MUSCLE (3.8) multiple sequence alignment

Kpol_1043.34       ---------------------MSDKPVESVPATDAEQVVAEPASAPAPAPAPAPATTETT
TPHA0C03520        -----------------------MSEQEHIVEDTVPAEELASSSPASPESIETPVAAESQ
TBLA0B07170        ------------MSEEISSATTTPTVEQPVQEEFKQKEETGDISTTTAETASSNMTTEQT
CAGL0H10604g       ----------------------------------MSEEIKNEVIETPEEVIEKPEEVSQE
KNAG0A05440        --------------------MSQEQIQPTSQSSEAEISSVPQSESPVTTAATAPSSIEPS
NDAI0B03440        -----------------MAEETAPILSQEQEGSASPITESSTASAAIEHVQEEQATTETN
KAFR0J01260        ------------------------------------MSDQQPSETVVPV-----------
NCAS0B06140        ---------------------MSQEEQEQQHPTAVEQTTIPSATENIPESESTPVTETAE
KLTH0G10912g       ----------------------------MSETVAETRPEQPPVTADESASSTPAPAPAPE
Kwal_27.11447      -----------------------------------MAEETPETRPEQPEIAEQQGTAGSS
KLLA0E08779g       MSAEESQQAQTETAAPVPVPAPAVEQDHSNEATTTVEEKSPGAATTAPATEEAPASEKPA
SAKL0E07128g       ----------------------------------MSEPQQPTQEKVVENNQD--------
AGR390C            ----------------------------------MSGEKADKT-----------------
Ecym_3344          --------------------------------MSVEQQEQPSQAIEVVNSVESVVATTPD
Suva_14.330        ------------------------MSENNEEQQHQQQQQQEPVAAETPLVTEVPTSADPS
Smik_14.313        ---------------------------MSENNEEQQQQQQQPVAVETPSVVETSSAADHP
YNL016W            -------------------------MSENNEEQHQQQQQQQPVAVETPSAVEAPASADPS
Skud_14.312        -------------------------MSENNEEQHQQQQQQQPVAVEAPLVAEASAPVDPS
ZYRO0A02398g       ---------------------------------MMSEEQGPVIGVNASVPVQEEPTVSPS
TDEL0G02360        ------------------------------MSEQENLEQNPTVESEVP------------
                                                                               

Kpol_1043.34       SASAPAEGANEG------EAEAEGEDESIVPANAINGGRETSDKILYVGNLDKSINEDIL
TPHA0C03520        ENQEDENQDRQKDQES--VGTAAEDDSDVVPANAINGGRETSDKILYVGNLDKSINEETL
TBLA0B07170        PAESSSEQT---------GDNDTEESANVVPANAIRGGRETSDKILYVGNLDKSINEDSL
CAGL0H10604g       VEGDNA------------SQENDDDKPSVVPASATKGGRETSDRVLYVGNLDKSITEDLL
KNAG0A05440        QKQAASEADVVPE-----ENEEANKEPPVVPANATHGGRETSDRVLYVGNLDKSITEDIL
NDAI0B03440        QQDGEESNQTEIATEEKGNGEEQEEEPNVVPASATHGGRETSDRVLYVGNLDKSINEDLL
KAFR0J01260        --------------------------ENVIPASAKEGGRETSDKVLYIGNLDKSINEDAL
NCAS0B06140        TSTEPESADPVSEAPAAGEQSAENQESSVVPASATQGGRETSDRVLYVGNLDKSINEDLL
KLTH0G10912g       VAQTPVQTP---------ESSTKPEEPTVTPANASRGGRETSDRILYVGNLDLAVTEEML
Kwal_27.11447      QTEAEQPSQEP-------QTAGKAAEPAVTPANATRGGRETSDRILYVGNLDLAVTEDML
KLLA0E08779g       SQDNNGDGEKQ-------QEEGDEEDDSAAPVLATQGGREKSDKILYVGNLPKSIDDDLL
SAKL0E07128g       ------------------ETTPVEEQPQITPANVARGGRETSDKILYVGNLDKSITEDLL
AGR390C            ------------------VESAAEEAVAATPVLATKGGRETSDRILYVGNLDKTINEATL
Ecym_3344          QPGGEGNEG---------SGSSSEDQSQVTPVLATKGGRETSDRILYVGNLDKAINEDTL
Suva_14.330        AEQNVSSEGNSEQV----DDEQGENDPSVVPANAITGGRETSDRVLYVGNLDKAITEDIL
Smik_14.313        SVQAVSGESNSEQV----EDNQGENDPSVVPANAITGGRETSDKVLYVGNLDKAITEDIL
YNL016W            SEQSVAVEGNSEQA----EDNQGENDPSVVPANAITGGRETSDRVLYVGNLDKAITEDIL
Skud_14.312        AEQNVSGEVNSTQV----EDDQGESDPSVVPANAITGGRETSDRVLYVGNLDKAITEDIL
ZYRO0A02398g       PER---------------SDSEERETTPVVPANATKGGRETSDRVLYVGNLDKSITEEVL
