MUSCLE (3.8) multiple sequence alignment

Kpol_1003.37       --------------MSFNGGAHSLKRILHDTVTEDVKPEMATGVNGGKETIMNGNSKNDH
TPHA0C03390        -----------------MSEQI------------GDKRKLKDESEF---PSVSIGDEGKV
KLLA0E08383g       -----------------MESKKPAEEP-------LERPSIKEIKNE-------GTAYTLP
Kpol_1039.32       ------------------------------------------------------------
TBLA0B06950        -------------------MSIKVEDNSG-----GLKRNHEELETG--TKNVSTNNILNK
ADL216C            -----------------MEERT------------QQKRKLEEGSPD----GEANGGQASR
Ecym_3324          -----------------MNQES------------KQKRKLEIDGNDTIGVENMKTAVSKL
SAKL0E07700g       -------------MTESTATVTGNDSAVEVKMEDSLKRKVDTMEDE----------VESR
KLTH0G10340g       -----------------MTESAEVKQEEPSEQINGLKRDHESATLN---------DGTGN
Kwal_27.11537      -----------------MTEAVGIKQEDSLKQENGFKRDAENALLE---------EENGG
KAFR0H03320        -----------------MQSNMTSSAMEG-----STKRKQEEENLE-------------S
KNAG0H02010        ------------------MTEPSVKRENP-----DSQKPAESSTHS--------------
CAGL0J03454g       -------------------MGVELKQEPG-----ESKRKLEDDVAS--------------
ZYRO0A01870g       -----------------MNTDNPVKQEDE-----GSKRKLEESPNG---PVEKKPNVASV
TDEL0G02160        --------------MTISMDCDIVKPENDTTL--QVKRKMEEQNDG---LDPKKSQLART
Suva_14.326        ------------------MDSATVKNEVLETPDQDLKHKLEGMKEE---------QNSLS
Skud_14.308        ------------------MDSARVKNEVLENPDHDLKRTLENTKED---------QNSLS
YNL021W            ------------------MDSVMVKKEVLENPDHDLKRKLEENKEE---------ENSLS
Smik_14.310        ------------------MDSEIVKKEAWENPDGNLKRRLEETKED---------QNSLS
NDAI0G00650        -----------------MNGGETTSNNDT-----IKKRKIDPES----------------
NCAS0G03800        MVKHLPLTLNHRWKTKESATVLLQTNKQFTQSDTTQKRNMTAVKEE-------PELKKQK
                                                                               

Kpol_1003.37       FKKMPKRQVIVPIRQPKLHYTPLKTGLCYDVRMRYHAKIFTSNFEYIDPHPEDPRRVYRI
TPHA0C03390        IQVLPKRPVIVPTQKPNLHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI
KLLA0E08383g       SKDESQRPVIVPPTKPKIRYSLLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRV
Kpol_1039.32       -------------MMSSLSYTPLKTGLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRI
TBLA0B06950        NPPNYKKQIIVPVQAPKIHYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI
ADL216C            KAIVQKRPVIVPPVRPKISYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI
Ecym_3324          TVAQQKRPIIVPVVKPKIHYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI
SAKL0E07700g       KRSTGTLPVIVPEVPPRIHYTQLKTGLCYDVRMRYHAKIYTSYFEYIDPHPEDPRRIYRI
KLTH0G10340g       QASVAKRPTIVPACRPKLHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI
Kwal_27.11537      SETKVKRPVIVPACRAKLHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI
KAFR0H03320        LNVVPKRQVIVPTKKPQVHYIPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI
KNAG0H02010        -----KRQMIVAPCAPKLRYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI
CAGL0J03454g       --QDVKRPVIVPTRKAQIHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI
ZYRO0A01870g       SNGRQKRQIIVPACEPKIHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI
TDEL0G02160        QNGAAGKRVIVPACAPNLHYTPLKTALCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRV
Suva_14.326        TTSKNKRQVIVPACTPKLHYTPLRTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI
Skud_14.308        TTSRNKRQVIVPACTPKIHYSPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI
YNL021W            TTSKSKRQVIVPVCMPKIHYSPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI
Smik_14.310        TTSNNKRQVIVPACTPKIHYSPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI
NDAI0G00650        ------RQIIVPPRDAQIHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI
NCAS0G03800        ITDVSERPVIVPPRDAELSYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI
                                  . : *  *.*.:************:** :************:**:

Kpol_1003.37       YKILAENGLIKDENLSGLDDIGDIMLKIPVRTATEEEILAVHTREHLDFIENIESQSREE
TPHA0C03390        YKILAENGLINDPSLTGVSDIGDLMLKIPVREATKEEILDVHTEEHMQFLESTEKMTREE
KLLA0E08383g       YKILAENGLIQDPTLSGADSIGDLMVKVPVREAEEEEILQVHSRQHLDFISQTEQLERES
Kpol_1039.32       YKILAENGLIRDPALSGIDDIGDLMCKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDE
TBLA0B06950        YKILAENGLINDPTLSGVDNIGDLMLKLPIREATMNEILEVHSIEHFKYLEKTSNDNREQ
ADL216C            YKILAENGLIEDPTLSGIDEIGELMQKIPVREATEEEILTVHSKEHVEFLKTTNTMDREQ
Ecym_3324          YKILAENGLIEDPTLSGVDDIGNLMLKIPIREATEDEILLVHSKEHVEFLKTTNTMSREQ
SAKL0E07700g       YKILAENGLIRDPTLSGVDEIGELMLKIPVREATAEEILQVHTKEHLAFLEKTPKMTREQ
KLTH0G10340g       YKILAENGLIDDPTLSGVDSIGDLMLKIPVREATDEEILQVHTKEHLEFISKTTSMTRDQ
Kwal_27.11537      YKILAENGLIIDPTLSGVDDIGDLMLKIPAREATDEEILQVHTPEHLEFLSKTTSMTREQ
KAFR0H03320        YKILAENGLINDTMLSGVDDIGDIMLKIPVREATADEILEVHSREHLEFLESTTTMNREV
KNAG0H02010        YKILAENGLITDPMLSGIDDIGDLMLKIPVREATSQEVLEVHSKEHLEFIESVTKMSHDE
CAGL0J03454g       YKILAENGLINDPTLSGVNDIGDLMLKIPIRAATAEEILEVHSKEHLEFIEKTEKMNREE
ZYRO0A01870g       YKILAENGLINDPTLSGEDDIGELMLKIPVREATVEELLQVHTKEHLEFIEKTSQMNREE
TDEL0G02160        YKILAENGLINDPTLSGIDEIGDLMLKIPVREATDEEILEVHSKENLEFVERSSRMKREE
Suva_14.326        YKILAENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREQ
Skud_14.308        YKILAENGLINDPTLSGVDDIGDLMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREQ
YNL021W            YKILAENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREE
Smik_14.310        YKILAENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREQ
NDAI0G00650        YKILAENGLIKDPTLSGIDDIGDLMLKIPVREATSEEILEVHSKEHLDFIESTSKMNREQ
NCAS0G03800        YKILAENGLIKDPTLSGIEDIGDLMLKIPVRDATEEEILEVHSKEHYDFIEKTSTMNREE
                   ********** *  *:* ..:*::* *:* * *  :*:* **. ::  ::.      .: 

