGLNDSLG----MQSEDEKKWLAQQQRHS
GSDF-----GNKNFIPKAAAGSVLLEDCKFHECVSLDKFNRNHIIEFVPPDGSMELMKYH
VRDN-INLPFKVTPIVTHSTRDNEIDYRITLKSLFPGKLSAKDVVLHIPVPPSTVDCKIS
VSNGHCKFVPEENAMIWRFNKYNGLTENTLSA-VTVSTSD-TTQLNLQQWTRPPISLEFE
VMMFSNSGLVV------RYFTISGK---DSKHRAVKWIKYISKAGSYEVRY---------
-------------------
>Kpol_1045.44
MINGVLVYTGKGELIVSKFSKSNAKRSISDIFRVQVINNLDVRSPILTLGSTTFHHIRSN
S----RDHL--WLVAVTRSNANSGAIWEFLYKFDSLLNAFGLDNETTLKEEFMTCYELLD
LML-NVDGVPLDTELSSVSAKMSTKPLH-----SINSPSDSSLDN----------SSSPL
SISKFLNRNNRSM--SVDTM----NTEPSNYPWRPN----GIK--YKKNEIFLNINEKIS
ILVSKDETILKAYVDGTVDLTSHLSGTPTCQFGLNDSLS----VDEPNYYNSDDNGF---
---------RNQQNIPRATAGTVVLEDCKFHECVSLDKFNRDRIIKFVPPDGHIELMKYH
VRDN-INLPFKVTPNVINSRSRTGLDYRITLKSLFPSKLSANDVVLKIPVPSSTVDCKLN
VSNGKCRFVPEESCIIWKFAKYNGLTENKLSA-VTVSSND-TTQLMLQQWARPPISLDFE
IMMFSNSGLVV------RYLKIMEK---DQKYRTVKWIKYISRSGSYEVRY---------
-------------------
>ZYRO0B04840g
MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSN
G----SDSL--WIVTVSRTNANSGAIWEFLYKFNAILDAYDLTKEEKLKEDFMICYEILD
VVI-GAGGIPMDTELGSIASKISVKPPK--SGGTSSEPKSSTVAN----FPGSNLSTSNL
SMPKFLTRNNRSM--SQDLG----TNYPSNFPWRPN----GIK--YKKNEVFLYVNEKIN
ILVSRDGSILKAYVDGTIDMTTHLSGTPICQFGLNDSPS----VEFGDS-LWLDTQ----
--EF-----HNKKAVPKAAAGSVMLEDCKFHQCVSLDKFNKERIIKFVPPDGNMELMKYC
VRDN-LNLPFKITPVVTPC--GSTVEYRITLKSLFPNKLSAKDVALHIPVPPGTVDCKIN
ISNGKCKFESEENAMVWRFNKYHGLTENTLSA-VTVPTSD-TTQLTLQQWPRPPMSLGFE
IMMFSNSGLVV------RYFRVSDK---DEKYRVVKWIKYISKSGSYEVRY---------
-------------------
>TDEL0D04580
MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSD
G----SDSL--WLVAVSRSNANSGAIWEFLYKLNVIMDVYGLTKEGTLKENFMNCYEILD
TVL-EEGGIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSS--LNLSTPGDSSSTL
SMPKFLTRNNRSM--SQDLG----SNYPSNLSWRPH----GIK--YKKNEVLLNVNEKIS
ILVSRDGSILKSYVDGTIDLTTHLSGMPICQFGLNDSLS----VEFGDDSISEVEDF---
---------ANKKAIPKAAAGRVMLEDCKFHQCVSLDKFNKDRVIKFVPPDGSMELMKYC
VRDN-LNLPFKVTPIVTSIGRGNTIDYRVTLKSLFPGKLSAKDVSLRIPVPPGTVDCEIN
VSNGKCKFVPEESAMIWKFTKYTGLTENTLSA-VTVPSSD-TTQLTVQQWPRPPMSLNFE
IMMFSNSGLVV------RYFKVSDK---DERYRTAKWIKYISKSGSYEIRY---------
-------------------