TDEL0G02360        ------------------ASETISEEPSVVPANAIKGGRETSDKVLYVGNLDTSINEEIL
                                                 *. .  ****.**.:**:***  :: :  *

Kpol_1043.34       KQYFQVGGPITNVKVINDKNN-EANYAFVEYSQHHDASIALKTLNGKQIENNTLKINWAF
TPHA0C03520        KQYFQIGGPISNVKVINDKNN-SVNYAFVEYLQHHDADVAFKNLNGKTIETKVLKINWAF
TBLA0B07170        KQYFQVGGPIANVKIIVDKNNKYCNYAFVEYLKHHDANVALQTLNGKHIEKKIVKINWAF
CAGL0H10604g       KQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLNGVQLENKTLKINWAF
KNAG0A05440        KQYFQVAGQIVDVKVMIDKKSNYVNYAFVEYAKAHDASVALQTLNGIQIENNKVKINRAF
NDAI0B03440        KQYFQVGGQITDVKIMVDKKNQNVNYAFVEYLKSHDANVALQTLNGIQIENKIIKINWAF
KAFR0J01260        KQYFQVAGQIVDVKVMVDKKNNHVNYAFIEYSTNHDANVALQTLNGIQIENKNIKINWAF
NCAS0B06140        KQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWAF
KLTH0G10912g       KQYFQVGGSIANVKILMDKNNKQANYAFVEFHQPHDANVAFQTLDGKQIENHVIKINWAF
Kwal_27.11447      KQYFQVGGAIANVKILMDKNNKEANYAFVEFHQPHDASVAFQTLDGKQIENHVIKINYAF
KLLA0E08779g       KQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTLNGKEVEGKVLKINWAF
SAKL0E07128g       KQYFQVGGPVANVKILVDKNNQEANYAFVEYHKPHDANVAFQTLDGKTIENNQIKINWAF
AGR390C            KQYFQVGGPIANVKVLVDKNNEEANYAFVEYRQPRDANVAFQTLDGKQIENNVIKINWAF
Ecym_3344          KQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQTLDGKQIEGNVIKINWAF
Suva_14.330        KQYFQVGGPIANIKIMIDKNNKNVNYAFVEYHQSHDANIALQTLNGKQIENNVVKINWAF
Smik_14.313        KQYFQVGGPIANIKIMIDKNNKNVNYAFVEYHQSHDANIALQTLNGKQIENNIVKINWAF
YNL016W            KQYFQVGGPIANIKIMIDKNNKNVNYAFVEYHQSHDANIALQTLNGKQIENNIVKINWAF
Skud_14.312        KQYFQVGGPIANIKIMIDKNNKNVNYAFVEYHQSHDANIALQTLNGKQIENNIVKINWAF
ZYRO0A02398g       RQYFQVGGQISNVKVMIDKNNARANYAFVEYFKSHDANIALQTLNGKQIENNVVRINWAF
TDEL0G02360        KQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLNGKQIENNVVKINWAF
                   .**** .* : .:*:: * :.   ****:*:   .**.:* :.*:*  :* : :.** **

Kpol_1043.34       QSQQNTTSDETFNLFIGDLNVDVDDETLVAAFKDFKSFIQAHVMWDMQTGRSRGYGFVSF
TPHA0C03520        QSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISF
TBLA0B07170        QSQQSSNDD-TFNLFIGDLNIDVNDESLTAAFKDFPSFVQAHVMWDMQTGRSRGYGFASF
CAGL0H10604g       ETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSF
KNAG0A05440        QSQQSTTDDSTFNLFVGDLNIDIDDDTLSRSFKDFPSYIQAHVMWDMQTGRSRGYGFVSF
NDAI0B03440        QSQQNLNSNDTFNLFVGDLNIDVDDETLSSNFKNFPSYIQAHVMWDMQTSRSRGYGFVSF
KAFR0J01260        QSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSF
NCAS0B06140        QSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSF
KLTH0G10912g       QSQQVSSED-TFNLFVGDLNVDVDDETLARTFKDIPTFIQAHVMWDMQTGRSRGYGFVSF
Kwal_27.11447      QSQQVSSED-TFNLFVGDLNVDVDDETLANTFKHVPTFIQAHVMWDMQTGRSRGYGFVSF
KLLA0E08779g       QSQQVNSDE-TFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSF
SAKL0E07128g       QSHQVASDE-SFNLFVGDLNVDVDDETLANAFSEFSAFIQAHVMWDMQSGRSRGYGFVSF
AGR390C            QSQQVSSDD-TFNLFVGDLNVDVDDETLSSTFKEFPTFIQAHVMWDMQSGRSRGYGFVSF
Ecym_3344          QSQHVSSDD-TFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSF
Suva_14.330        QSQQSSSDD-TFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSF
Smik_14.313        QSQQSSSDD-TFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSF
YNL016W            QSQQSSSDD-TFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSF
Skud_14.312        QSQQSSSDD-TFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSF
ZYRO0A02398g       QSQQALPDENTYNLFVGDLSVDVDDETLCNAFRSFPSFIQGHVMWDMQTGGSRGYGFVSF
TDEL0G02360        QSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSF
                   :::    .:  :***:***.::::* :*   *     ::..****** :. ****** **

Kpol_1043.34       SNLDDAQVAMDTMQGSELNGRQLRINWASKRE-----------------NNSSNNSNRNG
TPHA0C03520        SNQEDAQTAMDKMQSTELNGRQIRINWASKRE-----------------NATNGNGNNNN
TBLA0B07170        STQNDAQLAMDQMQGKELNGRPIRINWASKRD-----------------NQQGQQQSHNN
CAGL0H10604g       SNQEEAQKAMDAMQGKDLSGRQIRINWATKRE-------------RNMGNNFGNNRGSRG
KNAG0A05440        ADQEQAQKAMEEMQGKELNGRPIRINWATKRD----------------NNQQQNHGGPRR
NDAI0B03440        ADRDQAQNAMDTMQGKEINGRPIRINWATKRE------------NNNNNHGGNNNGQQRR
KAFR0J01260        DTHENAQAAMDQMQGHEINGRAIRINWATKRE------------------NMNNNSNNNT
NCAS0B06140        ADQEQAQEAMNVMQGMPINGRAVRINWATKRE----------------NNNNNNGNGPRR
KLTH0G10912g       GEQTQAQKAMEDNQGAVVNGRAIRINWASKREH-----------NSHNNNPMNNRGGARR
Kwal_27.11447      GEQVQAQKAMEEKQGTVVNGRAIRINWASKREHNNGNNANNNIANNNNNNNMGNRGGLRR
KLLA0E08779g       GEQDQAQVAMETKQGFELNGRALRINWASKRE---PQ-------QSQQGQRRFNGPASGR
SAKL0E07128g       GEQEQAQKAMETKQGFELNGRAIRINWASKRE------------NNQNQHNNQHRGGPRR
AGR390C            GEQEEAQKAMDAKQGFNLNGRAIRVNWAAKRE-----------------SQHAARPRSNR
Ecym_3344          SEQDVAQQAMESKQGFILNGRAIRINWASKRE----------------PQQHQPRPRSNR
Suva_14.330        TSQDDAQTAMDSMQGQDLNGRPLRINWAAKRD-------NN---NTNNYPQRRNYGNNNR
Smik_14.313        TSQDDAQTAMDSMQGQDLNGRPLRINWAAKRD-----NNNN---NNNNYPQRRNYGNNNR
YNL016W            TSQDDAQNAMDSMQGQDLNGRPLRINWAAKRD-------NN---NNNNYQQRRNYGNNNR
Skud_14.312        TSQDDAQTAMDTMQGQDLNGRPLRINWAAKRD-NNNSNNNN---NNNNYPQRRNYGNNNR
ZYRO0A02398g       GDQEQAQLAMDSMQSQELNGRPLRINWASKRE------------NHHNGNRRGGLAGNRN
TDEL0G02360        GSQEEAQKAMDAMQGHELNGRPLRINWASKRE-------------NNNNNNRRNVNGPRN
                        ** **:  *.  :.** :*:***:**:                            

Kpol_1043.34       GGFNQRRHNNNGPRGNNNGGFRP------FNNNMPP-----------PPMGNMAPMGAPP
TPHA0C03520        RNMNNRRNNNNSNSNGPRGGFRS------YNNNMPPLPMGN------MPMS------APP
TBLA0B07170        GGFQNRRNNNNNNPNMFGSRNTN------QMQGPPPPNMQM----G-VPPP---QQGMNP
CAGL0H10604g       GNFRPY-GNQGHHNRNNRNMM--------------PPAMGM-PMDGLMPMQQGQQNGQQP
KNAG0A05440        GGFR---NNNNNRRGGMMQ----------------EPQVNI-PIDG-MPPQMVPPQPMVA
NDAI0B03440        GGYRNN-NNNNNSRNTMGGMPMG-------MGGMPQNVMGLGSMDG-IPIQMQQQQQQQQ
KAFR0J01260        -------NNNNNNNQVRNRMMM-------------EGQQNM------PPPP-------PP
NCAS0B06140        GGF-----HNNNNMGGNRGGMIP------------PTALGMPPMDG-MIPN-------PQ
KLTH0G10912g       GGFRNH-GNNQLRHQM------------------PP--MGM-PGRG-AMLPNMGMPSQPP
Kwal_27.11447      GGFRGH-SNAQMRHQL------------------PP--MGMPTHGG-AMMP---GMGAPL
KLLA0E08779g       GGFRNN-NNQNQNHHNHNGINRH--------AGPPPHHQMQ-SHLP-PQLQQQPPIGIPP
SAKL0E07128g       GGFR---NNNGGQFRPPI----------------PP--MGI-PPQG-APMA--PPMGMPP
AGR390C            GGFR-----GGSGHQPFRGMPQG-----------PH-------LGGAAPAG-------PM
Ecym_3344          GGFR---NNNGPSHQQFRGIPQG-----------HP--MGS-PNNA-GPMG-MAPQGMAP
Suva_14.330        GGFRQY-NNNNNNNNMNMGMNMGMNMNMSSNRGMPPSSMGM-PMGA-MPLP---SQGQPQ