Kpol_1003.37       LIKLTEKADSVYYNNDSYYSAKLSCGGVIEACRAVVEGRVKNSLAIVRPPGHHAEPQAAG
TPHA0C03390        LLSKTEKGDSVYLNNDSYISARLSCGGAIEACKAVVEGRVKNALAIVRPPGHHAEPQAAG
KLLA0E08383g       LLKETEGGDSVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNSIAVVRPPGHHAEPEIAG
Kpol_1039.32       LLSKTELGDSVYFNNDSYFSAKLSCGGAIEACKAIVDGKVKNSLAIVRPPGHHSEPEVAG
TBLA0B06950        LLKETENGDSVYFNNDSFQSAKLSCGGAIEACKAVVEGRVKNAMAVVRPPGHHSEPESAG
ADL216C            LLKETEAGDSVYYNNDSLISARLSCGGAIEACKAVVEGRVKNAMAVVRPPGHHAEPGVAG
Ecym_3324          LLKETEAGDSVYYNNDSLVSAKLSCGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEVAG
SAKL0E07700g       LLKETETGDSVYFNNDSLLSAKLSCGGAIEACKAVVEGRVKNALAVIRPPGHHAEPEIAG
KLTH0G10340g       LLKETEKGDSVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEVAG
Kwal_27.11537      LLKETEKGDSVYFNNDSYLSAKLSCGGAIEACRAVVEGRVKNALAVVRPPGHHAEPDLAG
KAFR0H03320        LLKETEKGDSVYFNNDSYMSAKLSCGGAIEACKAVVEGKVKNALAVVRPPGHHSEPESSG
KNAG0H02010        LLKSTETGDSVYFNNDSSSSAKLSCGGAIEACKAVVEGRVKNAFAVVRPPGHHSEPESAG
CAGL0J03454g       LLKETEKGDSVYFNNDSYATSRLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPEAAG
ZYRO0A01870g       LLKETETGDSVYFNSDSYSAAKLPCGGAIEACKAVVEGRVKNALAVIRPPGHHAEPEMAG
TDEL0G02160        LLKETEKGDSVYFNNDSYVSAKLSCGGVIDACKAVVEGRVKNALAVVRPPGHHAEPEAPG
Suva_14.326        LLKETEKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAG
Skud_14.308        LLKETEKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAG
YNL021W            LLKETEKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAG
Smik_14.310        LLKETEKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAG
NDAI0G00650        LLKATESGDSVYFNSDSYASAKLPVGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEAAG
NCAS0G03800        LLKATEKGDSVYFNNDSFASAKLPVGGSIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAG
                   *:. ** .**** *.**  ::.*. ** *:**.*:*:*.***::*::******:**  .*

Kpol_1003.37       GFCLFSNVSVAARSILRTYPESVRKILILDWDIHHGNGTQKAFYEDENVLYISLHRYEST
TPHA0C03390        GFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELG
KLLA0E08383g       GFCLFSNVAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLG
Kpol_1039.32       GFCLFSNVAVATKNILKNYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELG
TBLA0B06950        GFCLFSNVAVATKNILKNYPESVRKVLILDWDIHHGNGTQKAFYNDDNVLYISLHRFELG
ADL216C            GFCLFSNVAVAAQNILKNYPESVRRVMILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELG
Ecym_3324          GFCLFSNVAVAARNILKNYPESVRKVMILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELG
SAKL0E07700g       GFCLFSNVAVAAQNILKNYPESVRRIMILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELG
KLTH0G10340g       GFCLFSNVAVAAQNILKNYPESVRKIMVLDWDVHHGNGTQKAFYDDDRVLYISLHRHELG
Kwal_27.11537      GFCLFSNVAVAAQNILKNYPESVKKIMILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELG
KAFR0H03320        GFCLFSNVAVAAKNILKNYPESVRKIMILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAG
KNAG0H02010        GFCLFSNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELG
CAGL0J03454g       GFCLFSNVAVAAKNILKNYPESVRRILILDWDVHHGNGTQKAFYDDDRVLYISLHRFELG
ZYRO0A01870g       GFCLFSNVAVAAQNILKNYPESVRRILILDWDIHHGNGTQKAFYNDDRVLYISLHRFELG
TDEL0G02160        GFCLFSNVAVAAQNILKQYPESVRRILILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMG
Suva_14.326        GFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIG
Skud_14.308        GFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMG
YNL021W            GFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMG
Smik_14.310        GFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMG
NDAI0G00650        GFCLFSNVAIAAKNILKNYPESVRKILILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMG
NCAS0G03800        GFCLFSNVAIAAKNILKNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELG
                   ********::*: .:*. **:.*..::::***:*******.:** * .:**:****.:  

Kpol_1003.37       AFYPGTIHGRYDQVGEGKGEGFNCNITWPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIV
TPHA0C03390        KFYPGFPEGNYDKVGDGKGKGFNCNITWPVKGVGDVEYIWAFEQIVIPMAREFRPDLVIV
KLLA0E08383g       KYYPGTIHGNYDQTGEGKGEGFNCNITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLI
Kpol_1039.32       KYYPGTIHGQYDQVGEGKGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIV
TBLA0B06950        KYYPGTIQGQYDQTGEGKGEGFNCNITWPIGAVGDAEYMWAFEQVVMPMSREFQPDLVII
ADL216C            KYYPGTSYGNYDQCGDGKGEGFNCNIPWSCSGVGDAEYMWAFEQVVIPMGREFQPDLVII
Ecym_3324          RYYPGTEYGNYNQSGEGKGEGFNCNIPWSCGGVGDAEYMWAFEQIVIPMGREFQPDLVII
SAKL0E07700g       KYYPGTVHGNYEQTGEGKGEGFNCNIPWPYGGLGDAEYMWAFQQVVMPMGREFQPDLVII
KLTH0G10340g       KYYPGTIHGNSDRVGEGKGEGFNCNIPWPWKGVGDSEYLWAFEQVIMPMGREFRPDLVII
Kwal_27.11537      KYYPGTIHGNADRVGEGKGEGFNCNIPWPWKGVGDAEYIWAFEQVVLPMGREFQPDLVII
KAFR0H03320        KYYPGTVQGQYDQCGEGKGEGFNCNITWPTGGVGDAEYMWAFEQIVMPMGREFQPDLVII
KNAG0H02010        KYYPGTAQGHYDKTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMSREFRPDLVII
CAGL0J03454g       KYYPGTIQGQYDQIGEGKGKGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFQPDLVII
ZYRO0A01870g       KYYPGTIHGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMLAFEQIVMPMAREYRPDLVII
TDEL0G02160        KYYPGTINGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMLAFEQIVMPMAREFQPDLVII
Suva_14.326        KYYPGTIQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVII
Skud_14.308        KYYPGTIQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVII
YNL021W            KYYPGTIQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVII
Smik_14.310        KYYPGTIQGQYDQAGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVII
NDAI0G00650        KYYPGTIHGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQIVMPMGREFQPDLVII
NCAS0G03800        KYYPGTINGQYDQTGEGKGEGFNCNITWPVGGVGDAEYIWAFEQVVMPMAREFQPDLVII
                    :***   *. :. *:***:******.*.  .:** **: **:::::*:.**: ****::

Kpol_1003.37       SSGXXXMK----------------------------------------------------
TPHA0C03390        SSGFDAAHGDTIGQCHVTPNCYGYMTHMLKSLARGNLCVVLEGGYNLDSISNSALAVAKI
KLLA0E08383g       SSGFDAADGDTIGQCHVTPACYGHMTHMLLSLAKGNLCVVLEGGYNLDSIAKSALGVCKV
Kpol_1039.32       SSGFDAADGDTIGKCHVTPSCYGHMTHMLKSLANGKLCVVLEGGYNLDAIARSALAVAKV
TBLA0B06950        SSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIARSALSVSKI
ADL216C            SSGFDAADGDTIGQCHVSPACYGHLTHMLKSLARGNMCVVLEGGYNLDSIAKSALGVAKV
Ecym_3324          SSGFDAADGDTIGQCHVSPACYGHMTHMLKSLAKGNMCVVLEGGYNLDSIAKSALGVVKV
SAKL0E07700g       SSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVLEGGYNLDSIAKSALGVAKI
KLTH0G10340g       SSGFDAADGDTVGQCHVTPSCYGHMTHMLKSLARGNLCAVLEGGYSLDSIAKSALAVAKV
Kwal_27.11537      SSGFDAADGDTVGQCHVTPSCYGHMTHMLKSLARGNICAVLEGGYSLDSIAKSALGVAKV
KAFR0H03320        SSGFDAADGDVIGQCHVTPSCYGHMTHMLKSLARGNLVVVLEGGYNLDSIAISALSVAKT
KNAG0H02010        SAGFDAADGDTIGQCHVSPSCYGHMTHMLKSLANGNLCVVLEGGYNLDAIARSALSVAKV
CAGL0J03454g       SSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAISALSVAKI
ZYRO0A01870g       SSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVALEGGYNLDAIATSALSVAKI
TDEL0G02160        SSGFDAADGDTIGQCHVTPSCYGQMTHMLKSLARGNLCVALEGGYNLDAIAISALSVAKV
Suva_14.326        SSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAISALSVAKV
Skud_14.308        SSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIARSALSVAKV
YNL021W            SSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIARSALSVAKV
Smik_14.310        SSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIARSALSVAKV
NDAI0G00650        SAGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNMAVVLEGGYNLDSIAISALSVAKI
NCAS0G03800        SSGFDAADGDSIGQCHVTPSCYGHMTHMLKSLAKGNLCVVLEGGYNLDAIARSALSVAKI
                   *:*                                                         