Smik_14.313        GGFRQY--NNNNNNNMNMGMNMNMNMNMNTNRGMPPSSMGM-PIGA-MPLP---SQGQPQ
YNL016W            GGFRQY--NSNNNNNMNMGMNMNMNMNMNNSRGMPPSSMGM-PIGA-MPLP---SQGQPQ
Skud_14.312        GGFRQY--NNNNNNNMNMGMNMNMNMNMNSSRGMPPSSMGM-PIGA-MPLP---SQGQPQ
ZYRO0A02398g       GGMRLFPNNNN---GFGRGMPMP-----------PPNSMGI-PLGG-TLPPNAQPMGAPP
TDEL0G02360        NGFR----HNNGGFPGSRGMPMP-----------PPNSMSL-PMGV-VPPP--QALGNP-
                                                                               

Kpol_1043.34       ------------------TGPAVL-PPVDPQAVDDMIRRAPQRVTTVYIGNIPHFATEAD
TPHA0C03520        ------------------AGPAVL-PPVNPQAVDDMIRRAPLRVTTVYIGNIPHFATEAD
TBLA0B07170        VG------------PNGPHPPVVP-LPVNPDAVEDMIRRAPPRVTTAYIGNLPRFATEAD
CAGL0H10604g       NV--------------QQQQPMVP-PPVNPQAIEDMIRRAPPRVTTAYIGNIPHYATEAD
KNAG0A05440        QSMTSAIP----FQDTQQGAPMGALPPVNPQAVDDMIRRAPPRVSTAYIGNIPHFATEAD
NDAI0B03440        QQQVAAAAAAAAAAAAAQQGPLVP-GPVNPQAVDDMIRRAPPRVTTAYIGNIPHFATEAD
KAFR0J01260        MG---------------------SLPPVNPQAVEDMIRRAPPRVTTAYIGNIPHFATEPD
NCAS0B06140        Q-----------------QAPVAP-PPVNPQAIDDMIRRAPPRVTTAYIGNIPHFATEAD
KLTH0G10912g       MP-----------QGAQPQGPIMP-PQVPPQAVEAMMRSAPPRVTTVYIGNIPHFATEQD
Kwal_27.11447      PQ------------GSQAPGPMLP-PQVPPQAIEAMIRSAPSRVTTVYIGNIPHFASEQD
KLLA0E08779g       IH----------------QAPLVP-PPVDPEAVEDMMRRAPPRVTTAYIGNIPHFAQEHD
SAKL0E07128g       QGPG--------IQGPGAQVPPVP-PPVNPQAVEAMIRRAPPRITTAYIGNIPHFATEPD
AGR390C            QL----------------QGPPVP-SPVNPQAVEAMIRRAPQRVTTAYIGNIPHFAQEPD
Ecym_3344          QG-------------IPPQGPVVP-PPVNPQAVEAMIRRAPQRVTTAYIGNIPHFAQEPD
Suva_14.330        QS----------------QTIGLP-PQVNPQAVDHIIRSAPPRVTTAYIGNIPHFATEAD
Smik_14.313        QS----------------QTIGLP-PQVNPQAVDHIIRSAPPRVTTAYIGNIPHFATEAD
YNL016W            QS----------------QTIGLP-PQVNPQAVDHIIRSAPPRVTTAYIGNIPHFATEAD
Skud_14.312        QS----------------QTIGLP-PQVNPQAVDHIIRSAPPRVTTAYIGNIPHFATEAD
ZYRO0A02398g       SG----------------PAPTVP-PPVNPQAVEAMIRRAPPRVTTSYIGNIPHFATDSD
TDEL0G02360        ------------------NGPSVP-PPVNPQAVDSMIRRAPPRVTTAYIGNIPHFAIEAD
                                              * *:*:: ::* ** *::* ****:*.:* : *

Kpol_1043.34       LIPLLQNFGFILDFKHYPEKGNCFIKYDTHEQAAVCIVVLANFPFQGRNLKTGWGKEKST
TPHA0C03520        LIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAVCIVVLANYPFQGRNLKTGWGKEKAV
TBLA0B07170        LIPLLQNFGFILDFKHYPDRGICFIKYDTHEQAAVCIVALANFPLQGRNLKTGWGKEKPT
CAGL0H10604g       LIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERTN
KNAG0A05440        LIPLLQSFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALANFNFQGRNLRTGWGKERNT
NDAI0B03440        LIPLLQTFGFILDFSHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERTT
KAFR0J01260        LIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALSNFQFQGRNLRTGWGKERST
NCAS0B06140        LIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERNT
KLTH0G10912g       LIPLLQNFGFIVDFKHYPDRGCCFIKYGTHEQAAVCILTLGNFPFQGRNLRTGWGKEKPS
Kwal_27.11447      LIPLLQNFGFIVDFKHYPDRGCCFIKYGTHEQAAICILTLGNFPFQGRNLRTGWGKEKPT
KLLA0E08779g       LIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCIVALTNFPFQGRNLRTGWGKEKPT
SAKL0E07128g       LIPLLQNFGFIVDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKEKPT
AGR390C            LIPLLQNFGFIIDFKHYAEKGCCFIKYDTHDQAALCIVALANFPFQGRTLRTGWGKEKPS
Ecym_3344          LIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKEKPA
Suva_14.330        LIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERSN
Smik_14.313        LIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERSN
YNL016W            LIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERSN
Skud_14.312        LIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERSN
ZYRO0A02398g       LIPLLQNFGFILDFKHYPEKGCCFVKYDTHEQAAVCIVALANFFFQGRNLRTGWGKERTT
TDEL0G02360        LIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERTS
                   ****:*.****:**.:*.:.* **:**.**:***:**:.* *: :***.*.******.  

Kpol_1043.34       FMPMPPQDPNGQMPPHMMNEQQLHGEQQQDQGEQ--------------EQSQEQSHQ-
TPHA0C03520        FIPMGQQQGM-MMSGMPPPPPQQQQQFQQDASTP--------------IPNEQQQQQ-
TBLA0B07170        FMPQQQQQQQ-QQPGQLPPQAQLPPQAQMQMQQPPANMMPMMMGNAPNQPPQQQDQE-
CAGL0H10604g       FMPPQ------GAPGQQMPVMMDPSQAPPAPQ--------------------------
KNAG0A05440        FAPPQQQQ---AQPGMMPVMMGEQ---QPPQQQQ------------------------
NDAI0B03440        FIPNQQQQQQQAQVQGQQQQQLPPQHGQIPMQEQGQQPGMIPIMMNDQQQQQQQQQDM
KAFR0J01260        FIP----------PQGMMPPPMMTSEGEQQQQQQ--------------QLQPSE----
NCAS0B06140        FIPPQQQQQQQQQQPGMMPIMMTDPQQQQQQQQQ--------------SPPPQQQQQ-
KLTH0G10912g       YIPQPKPG---QGASKMEQLPTQPIEQDPQSNTP--------------AEQPQEEEQ-
Kwal_27.11447      YVPQPKLD---QSALQMEQRPVQGNEQEPHLNLS--------------ADQAHAGSQ-
KLLA0E08779g       FIRPQQQMG--PIPGQLPLEEQQQQFENAPQQHD--------------QQQPQQQEQ-
SAKL0E07128g       FIPQHQQG----------PVPQQDGQL-PPPQTQ--------------EPQQL-----
AGR390C            FVPNG------AVPHAAAPAPVQPASDAVPAQDQ--------------EHQQ------
Ecym_3344          FIPNGMVP-----PPQQLLHPSQQPIDAPVPQEQ--------------EQQ-------
Suva_14.330        FMPQQQQQQ--GGQPLIMNDQQQPVMPDQQQQQQ--------------QQQQQQQ---
Smik_14.313        FMPQQQQQQ--GGQPLIMNDQQQPVMADPQQQQQ--------------QQQ-------
YNL016W            FMPQQQQQ---GGQPLIMNDQQQPVMSEQQQQQQ--------------QQQQQQ----
Skud_14.312        FMPQQQQQQ--GGQPLIMNDQQQPVMSDQQQQQQ--------------QQQQQ-----
ZYRO0A02398g       FVPMAQPQ-----QPMMMADQSQQPIEH------------------------------
TDEL0G02360        FVPMSQQQ-----PPQQPQQPQQQEEAVPPVDMT--------------EENAQ-----
                   :                                                         

FASTA FORMAT for MUSCLE Version 3.6

>Kpol_1043.34
---------------------MSDKPVESVPATDAEQVVAEPASAPAPAPAPAPATTETT
SASAPAEGANEG------EAEAEGEDESIVPANAINGGRETSDKILYVGNLDKSINEDIL
KQYFQVGGPITNVKVINDKNN-EANYAFVEYSQHHDASIALKTLNGKQIENNTLKINWAF
QSQQNTTSDETFNLFIGDLNVDVDDETLVAAFKDFKSFIQAHVMWDMQTGRSRGYGFVSF
SNLDDAQVAMDTMQGSELNGRQLRINWASKRE-----------------NNSSNNSNRNG
GGFNQRRHNNNGPRGNNNGGFRP------FNNNMPP-----------PPMGNMAPMGAPP
------------------TGPAVL-PPVDPQAVDDMIRRAPQRVTTVYIGNIPHFATEAD
LIPLLQNFGFILDFKHYPEKGNCFIKYDTHEQAAVCIVVLANFPFQGRNLKTGWGKEKST
FMPMPPQDPNGQMPPHMMNEQQLHGEQQQDQGEQ--------------EQSQEQSHQ-
>TPHA0C03520
-----------------------MSEQEHIVEDTVPAEELASSSPASPESIETPVAAESQ
ENQEDENQDRQKDQES--VGTAAEDDSDVVPANAINGGRETSDKILYVGNLDKSINEETL
KQYFQIGGPISNVKVINDKNN-SVNYAFVEYLQHHDADVAFKNLNGKTIETKVLKINWAF
QSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISF
SNQEDAQTAMDKMQSTELNGRQIRINWASKRE-----------------NATNGNGNNNN
RNMNNRRNNNNSNSNGPRGGFRS------YNNNMPPLPMGN------MPMS------APP
------------------AGPAVL-PPVNPQAVDDMIRRAPLRVTTVYIGNIPHFATEAD
LIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAVCIVVLANYPFQGRNLKTGWGKEKAV