Kpol_1003.37       ----PHEKL---------------------------------------------------
TPHA0C03390        LIGEPPDEIPESDRDPKPGVLEMINK-VIRVQSKYWKCFRRKFGNFGGEYEN--AIESQI
KLLA0E08383g       LVGEPPDELPAPKKQPTPEAKKMIET-VIRTQSKYWSCFKNRHGNDGINFKD-AITSTLD
Kpol_1039.32       LIGEPPDELPAPDKDPKPEAIEMIDR-VIDLKSKYWKCFKRQITNSNCEYKG-PISESFF
TBLA0B06950        LIGEPPDELPDPLKDPKPEVIEMIDK-IIRLQSKYWKCFRRRHGNLGCNFKE-SINDSLI
ADL216C            LIGEPPDELPQPLKQPKPEAIVTIDMGLVKEQSKYWNCFKGRHGNDGINWREGAVNDSLT
Ecym_3324          LIGEPPDELPDPFKQPKPEAIATIET-VIREQAKYWDCFKSKHGNCGVNWKE-PVDESLT
SAKL0E07700g       LIGEPPDELPHPTQQPKPEAIETIET-VIRTQSKYWNCFKSTHSNDGCNFKE-EVTESTI
KLTH0G10340g       LIGEPPDELP-VVKQPKLEAVEVIDS-VIKTQSKYWKCFKSTHGNDGCSFKE-QATDTAI
Kwal_27.11537      LIGEPPDELP-VVKQPKPEAVEVIDA-VIKMQSRYWQCFKSTHANDGCSFKE-PVTETLL
KAFR0H03320        LIGEPPDELPDPLKDPKPEALEMIYK-VIKIQSKYWKCFKRRHGNYNINFSE-VASDTLA
KNAG0H02010        LIGEPPEELLDPVKDPKPEAIEIINK-VIRLQSKYWKCFQRRHGNSGCTFEK-HMTESIS
CAGL0J03454g       LIGEPPDELPDPLREPKAEALEIIDK-VISLQSKYWKCFGKRYGNLGLPSEN-VVKALMM
ZYRO0A01870g       LIGEPPEELPDPSKNPKLEAIEMIDK-VIHVQSKYWKCFR-RLGNSGCNFKE-PVTESLI
TDEL0G02160        LIGEPPDELPDPTKDPKLEAIEMIDT-VIHTQSKYWKCFQRKFGNAGCNFSE-PVTETVI
Suva_14.326        LIGEPPDELPDPLSDPKPEVIEMIDK-VVRLQSKYWNCFRRRHANSGCNFNE-PINDSII
Skud_14.308        LIGEPPDELPDSLSDPKPEVIEMIDK-VIRLQSKYWNCFRRRHANSGCNFNE-PINDSII
YNL021W            LIGEPPDELPDPLSDPKPEVIEMIDK-VIRLQSKYWNCFRRRHANSGCNFNE-PINDSII
Smik_14.310        LIGEPPDELPDSSSDPKPEVIEMIDK-VIRLQSKYWNCFRRRHANSGCNFNE-PINDSIV
NDAI0G00650        LIGEPPDELPDVTRDPKPEVIEMIDK-VLRIQSKYWKCFKSKFGNAGCDFQE-QINNSIA
NCAS0G03800        LIGEPPDELPDPLRDPKPEAIEIIDK-VIRLQSKYWKCFKRRYGNAGCNFKD-EINESLI
                       * :::                                                   

Kpol_1003.37       ------------------------------------------------------------
TPHA0C03390        PKMFPLQDAIR-NAQLSHYYDDFGMISLSLPNLN--------------------------
KLLA0E08383g       TRNFPLQNAIR-EYQVSQLSSQFNFVQLPILDLN--------------------------
Kpol_1039.32       AKKFPIQDAIR-AQQIQYLTNDYNMVPLPLMNSN--------------------------
TBLA0B06950        SKNFPLQTAIR-NFQSKKLFDELNFLTLPIKNFQKNNMSTSTTNSINNKTTSTVISSTST
ADL216C            SKNFPLQKCCSPTTQFRRLAKEYKFVTLPLLNME--------------------------
Ecym_3324          FKNFPLQSAVR-QEQFRRLSKEYKFVTLPLLDME--------------------------
SAKL0E07700g       SKNFPLQQAIR-QEQLQQLSEKFGFVTLPLLNME--------------------------
KLTH0G10340g       NKNFPLQNAIR-QQQMRLLANEFRFVTLPLFKKE--------------------------
Kwal_27.11537      NRNFPLQTAIR-QQQVRLLTTEYNFVTLPLIKKE--------------------------
KAFR0H03320        TKTFPLQTAIR-QQQYYNLFKEYDFVKFPTANLK--------------------------
KNAG0H02010        TDNFPLQSAIR-QQQFSALSKEFGFVKFPLFEMK--------------------------
CAGL0J03454g       SKSFPLQTAIR-QEQFHQLSEDFGFVTLPLLNME--------------------------
ZYRO0A01870g       TKNFPLQKAIR-QEQFHQLEKEYGFVTLPVPKLE--------------------------
TDEL0G02160        SKSFPLQTAIR-QEQFRQLSKEYGFVTLPISKLE--------------------------
Suva_14.326        SKNFPLQKAIR-QQQLHYLSDEFNFVTLPLINME--------------------------
Skud_14.308        SKNFPLQKAIR-QQQLQYLSNEFSFVTLPLINMG--------------------------
YNL021W            SKNFPLQKAIR-QQQQHYLSDEFNFVTLPLVSMD--------------------------
Smik_14.310        SKNFPLQKAIR-QQQQHYLSDEFNLVTLPLINMD--------------------------
NDAI0G00650        TKNFPLQSAIR-QQQVRNLSKEFNFSELPIYKSE--------------------------
NCAS0G03800        SKNFPLQQAIR-EQQLNTLSQDFKFATLPLLKPE--------------------------
                                                                               

Kpol_1003.37       ------------------------------------------------------------
TPHA0C03390        ------------------------------------------------------------
KLLA0E08383g       ------------------------------------------------------------
Kpol_1039.32       ------------------------------------------------------------
TBLA0B06950        GTPGNSKEKNDTDDINGNNTTTETNHSSDSIVPPDGSTETKSSSINSKKLENSTTNIKTI
ADL216C            ------------------------------------------------------------
Ecym_3324          ------------------------------------------------------------
SAKL0E07700g       ------------------------------------------------------------
KLTH0G10340g       ------------------------------------------------------------
Kwal_27.11537      ------------------------------------------------------------
KAFR0H03320        ------------------------------------------------------------
KNAG0H02010        ------------------------------------------------------------
CAGL0J03454g       ------------------------------------------------------------
ZYRO0A01870g       ------------------------------------------------------------
TDEL0G02160        ------------------------------------------------------------
Suva_14.326        ------------------------------------------------------------
Skud_14.308        ------------------------------------------------------------
YNL021W            ------------------------------------------------------------
Smik_14.310        ------------------------------------------------------------
NDAI0G00650        ------------------------------------------------------------
NCAS0G03800        ------------------------------------------------------------
                                                                               