FIPMGQQQGM-MMSGMPPPPPQQQQQFQQDASTP--------------IPNEQQQQQ-
>TBLA0B07170
------------MSEEISSATTTPTVEQPVQEEFKQKEETGDISTTTAETASSNMTTEQT
PAESSSEQT---------GDNDTEESANVVPANAIRGGRETSDKILYVGNLDKSINEDSL
KQYFQVGGPIANVKIIVDKNNKYCNYAFVEYLKHHDANVALQTLNGKHIEKKIVKINWAF
QSQQSSNDD-TFNLFIGDLNIDVNDESLTAAFKDFPSFVQAHVMWDMQTGRSRGYGFASF
STQNDAQLAMDQMQGKELNGRPIRINWASKRD-----------------NQQGQQQSHNN
GGFQNRRNNNNNNPNMFGSRNTN------QMQGPPPPNMQM----G-VPPP---QQGMNP
VG------------PNGPHPPVVP-LPVNPDAVEDMIRRAPPRVTTAYIGNLPRFATEAD
LIPLLQNFGFILDFKHYPDRGICFIKYDTHEQAAVCIVALANFPLQGRNLKTGWGKEKPT
FMPQQQQQQQ-QQPGQLPPQAQLPPQAQMQMQQPPANMMPMMMGNAPNQPPQQQDQE-
>CAGL0H10604g
----------------------------------MSEEIKNEVIETPEEVIEKPEEVSQE
VEGDNA------------SQENDDDKPSVVPASATKGGRETSDRVLYVGNLDKSITEDLL
KQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLNGVQLENKTLKINWAF
ETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSF
SNQEEAQKAMDAMQGKDLSGRQIRINWATKRE-------------RNMGNNFGNNRGSRG
GNFRPY-GNQGHHNRNNRNMM--------------PPAMGM-PMDGLMPMQQGQQNGQQP
NV--------------QQQQPMVP-PPVNPQAIEDMIRRAPPRVTTAYIGNIPHYATEAD
LIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERTN
FMPPQ------GAPGQQMPVMMDPSQAPPAPQ--------------------------
>KNAG0A05440
--------------------MSQEQIQPTSQSSEAEISSVPQSESPVTTAATAPSSIEPS
QKQAASEADVVPE-----ENEEANKEPPVVPANATHGGRETSDRVLYVGNLDKSITEDIL
KQYFQVAGQIVDVKVMIDKKSNYVNYAFVEYAKAHDASVALQTLNGIQIENNKVKINRAF
QSQQSTTDDSTFNLFVGDLNIDIDDDTLSRSFKDFPSYIQAHVMWDMQTGRSRGYGFVSF
ADQEQAQKAMEEMQGKELNGRPIRINWATKRD----------------NNQQQNHGGPRR
GGFR---NNNNNRRGGMMQ----------------EPQVNI-PIDG-MPPQMVPPQPMVA
QSMTSAIP----FQDTQQGAPMGALPPVNPQAVDDMIRRAPPRVSTAYIGNIPHFATEAD
LIPLLQSFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALANFNFQGRNLRTGWGKERNT
FAPPQQQQ---AQPGMMPVMMGEQ---QPPQQQQ------------------------
>NDAI0B03440
-----------------MAEETAPILSQEQEGSASPITESSTASAAIEHVQEEQATTETN
QQDGEESNQTEIATEEKGNGEEQEEEPNVVPASATHGGRETSDRVLYVGNLDKSINEDLL
KQYFQVGGQITDVKIMVDKKNQNVNYAFVEYLKSHDANVALQTLNGIQIENKIIKINWAF
QSQQNLNSNDTFNLFVGDLNIDVDDETLSSNFKNFPSYIQAHVMWDMQTSRSRGYGFVSF
ADRDQAQNAMDTMQGKEINGRPIRINWATKRE------------NNNNNHGGNNNGQQRR
GGYRNN-NNNNNSRNTMGGMPMG-------MGGMPQNVMGLGSMDG-IPIQMQQQQQQQQ
QQQVAAAAAAAAAAAAAQQGPLVP-GPVNPQAVDDMIRRAPPRVTTAYIGNIPHFATEAD
LIPLLQTFGFILDFSHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERTT
FIPNQQQQQQQAQVQGQQQQQLPPQHGQIPMQEQGQQPGMIPIMMNDQQQQQQQQQDM
>KAFR0J01260
------------------------------------MSDQQPSETVVPV-----------
--------------------------ENVIPASAKEGGRETSDKVLYIGNLDKSINEDAL
KQYFQVAGQIVDVKVMVDKKNNHVNYAFIEYSTNHDANVALQTLNGIQIENKNIKINWAF
QSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSF
DTHENAQAAMDQMQGHEINGRAIRINWATKRE------------------NMNNNSNNNT
-------NNNNNNNQVRNRMMM-------------EGQQNM------PPPP-------PP
MG---------------------SLPPVNPQAVEDMIRRAPPRVTTAYIGNIPHFATEPD
LIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALSNFQFQGRNLRTGWGKERST
FIP----------PQGMMPPPMMTSEGEQQQQQQ--------------QLQPSE----
>NCAS0B06140
---------------------MSQEEQEQQHPTAVEQTTIPSATENIPESESTPVTETAE
TSTEPESADPVSEAPAAGEQSAENQESSVVPASATQGGRETSDRVLYVGNLDKSINEDLL
KQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWAF
QSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSF
ADQEQAQEAMNVMQGMPINGRAVRINWATKRE----------------NNNNNNGNGPRR
GGF-----HNNNNMGGNRGGMIP------------PTALGMPPMDG-MIPN-------PQ
Q-----------------QAPVAP-PPVNPQAIDDMIRRAPPRVTTAYIGNIPHFATEAD
LIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERNT
FIPPQQQQQQQQQQPGMMPIMMTDPQQQQQQQQQ--------------SPPPQQQQQ-
>KLTH0G10912g
----------------------------MSETVAETRPEQPPVTADESASSTPAPAPAPE
VAQTPVQTP---------ESSTKPEEPTVTPANASRGGRETSDRILYVGNLDLAVTEEML
KQYFQVGGSIANVKILMDKNNKQANYAFVEFHQPHDANVAFQTLDGKQIENHVIKINWAF
QSQQVSSED-TFNLFVGDLNVDVDDETLARTFKDIPTFIQAHVMWDMQTGRSRGYGFVSF
GEQTQAQKAMEDNQGAVVNGRAIRINWASKREH-----------NSHNNNPMNNRGGARR
GGFRNH-GNNQLRHQM------------------PP--MGM-PGRG-AMLPNMGMPSQPP
MP-----------QGAQPQGPIMP-PQVPPQAVEAMMRSAPPRVTTVYIGNIPHFATEQD
LIPLLQNFGFIVDFKHYPDRGCCFIKYGTHEQAAVCILTLGNFPFQGRNLRTGWGKEKPS
YIPQPKPG---QGASKMEQLPTQPIEQDPQSNTP--------------AEQPQEEEQ-
>Kwal_27.11447
-----------------------------------MAEETPETRPEQPEIAEQQGTAGSS
QTEAEQPSQEP-------QTAGKAAEPAVTPANATRGGRETSDRILYVGNLDLAVTEDML
KQYFQVGGAIANVKILMDKNNKEANYAFVEFHQPHDASVAFQTLDGKQIENHVIKINYAF
QSQQVSSED-TFNLFVGDLNVDVDDETLANTFKHVPTFIQAHVMWDMQTGRSRGYGFVSF
GEQVQAQKAMEEKQGTVVNGRAIRINWASKREHNNGNNANNNIANNNNNNNMGNRGGLRR
GGFRGH-SNAQMRHQL------------------PP--MGMPTHGG-AMMP---GMGAPL
PQ------------GSQAPGPMLP-PQVPPQAIEAMIRSAPSRVTTVYIGNIPHFASEQD
LIPLLQNFGFIVDFKHYPDRGCCFIKYGTHEQAAICILTLGNFPFQGRNLRTGWGKEKPT
YVPQPKLD---QSALQMEQRPVQGNEQEPHLNLS--------------ADQAHAGSQ-
>KLLA0E08779g
MSAEESQQAQTETAAPVPVPAPAVEQDHSNEATTTVEEKSPGAATTAPATEEAPASEKPA
SQDNNGDGEKQ-------QEEGDEEDDSAAPVLATQGGREKSDKILYVGNLPKSIDDDLL
KQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTLNGKEVEGKVLKINWAF
QSQQVNSDE-TFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSF
GEQDQAQVAMETKQGFELNGRALRINWASKRE---PQ-------QSQQGQRRFNGPASGR
GGFRNN-NNQNQNHHNHNGINRH--------AGPPPHHQMQ-SHLP-PQLQQQPPIGIPP
IH----------------QAPLVP-PPVDPEAVEDMMRRAPPRVTTAYIGNIPHFAQEHD
LIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCIVALTNFPFQGRNLRTGWGKEKPT
FIRPQQQMG--PIPGQLPLEEQQQQFENAPQQHD--------------QQQPQQQEQ-
>SAKL0E07128g
----------------------------------MSEPQQPTQEKVVENNQD--------
------------------ETTPVEEQPQITPANVARGGRETSDKILYVGNLDKSITEDLL
KQYFQVGGPVANVKILVDKNNQEANYAFVEYHKPHDANVAFQTLDGKTIENNQIKINWAF
QSHQVASDE-SFNLFVGDLNVDVDDETLANAFSEFSAFIQAHVMWDMQSGRSRGYGFVSF
GEQEQAQKAMETKQGFELNGRAIRINWASKRE------------NNQNQHNNQHRGGPRR
GGFR---NNNGGQFRPPI----------------PP--MGI-PPQG-APMA--PPMGMPP
QGPG--------IQGPGAQVPPVP-PPVNPQAVEAMIRRAPPRITTAYIGNIPHFATEPD
LIPLLQNFGFIVDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKEKPT
FIPQHQQG----------PVPQQDGQL-PPPQTQ--------------EPQQL-----
>AGR390C
----------------------------------MSGEKADKT-----------------
------------------VESAAEEAVAATPVLATKGGRETSDRILYVGNLDKTINEATL
KQYFQVGGPIANVKVLVDKNNEEANYAFVEYRQPRDANVAFQTLDGKQIENNVIKINWAF
QSQQVSSDD-TFNLFVGDLNVDVDDETLSSTFKEFPTFIQAHVMWDMQSGRSRGYGFVSF
GEQEEAQKAMDAKQGFNLNGRAIRVNWAAKRE-----------------SQHAARPRSNR
GGFR-----GGSGHQPFRGMPQG-----------PH-------LGGAAPAG-------PM
QL----------------QGPPVP-SPVNPQAVEAMIRRAPQRVTTAYIGNIPHFAQEPD
LIPLLQNFGFIIDFKHYAEKGCCFIKYDTHDQAALCIVALANFPFQGRTLRTGWGKEKPS
FVPNG------AVPHAAAPAPVQPASDAVPAQDQ--------------EHQQ------
>Ecym_3344
--------------------------------MSVEQQEQPSQAIEVVNSVESVVATTPD
QPGGEGNEG---------SGSSSEDQSQVTPVLATKGGRETSDRILYVGNLDKAINEDTL
KQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQTLDGKQIEGNVIKINWAF
QSQHVSSDD-TFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSF
SEQDVAQQAMESKQGFILNGRAIRINWASKRE----------------PQQHQPRPRSNR
GGFR---NNNGPSHQQFRGIPQG-----------HP--MGS-PNNA-GPMG-MAPQGMAP
QG-------------IPPQGPVVP-PPVNPQAVEAMIRRAPQRVTTAYIGNIPHFAQEPD
LIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKEKPA
FIPNGMVP-----PPQQLLHPSQQPIDAPVPQEQ--------------EQQ-------
>Suva_14.330
------------------------MSENNEEQQHQQQQQQEPVAAETPLVTEVPTSADPS
AEQNVSSEGNSEQV----DDEQGENDPSVVPANAITGGRETSDRVLYVGNLDKAITEDIL
KQYFQVGGPIANIKIMIDKNNKNVNYAFVEYHQSHDANIALQTLNGKQIENNVVKINWAF
QSQQSSSDD-TFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSF
TSQDDAQTAMDSMQGQDLNGRPLRINWAAKRD-------NN---NTNNYPQRRNYGNNNR
GGFRQY-NNNNNNNNMNMGMNMGMNMNMSSNRGMPPSSMGM-PMGA-MPLP---SQGQPQ
QS----------------QTIGLP-PQVNPQAVDHIIRSAPPRVTTAYIGNIPHFATEAD
LIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERSN
FMPQQQQQQ--GGQPLIMNDQQQPVMPDQQQQQQ--------------QQQQQQQ---
>Smik_14.313
---------------------------MSENNEEQQQQQQQPVAVETPSVVETSSAADHP
SVQAVSGESNSEQV----EDNQGENDPSVVPANAITGGRETSDKVLYVGNLDKAITEDIL
KQYFQVGGPIANIKIMIDKNNKNVNYAFVEYHQSHDANIALQTLNGKQIENNIVKINWAF
QSQQSSSDD-TFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSF
TSQDDAQTAMDSMQGQDLNGRPLRINWAAKRD-----NNNN---NNNNYPQRRNYGNNNR
GGFRQY--NNNNNNNMNMGMNMNMNMNMNTNRGMPPSSMGM-PIGA-MPLP---SQGQPQ
QS----------------QTIGLP-PQVNPQAVDHIIRSAPPRVTTAYIGNIPHFATEAD
LIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERSN
FMPQQQQQQ--GGQPLIMNDQQQPVMADPQQQQQ--------------QQQ-------
>YNL016W
-------------------------MSENNEEQHQQQQQQQPVAVETPSAVEAPASADPS
SEQSVAVEGNSEQA----EDNQGENDPSVVPANAITGGRETSDRVLYVGNLDKAITEDIL
KQYFQVGGPIANIKIMIDKNNKNVNYAFVEYHQSHDANIALQTLNGKQIENNIVKINWAF
QSQQSSSDD-TFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSF
TSQDDAQNAMDSMQGQDLNGRPLRINWAAKRD-------NN---NNNNYQQRRNYGNNNR
GGFRQY--NSNNNNNMNMGMNMNMNMNMNNSRGMPPSSMGM-PIGA-MPLP---SQGQPQ
QS----------------QTIGLP-PQVNPQAVDHIIRSAPPRVTTAYIGNIPHFATEAD
LIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERSN
FMPQQQQQ---GGQPLIMNDQQQPVMSEQQQQQQ--------------QQQQQQ----
>Skud_14.312
-------------------------MSENNEEQHQQQQQQQPVAVEAPLVAEASAPVDPS
AEQNVSGEVNSTQV----EDDQGESDPSVVPANAITGGRETSDRVLYVGNLDKAITEDIL
KQYFQVGGPIANIKIMIDKNNKNVNYAFVEYHQSHDANIALQTLNGKQIENNIVKINWAF
QSQQSSSDD-TFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSF
TSQDDAQTAMDTMQGQDLNGRPLRINWAAKRD-NNNSNNNN---NNNNYPQRRNYGNNNR
GGFRQY--NNNNNNNMNMGMNMNMNMNMNSSRGMPPSSMGM-PIGA-MPLP---SQGQPQ
QS----------------QTIGLP-PQVNPQAVDHIIRSAPPRVTTAYIGNIPHFATEAD
LIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERSN
FMPQQQQQQ--GGQPLIMNDQQQPVMSDQQQQQQ--------------QQQQQ-----
>ZYRO0A02398g
---------------------------------MMSEEQGPVIGVNASVPVQEEPTVSPS
PER---------------SDSEERETTPVVPANATKGGRETSDRVLYVGNLDKSITEEVL
RQYFQVGGQISNVKVMIDKNNARANYAFVEYFKSHDANIALQTLNGKQIENNVVRINWAF
QSQQALPDENTYNLFVGDLSVDVDDETLCNAFRSFPSFIQGHVMWDMQTGGSRGYGFVSF
GDQEQAQLAMDSMQSQELNGRPLRINWASKRE------------NHHNGNRRGGLAGNRN
GGMRLFPNNNN---GFGRGMPMP-----------PPNSMGI-PLGG-TLPPNAQPMGAPP
SG----------------PAPTVP-PPVNPQAVEAMIRRAPPRVTTSYIGNIPHFATDSD
LIPLLQNFGFILDFKHYPEKGCCFVKYDTHEQAAVCIVALANFFFQGRNLRTGWGKERTT
FVPMAQPQ-----QPMMMADQSQQPIEH------------------------------
>TDEL0G02360
------------------------------MSEQENLEQNPTVESEVP------------
------------------ASETISEEPSVVPANAIKGGRETSDKVLYVGNLDTSINEEIL
KQYFQVGGPIANVKIMVDKNNSNANYAFVEYFQSHDANIALQTLNGKQIENNVVKINWAF
QSQQVSPDEATFNLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSF
GSQEEAQKAMDAMQGHELNGRPLRINWASKRE-------------NNNNNNRRNVNGPRN
NGFR----HNNGGFPGSRGMPMP-----------PPNSMSL-PMGV-VPPP--QALGNP-
------------------NGPSVP-PPVNPQAVDSMIRRAPPRVTTAYIGNIPHFAIEAD
LIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERTS
FVPMSQQQ-----PPQQPQQPQQQEEAVPPVDMT--------------EENAQ-----