Kpol_1003.37       -------VLASQKIFKAETLVILVHDTPELWGDRDIITGVLDPSTSVLIDTSMKFIKWAA
TPHA0C03390        --LPKNSIICSSNFFKAKSLCVLLHDTPEVWGNRDIITGIIDPSTSIIFDSSLKFINWAI
KLLA0E08383g       --LPANTMLCTSGIQDSETLVVIVHDTPEIWSERDTQTGIIDPSSSIIVDNALKMINWAM
Kpol_1039.32       --LPEDTVMCSTDILQSNVAIIYVHDTPEIWSKRDAIAGVIDSSASLYMDASLQFYDWAL
TBLA0B06950        SPLNENTILCSPAIIRSKTLVVLVHDSPDLWTKRDVSTGVVDLSSTIIIDSTLDFIKWSL
ADL216C            --LPSDTIICSPNIHTTDAIIICVHDTPEIWAQRDSLTGHIDPSTSIIVDTTVSVINWAL
Ecym_3324          --LSGDTIICSPNIHETDTLIICVHDTPEVWAKRNPLTGYIDPSTSIIVDTTLSITNWAL
SAKL0E07700g       --VPQDTVICSPNIYDAETVVVCVHDTPEIWAQRNPITGTIDPSTSIIVDTTLDIIKWSL
KLTH0G10340g       --LPDDTAICSPNIYDASAIIVCVHDTPSIWAQRSRATGTIDPSTSIIVDTTLDVIKWAS
Kwal_27.11537      --LPDDTALCSPNIYDSQSIIVCVHDTPEIWAQRSRATGTIDPSTSIIVDTTLDVIKWAS
KAFR0H03320        --LPDDLILCSPNIHTAETVIIIVHDTPQIWLEKDIISNTVDPCSSIIIDSTLDFLKWAH
KNAG0H02010        --LSDDTVICSPEVYNKDTIIILVRDTPEIWAKRDVIQGTIDPSASIITDAALAFIKWAM
CAGL0J03454g       --VPQDSVICSPNLFNETTILVVVHDTPEIWAKRNVITGTIDPSTSLVVDSGAEFIKWGL
ZYRO0A01870g       --LPEDTVLCSPDVFQESTVIIFVHDTPEIWAKRDVITGMIDPSTSITVDSPLDFIKWSL
TDEL0G02160        --IPDDSVLCSPEVFQQSTIVIIVHDTPEIWAKRDVITGVIDPSTSIIVDSPLDFTKWCM
Suva_14.326        --LPDNIVLCTPNVSESSTLLVVVHDTSDVWAKRNVISGTIDLSSSVVIDNCLDFIKWGL
Skud_14.308        --LPDNTALCTPNVFESNALLVVVHDTSDVWAKRNVISGTIDLSSSVIIDNCIDFIKWGL
YNL021W            --LPDNTVLCTPNISESNTIIIVVHDTSDIWAKRNVISGTIDLSSSVIIDNSLDFIKWGL
Smik_14.310        --LPDNTVLCTPNVYESTTLLVVVHDTSDIWAKRNVISGTIDLSSSVIIDNCLDFIKWGL
NDAI0G00650        --LPEDTILCSSNIYESNTIIICVHDTPEIWAKRDAIQGTIDPSSSIIVDSSLDMIKWAI
NCAS0G03800        --LPKDTVLCSPNVYQSKTVIICAHDTPEIWAKRDVIQGTIDPSSSIIVDSTLDFIKWAN
                           :.:  .       :  .*:..:* ...   . :* .:::  *    . .*  

Kpol_1003.37       DRNYSILDINIPKSNL----EKETFSSSKAANEIMLSLWDNHLQYISTLTKICFIGIGES
TPHA0C03390        ERETAVIDINIPRSAF----EADNYSSNLLSQDVMISLWDNHFKYIESLEKLCFIGIGEA
KLLA0E08383g       DRRYGIIDINIPQTLF----EHANYPGVASSQEILIYLWDNYLKFFQNLQKVAFIGIGDA
Kpol_1039.32       DRGYGIIDVNIPQTLY----EQDNYSASLTAQEVLIKLWDNNLKYFPNVNKIAYIGVGEA
TBLA0B06950        DRNYGVIDINIPQTLF----EQDNYSSILAAQETLLSFWDNYLKYFPYIEKIVFIGFGDA
ADL216C            GRNYGVIDINIPQSLF----EQDNYSAVLSSQEVVTYLWDSYLKTFPHLARVAFVGIGDA
Ecym_3324          GRSYGIIDINIPQSLF----ELDNYSAVLTSQEVLSYLWDHYLKFFAQLTRVAFVGIGDA
SAKL0E07700g       QRKYSVIDVNIPQSLF----EQDNYSAMITSQEVLVYIWDNYLKYFPSLAKVAFIGVGDA
KLTH0G10340g       SRNYGVIDINIPQSLH----EQDNYSAVITAQEVLVHIWDNYLKYFPSLNRVAFVAIGDA
Kwal_27.11537      KRNYGVIDINIPQSLH----EQDNYSAVLTAQEVLVYIWDSYLKYFTSLSKVAFVSIGDA
KAFR0H03320        NRKYGIIDVNIPQSLIYGDENPDNYSSLINAQEILLFLWDNHIKFLNEVNKIAFIGVGDS
KNAG0H02010        ERNYGVIDVNIPQSLF----EQDNYSAMITAQEVMSFMWDNYIRFFGSASKIAFVGVGDA
CAGL0J03454g       ERKYGIMDINIPQSLF----EQENYTAVLTSQEILIYIWDNYLKFFPSLTKVAFIGIGDA
ZYRO0A01870g       ARKYGVIDVNIPQSLF----EQDNYSAMITSQEVLIYLWDNFVKYFPSLSKVAFVGVGDA
TDEL0G02160        NRKYGVIDVNIPQSLF----EQDNYSAMITSQEVLLYIWDNYIKYFPSLAKVAFVGFGDA
Suva_14.326        DRKYGIIDVNIPLTLF----EADNYSGMITSQEVLIYLWDNYIKYFPAVAKIAYIGIGDS
Skud_14.308        DRKYGIIDVNIPLTLF----EADNYSGMITSQEVLIYLWDNYIKYFPNVAKIAFIGIGDS
YNL021W            DRKYGIIDVNIPLTLF----EPDNYSGMITSQEVLIYLWDNYIKYFPSVAKIAFIGIGDS
Smik_14.310        DRKYGIIDVNIPLSLF----EPDNYSGMITSQEVLIYLWDNYIKYFPAVAKIAFVGIGDS
NDAI0G00650        ERKYGVIDINIPQNLL----EQENYYSIITAQEVLINLWDNYLKYFPNVNKIAFVGIGDA
NCAS0G03800        EKKYGVIDINIPQNLF----EQENYSAIVTSQEVLTYIWDNYLKYFPNVEKVAFIGIGDA
                    .  .::*:*** .      :  .: .   ::: :  :**  .. :    .: ::..*::

Kpol_1003.37       YQGIVHLIGERDLRVLSKAVINFVGNFPLKSLSSNFDETMVDWYFKNSLVFTNDSHNCWK
TPHA0C03390        TSGIVHLLGKRDTRTVTKAAINFVGSSSLKPIVPSLDESLGDWYFKNSLVFTDHFHGCWS
KLLA0E08383g       YGGIVHLLGHRDTRSVVKCAISFLDKKPLKVMVPLIDETLGDWYFKNSLVFTSSTHSCWG
Kpol_1039.32       YSGLVHLLGHRDTRSVVKSVIGFVGKKPLKALVPLVEESLADWYFKTSLLFADKNHSCWG
TBLA0B06950        HAGIVHLLGHRDTRSVVKSVINFLGKKPLKALVPLVDETLSDWYFKNSLVFTDKNHPFWA
ADL216C            YSGFVHLLGHRDTRSVVKCAIAFADKKQLRPLVPLVDESLGDWYFKNSLVFTSTYHPCWG
Ecym_3324          YSGFVHLLGHRDTRSIVKCAISFTDKKQLRPLVPLVDESISDWYFKNSLIFTSKYHSCWG
SAKL0E07700g       YSGIVHLLGHRDTRSVVKAAVSFVDTKPLKSLVPLVDESLGNWYFKNSLVFTSKNHSCWG
KLTH0G10340g       HSGVVHLLGHRDTRSVVKSAVSFVDQRPLRPLIPLVDETLADWYFKNSLVFASAEHTCWG
Kwal_27.11537      YSGVVHLLGHRDTRNVVKAAISFIDQRPLRPLVPLVDESLADWYFKNSLVFASAGHTCWG
KAFR0H03320        VSGVVHLLGHRDTKERVKAVINFMADKQLKPLVPLVDESLSDWYFKNSLVFSNRTHPCWG
KNAG0H02010        CSGIVHLLGHRDTRSKVKSVINFIAQKTLKPLIPLVDETLGDWYFKNSLVFSDKNHACWG
CAGL0J03454g       SAGIVHLLGHRDTRSVVKSVVSFIGKKSLKPLVPLVNESLGDWYFKNSLVFTDHSHSCWG
ZYRO0A01870g       YSGIVHLLGHRDTRSVVKAVINFVGRKQLKPLVPLVDESLGDWYFKNSLVFSDRNNPCWV
TDEL0G02160        YAGIVHLLGHRDTRATVKAVVSFIGRKQLKPLVPLVDESLSDWYFKNSLIFTDKNHPCWA
Suva_14.326        YSGIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLTEWYFKNSLVFTNNSHQCWK
Skud_14.308        HSGIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWK
YNL021W            YSGIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWK
Smik_14.310        YSGIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWK
NDAI0G00650        YSGIVHLLGHRDTRSVVKAVINFVGQKQLKPLVPLVDESLGEWYFKNSLVFSNKNHIYWG
NCAS0G03800        YSGIVHLLGHRDTRSVVKSVINFIAQKQLRALVPLVDESLSDWYFKNSLVFSDKSHTYWG
                     *.***:* ** .   * .: *     *. : . .:*:: :****.**:*:.  :  * 

Kpol_1003.37       E--SEEKRPRKKFGRVLKSDSDGIISIINERFDEATDFILDAFEEWSDEESD
TPHA0C03390        E---NDKKPRKKYGRVLRCDTDGIHNIIEERFEEATDFILDAFDEWSDTEDE
KLLA0E08383g       STANENKKLRKKYGRVLKADCDGMTNIFDERFEEATDFILDSFEEWSESE--
Kpol_1039.32       E--NDSKKPRKRYGRVLRCDSDGIFSLIEERFEEATDFIIDSLDEWTEE---
TBLA0B06950        D--NENKKPRKKFGRVLRSQQDGIANLIEERFDEATDFILDSFEEWSDEE--
ADL216C            TDGNDSKKPRKKFGRVLRWTCDGMNNIVEERLEEATDFILDSFEEWSESE--
Ecym_3324          TEGNDSKKPRKKFGRVLKCNSDGMNNILEERFEEATDFILDSFEEWSDSE--
SAKL0E07700g       TDGNENKKPRKRFGRVLKCDTTGMNNIVEERFQEATDFILDSFEEWSDSE--
KLTH0G10340g       NDGNENKKPRKKFGRVLKCDSDGINNILEERFEEATDFILDTFEEWSDSE--
Kwal_27.11537      NDGAENKKPRKKFGRVLKCNSDGLNNILEERFEEATDFILDTFEEWSDSE--
KAFR0H03320        D--KENKKPRKKYGRVLRCDTDGLNSTIEERFDEATDFILDSFEEWSDSE--
KNAG0H02010        DNENENKKPRKKFGRVLRCNSDGLTNIIEERFEEATDFMLDSFEEWSESD--
CAGL0J03454g       D--NENRKPRKKFGRVLRCDAEGMNNIIEERLEESTDFILDSFEEWSDSE--
ZYRO0A01870g       D--NENKKPRRKFGRVLRCESDGINNNMEERFDEATDFILDSFEEWSDSE--
TDEL0G02160        D--NESKKPRKKFGRVLRCDTDGLNSNMEERFEEATDFILDLFEEWSDSE--
Suva_14.326        E--NESRKPRKKFGRVLRCDTDGLSNTVEERFEEATDFILDSFEEWSDEE--
Skud_14.308        E--NESRKPRKKFGRVLRCDTDGLSNTIEERFEEATDFILDSFEEWSDDE--
YNL021W            E--NESRKPRKKFGRVLRCDTDGLNNIIEERFEEATDFILDSFEEWSDEE--
Smik_14.310        E--NESRKPRKKFGRVLRCDTDGLNNTIEERFEEATDFILDSFEEWSDEE--
NDAI0G00650        D--KENKKPRKKYGRVLRCDTDGISNIMEERFEEATDFILDSFEEWSDSE--
NCAS0G03800        D--KENKKPRKKYGRLLRCETDGINNIVEERFEEATDFILDSFEEWSDSE--
                       :... *..:**:*.    *: . .:**::*:***::* ::**::    

FASTA FORMAT for MUSCLE Version 3.6

>Kpol_1003.37
--------------MSFNGGAHSLKRILHDTVTEDVKPEMATGVNGGKETIMNGNSKNDH
FKKMPKRQVIVPIRQPKLHYTPLKTGLCYDVRMRYHAKIFTSNFEYIDPHPEDPRRVYRI
YKILAENGLIKDENLSGLDDIGDIMLKIPVRTATEEEILAVHTREHLDFIENIESQSREE
LIKLTEKADSVYYNNDSYYSAKLSCGGVIEACRAVVEGRVKNSLAIVRPPGHHAEPQAAG
GFCLFSNVSVAARSILRTYPESVRKILILDWDIHHGNGTQKAFYEDENVLYISLHRYEST
AFYPGTIHGRYDQVGEGKGEGFNCNITWPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIV
SSGXXXMK----------------------------------------------------
----PHEKL---------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------VLASQKIFKAETLVILVHDTPELWGDRDIITGVLDPSTSVLIDTSMKFIKWAA
DRNYSILDINIPKSNL----EKETFSSSKAANEIMLSLWDNHLQYISTLTKICFIGIGES
YQGIVHLIGERDLRVLSKAVINFVGNFPLKSLSSNFDETMVDWYFKNSLVFTNDSHNCWK
E--SEEKRPRKKFGRVLKSDSDGIISIINERFDEATDFILDAFEEWSDEESD
>TPHA0C03390
-----------------MSEQI------------GDKRKLKDESEF---PSVSIGDEGKV
IQVLPKRPVIVPTQKPNLHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI
YKILAENGLINDPSLTGVSDIGDLMLKIPVREATKEEILDVHTEEHMQFLESTEKMTREE
LLSKTEKGDSVYLNNDSYISARLSCGGAIEACKAVVEGRVKNALAIVRPPGHHAEPQAAG
GFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELG
KFYPGFPEGNYDKVGDGKGKGFNCNITWPVKGVGDVEYIWAFEQIVIPMAREFRPDLVIV
SSGFDAAHGDTIGQCHVTPNCYGYMTHMLKSLARGNLCVVLEGGYNLDSISNSALAVAKI
LIGEPPDEIPESDRDPKPGVLEMINK-VIRVQSKYWKCFRRKFGNFGGEYEN--AIESQI
PKMFPLQDAIR-NAQLSHYYDDFGMISLSLPNLN--------------------------
------------------------------------------------------------
--LPKNSIICSSNFFKAKSLCVLLHDTPEVWGNRDIITGIIDPSTSIIFDSSLKFINWAI
ERETAVIDINIPRSAF----EADNYSSNLLSQDVMISLWDNHFKYIESLEKLCFIGIGEA
TSGIVHLLGKRDTRTVTKAAINFVGSSSLKPIVPSLDESLGDWYFKNSLVFTDHFHGCWS
E---NDKKPRKKYGRVLRCDTDGIHNIIEERFEEATDFILDAFDEWSDTEDE
>KLLA0E08383g
-----------------MESKKPAEEP-------LERPSIKEIKNE-------GTAYTLP
SKDESQRPVIVPPTKPKIRYSLLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRV
YKILAENGLIQDPTLSGADSIGDLMVKVPVREAEEEEILQVHSRQHLDFISQTEQLERES
LLKETEGGDSVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNSIAVVRPPGHHAEPEIAG
GFCLFSNVAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLG
KYYPGTIHGNYDQTGEGKGEGFNCNITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLI
SSGFDAADGDTIGQCHVTPACYGHMTHMLLSLAKGNLCVVLEGGYNLDSIAKSALGVCKV
LVGEPPDELPAPKKQPTPEAKKMIET-VIRTQSKYWSCFKNRHGNDGINFKD-AITSTLD
TRNFPLQNAIR-EYQVSQLSSQFNFVQLPILDLN--------------------------
------------------------------------------------------------
--LPANTMLCTSGIQDSETLVVIVHDTPEIWSERDTQTGIIDPSSSIIVDNALKMINWAM
DRRYGIIDINIPQTLF----EHANYPGVASSQEILIYLWDNYLKFFQNLQKVAFIGIGDA
YGGIVHLLGHRDTRSVVKCAISFLDKKPLKVMVPLIDETLGDWYFKNSLVFTSSTHSCWG
STANENKKLRKKYGRVLKADCDGMTNIFDERFEEATDFILDSFEEWSESE--
>Kpol_1039.32
------------------------------------------------------------
-------------MMSSLSYTPLKTGLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRI
YKILAENGLIRDPALSGIDDIGDLMCKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDE
LLSKTELGDSVYFNNDSYFSAKLSCGGAIEACKAIVDGKVKNSLAIVRPPGHHSEPEVAG
GFCLFSNVAVATKNILKNYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELG
KYYPGTIHGQYDQVGEGKGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIV
SSGFDAADGDTIGKCHVTPSCYGHMTHMLKSLANGKLCVVLEGGYNLDAIARSALAVAKV
LIGEPPDELPAPDKDPKPEAIEMIDR-VIDLKSKYWKCFKRQITNSNCEYKG-PISESFF
AKKFPIQDAIR-AQQIQYLTNDYNMVPLPLMNSN--------------------------
------------------------------------------------------------
--LPEDTVMCSTDILQSNVAIIYVHDTPEIWSKRDAIAGVIDSSASLYMDASLQFYDWAL
DRGYGIIDVNIPQTLY----EQDNYSASLTAQEVLIKLWDNNLKYFPNVNKIAYIGVGEA
YSGLVHLLGHRDTRSVVKSVIGFVGKKPLKALVPLVEESLADWYFKTSLLFADKNHSCWG
E--NDSKKPRKRYGRVLRCDSDGIFSLIEERFEEATDFIIDSLDEWTEE---
>TBLA0B06950
-------------------MSIKVEDNSG-----GLKRNHEELETG--TKNVSTNNILNK
NPPNYKKQIIVPVQAPKIHYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI
YKILAENGLINDPTLSGVDNIGDLMLKLPIREATMNEILEVHSIEHFKYLEKTSNDNREQ
LLKETENGDSVYFNNDSFQSAKLSCGGAIEACKAVVEGRVKNAMAVVRPPGHHSEPESAG
GFCLFSNVAVATKNILKNYPESVRKVLILDWDIHHGNGTQKAFYNDDNVLYISLHRFELG
KYYPGTIQGQYDQTGEGKGEGFNCNITWPIGAVGDAEYMWAFEQVVMPMSREFQPDLVII
SSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIARSALSVSKI
LIGEPPDELPDPLKDPKPEVIEMIDK-IIRLQSKYWKCFRRRHGNLGCNFKE-SINDSLI
SKNFPLQTAIR-NFQSKKLFDELNFLTLPIKNFQKNNMSTSTTNSINNKTTSTVISSTST
GTPGNSKEKNDTDDINGNNTTTETNHSSDSIVPPDGSTETKSSSINSKKLENSTTNIKTI
SPLNENTILCSPAIIRSKTLVVLVHDSPDLWTKRDVSTGVVDLSSTIIIDSTLDFIKWSL
DRNYGVIDINIPQTLF----EQDNYSSILAAQETLLSFWDNYLKYFPYIEKIVFIGFGDA
HAGIVHLLGHRDTRSVVKSVINFLGKKPLKALVPLVDETLSDWYFKNSLVFTDKNHPFWA
D--NENKKPRKKFGRVLRSQQDGIANLIEERFDEATDFILDSFEEWSDEE--
>ADL216C
-----------------MEERT------------QQKRKLEEGSPD----GEANGGQASR
KAIVQKRPVIVPPVRPKISYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI
YKILAENGLIEDPTLSGIDEIGELMQKIPVREATEEEILTVHSKEHVEFLKTTNTMDREQ
LLKETEAGDSVYYNNDSLISARLSCGGAIEACKAVVEGRVKNAMAVVRPPGHHAEPGVAG
GFCLFSNVAVAAQNILKNYPESVRRVMILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELG
KYYPGTSYGNYDQCGDGKGEGFNCNIPWSCSGVGDAEYMWAFEQVVIPMGREFQPDLVII
SSGFDAADGDTIGQCHVSPACYGHLTHMLKSLARGNMCVVLEGGYNLDSIAKSALGVAKV
LIGEPPDELPQPLKQPKPEAIVTIDMGLVKEQSKYWNCFKGRHGNDGINWREGAVNDSLT
SKNFPLQKCCSPTTQFRRLAKEYKFVTLPLLNME--------------------------
------------------------------------------------------------
--LPSDTIICSPNIHTTDAIIICVHDTPEIWAQRDSLTGHIDPSTSIIVDTTVSVINWAL
GRNYGVIDINIPQSLF----EQDNYSAVLSSQEVVTYLWDSYLKTFPHLARVAFVGIGDA
YSGFVHLLGHRDTRSVVKCAIAFADKKQLRPLVPLVDESLGDWYFKNSLVFTSTYHPCWG
TDGNDSKKPRKKFGRVLRWTCDGMNNIVEERLEEATDFILDSFEEWSESE--
>Ecym_3324
-----------------MNQES------------KQKRKLEIDGNDTIGVENMKTAVSKL
TVAQQKRPIIVPVVKPKIHYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI
YKILAENGLIEDPTLSGVDDIGNLMLKIPIREATEDEILLVHSKEHVEFLKTTNTMSREQ
LLKETEAGDSVYYNNDSLVSAKLSCGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEVAG
GFCLFSNVAVAARNILKNYPESVRKVMILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELG
RYYPGTEYGNYNQSGEGKGEGFNCNIPWSCGGVGDAEYMWAFEQIVIPMGREFQPDLVII
SSGFDAADGDTIGQCHVSPACYGHMTHMLKSLAKGNMCVVLEGGYNLDSIAKSALGVVKV
LIGEPPDELPDPFKQPKPEAIATIET-VIREQAKYWDCFKSKHGNCGVNWKE-PVDESLT
FKNFPLQSAVR-QEQFRRLSKEYKFVTLPLLDME--------------------------
------------------------------------------------------------
--LSGDTIICSPNIHETDTLIICVHDTPEVWAKRNPLTGYIDPSTSIIVDTTLSITNWAL
GRSYGIIDINIPQSLF----ELDNYSAVLTSQEVLSYLWDHYLKFFAQLTRVAFVGIGDA
YSGFVHLLGHRDTRSIVKCAISFTDKKQLRPLVPLVDESISDWYFKNSLIFTSKYHSCWG
TEGNDSKKPRKKFGRVLKCNSDGMNNILEERFEEATDFILDSFEEWSDSE--
>SAKL0E07700g
-------------MTESTATVTGNDSAVEVKMEDSLKRKVDTMEDE----------VESR
KRSTGTLPVIVPEVPPRIHYTQLKTGLCYDVRMRYHAKIYTSYFEYIDPHPEDPRRIYRI
YKILAENGLIRDPTLSGVDEIGELMLKIPVREATAEEILQVHTKEHLAFLEKTPKMTREQ
LLKETETGDSVYFNNDSLLSAKLSCGGAIEACKAVVEGRVKNALAVIRPPGHHAEPEIAG
GFCLFSNVAVAAQNILKNYPESVRRIMILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELG
KYYPGTVHGNYEQTGEGKGEGFNCNIPWPYGGLGDAEYMWAFQQVVMPMGREFQPDLVII
SSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVLEGGYNLDSIAKSALGVAKI
LIGEPPDELPHPTQQPKPEAIETIET-VIRTQSKYWNCFKSTHSNDGCNFKE-EVTESTI
SKNFPLQQAIR-QEQLQQLSEKFGFVTLPLLNME--------------------------
------------------------------------------------------------
--VPQDTVICSPNIYDAETVVVCVHDTPEIWAQRNPITGTIDPSTSIIVDTTLDIIKWSL
QRKYSVIDVNIPQSLF----EQDNYSAMITSQEVLVYIWDNYLKYFPSLAKVAFIGVGDA
YSGIVHLLGHRDTRSVVKAAVSFVDTKPLKSLVPLVDESLGNWYFKNSLVFTSKNHSCWG
TDGNENKKPRKRFGRVLKCDTTGMNNIVEERFQEATDFILDSFEEWSDSE--
>KLTH0G10340g
-----------------MTESAEVKQEEPSEQINGLKRDHESATLN---------DGTGN
QASVAKRPTIVPACRPKLHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI
YKILAENGLIDDPTLSGVDSIGDLMLKIPVREATDEEILQVHTKEHLEFISKTTSMTRDQ
LLKETEKGDSVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEVAG
GFCLFSNVAVAAQNILKNYPESVRKIMVLDWDVHHGNGTQKAFYDDDRVLYISLHRHELG
KYYPGTIHGNSDRVGEGKGEGFNCNIPWPWKGVGDSEYLWAFEQVIMPMGREFRPDLVII
SSGFDAADGDTVGQCHVTPSCYGHMTHMLKSLARGNLCAVLEGGYSLDSIAKSALAVAKV
LIGEPPDELP-VVKQPKLEAVEVIDS-VIKTQSKYWKCFKSTHGNDGCSFKE-QATDTAI
NKNFPLQNAIR-QQQMRLLANEFRFVTLPLFKKE--------------------------
------------------------------------------------------------
--LPDDTAICSPNIYDASAIIVCVHDTPSIWAQRSRATGTIDPSTSIIVDTTLDVIKWAS
SRNYGVIDINIPQSLH----EQDNYSAVITAQEVLVHIWDNYLKYFPSLNRVAFVAIGDA
HSGVVHLLGHRDTRSVVKSAVSFVDQRPLRPLIPLVDETLADWYFKNSLVFASAEHTCWG
NDGNENKKPRKKFGRVLKCDSDGINNILEERFEEATDFILDTFEEWSDSE--
>Kwal_27.11537
-----------------MTEAVGIKQEDSLKQENGFKRDAENALLE---------EENGG
SETKVKRPVIVPACRAKLHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI
YKILAENGLIIDPTLSGVDDIGDLMLKIPAREATDEEILQVHTPEHLEFLSKTTSMTREQ
LLKETEKGDSVYFNNDSYLSAKLSCGGAIEACRAVVEGRVKNALAVVRPPGHHAEPDLAG
GFCLFSNVAVAAQNILKNYPESVKKIMILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELG
KYYPGTIHGNADRVGEGKGEGFNCNIPWPWKGVGDAEYIWAFEQVVLPMGREFQPDLVII
SSGFDAADGDTVGQCHVTPSCYGHMTHMLKSLARGNICAVLEGGYSLDSIAKSALGVAKV
LIGEPPDELP-VVKQPKPEAVEVIDA-VIKMQSRYWQCFKSTHANDGCSFKE-PVTETLL
NRNFPLQTAIR-QQQVRLLTTEYNFVTLPLIKKE--------------------------
------------------------------------------------------------
--LPDDTALCSPNIYDSQSIIVCVHDTPEIWAQRSRATGTIDPSTSIIVDTTLDVIKWAS
KRNYGVIDINIPQSLH----EQDNYSAVLTAQEVLVYIWDSYLKYFTSLSKVAFVSIGDA
YSGVVHLLGHRDTRNVVKAAISFIDQRPLRPLVPLVDESLADWYFKNSLVFASAGHTCWG
NDGAENKKPRKKFGRVLKCNSDGLNNILEERFEEATDFILDTFEEWSDSE--
>KAFR0H03320
-----------------MQSNMTSSAMEG-----STKRKQEEENLE-------------S
LNVVPKRQVIVPTKKPQVHYIPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI
YKILAENGLINDTMLSGVDDIGDIMLKIPVREATADEILEVHSREHLEFLESTTTMNREV
LLKETEKGDSVYFNNDSYMSAKLSCGGAIEACKAVVEGKVKNALAVVRPPGHHSEPESSG
GFCLFSNVAVAAKNILKNYPESVRKIMILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAG
KYYPGTVQGQYDQCGEGKGEGFNCNITWPTGGVGDAEYMWAFEQIVMPMGREFQPDLVII
SSGFDAADGDVIGQCHVTPSCYGHMTHMLKSLARGNLVVVLEGGYNLDSIAISALSVAKT
LIGEPPDELPDPLKDPKPEALEMIYK-VIKIQSKYWKCFKRRHGNYNINFSE-VASDTLA
TKTFPLQTAIR-QQQYYNLFKEYDFVKFPTANLK--------------------------
------------------------------------------------------------
--LPDDLILCSPNIHTAETVIIIVHDTPQIWLEKDIISNTVDPCSSIIIDSTLDFLKWAH
NRKYGIIDVNIPQSLIYGDENPDNYSSLINAQEILLFLWDNHIKFLNEVNKIAFIGVGDS
VSGVVHLLGHRDTKERVKAVINFMADKQLKPLVPLVDESLSDWYFKNSLVFSNRTHPCWG
D--KENKKPRKKYGRVLRCDTDGLNSTIEERFDEATDFILDSFEEWSDSE--
>KNAG0H02010
------------------MTEPSVKRENP-----DSQKPAESSTHS--------------
-----KRQMIVAPCAPKLRYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI
YKILAENGLITDPMLSGIDDIGDLMLKIPVREATSQEVLEVHSKEHLEFIESVTKMSHDE
LLKSTETGDSVYFNNDSSSSAKLSCGGAIEACKAVVEGRVKNAFAVVRPPGHHSEPESAG
GFCLFSNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELG
KYYPGTAQGHYDKTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMSREFRPDLVII
SAGFDAADGDTIGQCHVSPSCYGHMTHMLKSLANGNLCVVLEGGYNLDAIARSALSVAKV
LIGEPPEELLDPVKDPKPEAIEIINK-VIRLQSKYWKCFQRRHGNSGCTFEK-HMTESIS
TDNFPLQSAIR-QQQFSALSKEFGFVKFPLFEMK--------------------------
------------------------------------------------------------
--LSDDTVICSPEVYNKDTIIILVRDTPEIWAKRDVIQGTIDPSASIITDAALAFIKWAM
ERNYGVIDVNIPQSLF----EQDNYSAMITAQEVMSFMWDNYIRFFGSASKIAFVGVGDA
CSGIVHLLGHRDTRSKVKSVINFIAQKTLKPLIPLVDETLGDWYFKNSLVFSDKNHACWG
DNENENKKPRKKFGRVLRCNSDGLTNIIEERFEEATDFMLDSFEEWSESD--
>CAGL0J03454g
-------------------MGVELKQEPG-----ESKRKLEDDVAS--------------
--QDVKRPVIVPTRKAQIHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI
YKILAENGLINDPTLSGVNDIGDLMLKIPIRAATAEEILEVHSKEHLEFIEKTEKMNREE
LLKETEKGDSVYFNNDSYATSRLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPEAAG
GFCLFSNVAVAAKNILKNYPESVRRILILDWDVHHGNGTQKAFYDDDRVLYISLHRFELG
KYYPGTIQGQYDQIGEGKGKGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFQPDLVII
SSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAISALSVAKI
LIGEPPDELPDPLREPKAEALEIIDK-VISLQSKYWKCFGKRYGNLGLPSEN-VVKALMM
SKSFPLQTAIR-QEQFHQLSEDFGFVTLPLLNME--------------------------
------------------------------------------------------------
--VPQDSVICSPNLFNETTILVVVHDTPEIWAKRNVITGTIDPSTSLVVDSGAEFIKWGL
ERKYGIMDINIPQSLF----EQENYTAVLTSQEILIYIWDNYLKFFPSLTKVAFIGIGDA
SAGIVHLLGHRDTRSVVKSVVSFIGKKSLKPLVPLVNESLGDWYFKNSLVFTDHSHSCWG
D--NENRKPRKKFGRVLRCDAEGMNNIIEERLEESTDFILDSFEEWSDSE--
>ZYRO0A01870g
-----------------MNTDNPVKQEDE-----GSKRKLEESPNG---PVEKKPNVASV
SNGRQKRQIIVPACEPKIHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI
YKILAENGLINDPTLSGEDDIGELMLKIPVREATVEELLQVHTKEHLEFIEKTSQMNREE
LLKETETGDSVYFNSDSYSAAKLPCGGAIEACKAVVEGRVKNALAVIRPPGHHAEPEMAG
GFCLFSNVAVAAQNILKNYPESVRRILILDWDIHHGNGTQKAFYNDDRVLYISLHRFELG
KYYPGTIHGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMLAFEQIVMPMAREYRPDLVII
SSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVALEGGYNLDAIATSALSVAKI
LIGEPPEELPDPSKNPKLEAIEMIDK-VIHVQSKYWKCFR-RLGNSGCNFKE-PVTESLI
TKNFPLQKAIR-QEQFHQLEKEYGFVTLPVPKLE--------------------------
------------------------------------------------------------
--LPEDTVLCSPDVFQESTVIIFVHDTPEIWAKRDVITGMIDPSTSITVDSPLDFIKWSL
ARKYGVIDVNIPQSLF----EQDNYSAMITSQEVLIYLWDNFVKYFPSLSKVAFVGVGDA
YSGIVHLLGHRDTRSVVKAVINFVGRKQLKPLVPLVDESLGDWYFKNSLVFSDRNNPCWV
D--NENKKPRRKFGRVLRCESDGINNNMEERFDEATDFILDSFEEWSDSE--
>TDEL0G02160
--------------MTISMDCDIVKPENDTTL--QVKRKMEEQNDG---LDPKKSQLART
QNGAAGKRVIVPACAPNLHYTPLKTALCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRV
YKILAENGLINDPTLSGIDEIGDLMLKIPVREATDEEILEVHSKENLEFVERSSRMKREE
LLKETEKGDSVYFNNDSYVSAKLSCGGVIDACKAVVEGRVKNALAVVRPPGHHAEPEAPG
GFCLFSNVAVAAQNILKQYPESVRRILILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMG
KYYPGTINGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMLAFEQIVMPMAREFQPDLVII
SSGFDAADGDTIGQCHVTPSCYGQMTHMLKSLARGNLCVALEGGYNLDAIAISALSVAKV
LIGEPPDELPDPTKDPKLEAIEMIDT-VIHTQSKYWKCFQRKFGNAGCNFSE-PVTETVI
SKSFPLQTAIR-QEQFRQLSKEYGFVTLPISKLE--------------------------
------------------------------------------------------------
--IPDDSVLCSPEVFQQSTIVIIVHDTPEIWAKRDVITGVIDPSTSIIVDSPLDFTKWCM
NRKYGVIDVNIPQSLF----EQDNYSAMITSQEVLLYIWDNYIKYFPSLAKVAFVGFGDA
YAGIVHLLGHRDTRATVKAVVSFIGRKQLKPLVPLVDESLSDWYFKNSLIFTDKNHPCWA
D--NESKKPRKKFGRVLRCDTDGLNSNMEERFEEATDFILDLFEEWSDSE--
>Suva_14.326
------------------MDSATVKNEVLETPDQDLKHKLEGMKEE---------QNSLS
TTSKNKRQVIVPACTPKLHYTPLRTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI
YKILAENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREQ
LLKETEKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAG
GFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIG
KYYPGTIQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVII
SSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAISALSVAKV
LIGEPPDELPDPLSDPKPEVIEMIDK-VVRLQSKYWNCFRRRHANSGCNFNE-PINDSII
SKNFPLQKAIR-QQQLHYLSDEFNFVTLPLINME--------------------------
------------------------------------------------------------
--LPDNIVLCTPNVSESSTLLVVVHDTSDVWAKRNVISGTIDLSSSVVIDNCLDFIKWGL
DRKYGIIDVNIPLTLF----EADNYSGMITSQEVLIYLWDNYIKYFPAVAKIAYIGIGDS
YSGIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLTEWYFKNSLVFTNNSHQCWK
E--NESRKPRKKFGRVLRCDTDGLSNTVEERFEEATDFILDSFEEWSDEE--
>Skud_14.308
------------------MDSARVKNEVLENPDHDLKRTLENTKED---------QNSLS
TTSRNKRQVIVPACTPKIHYSPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI
YKILAENGLINDPTLSGVDDIGDLMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREQ
LLKETEKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAG
GFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMG
KYYPGTIQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVII
SSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIARSALSVAKV
LIGEPPDELPDSLSDPKPEVIEMIDK-VIRLQSKYWNCFRRRHANSGCNFNE-PINDSII
SKNFPLQKAIR-QQQLQYLSNEFSFVTLPLINMG--------------------------
------------------------------------------------------------
--LPDNTALCTPNVFESNALLVVVHDTSDVWAKRNVISGTIDLSSSVIIDNCIDFIKWGL
DRKYGIIDVNIPLTLF----EADNYSGMITSQEVLIYLWDNYIKYFPNVAKIAFIGIGDS
HSGIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWK
E--NESRKPRKKFGRVLRCDTDGLSNTIEERFEEATDFILDSFEEWSDDE--
>YNL021W
------------------MDSVMVKKEVLENPDHDLKRKLEENKEE---------ENSLS
TTSKSKRQVIVPVCMPKIHYSPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI
YKILAENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREE
LLKETEKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAG
GFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMG
KYYPGTIQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVII
SSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIARSALSVAKV
LIGEPPDELPDPLSDPKPEVIEMIDK-VIRLQSKYWNCFRRRHANSGCNFNE-PINDSII
SKNFPLQKAIR-QQQQHYLSDEFNFVTLPLVSMD--------------------------
------------------------------------------------------------
--LPDNTVLCTPNISESNTIIIVVHDTSDIWAKRNVISGTIDLSSSVIIDNSLDFIKWGL
DRKYGIIDVNIPLTLF----EPDNYSGMITSQEVLIYLWDNYIKYFPSVAKIAFIGIGDS
YSGIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWK
E--NESRKPRKKFGRVLRCDTDGLNNIIEERFEEATDFILDSFEEWSDEE--
>Smik_14.310
------------------MDSEIVKKEAWENPDGNLKRRLEETKED---------QNSLS
TTSNNKRQVIVPACTPKIHYSPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI
YKILAENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREQ
LLKETEKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAG
GFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMG
KYYPGTIQGQYDQAGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVII
SSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIARSALSVAKV
LIGEPPDELPDSSSDPKPEVIEMIDK-VIRLQSKYWNCFRRRHANSGCNFNE-PINDSIV
SKNFPLQKAIR-QQQQHYLSDEFNLVTLPLINMD--------------------------
------------------------------------------------------------
--LPDNTVLCTPNVYESTTLLVVVHDTSDIWAKRNVISGTIDLSSSVIIDNCLDFIKWGL
DRKYGIIDVNIPLSLF----EPDNYSGMITSQEVLIYLWDNYIKYFPAVAKIAFVGIGDS
YSGIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWK
E--NESRKPRKKFGRVLRCDTDGLNNTIEERFEEATDFILDSFEEWSDEE--
>NDAI0G00650
-----------------MNGGETTSNNDT-----IKKRKIDPES----------------
------RQIIVPPRDAQIHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI
YKILAENGLIKDPTLSGIDDIGDLMLKIPVREATSEEILEVHSKEHLDFIESTSKMNREQ
LLKATESGDSVYFNSDSYASAKLPVGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEAAG
GFCLFSNVAIAAKNILKNYPESVRKILILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMG
KYYPGTIHGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQIVMPMGREFQPDLVII
SAGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNMAVVLEGGYNLDSIAISALSVAKI
LIGEPPDELPDVTRDPKPEVIEMIDK-VLRIQSKYWKCFKSKFGNAGCDFQE-QINNSIA
TKNFPLQSAIR-QQQVRNLSKEFNFSELPIYKSE--------------------------
------------------------------------------------------------
--LPEDTILCSSNIYESNTIIICVHDTPEIWAKRDAIQGTIDPSSSIIVDSSLDMIKWAI
ERKYGVIDINIPQNLL----EQENYYSIITAQEVLINLWDNYLKYFPNVNKIAFVGIGDA
YSGIVHLLGHRDTRSVVKAVINFVGQKQLKPLVPLVDESLGEWYFKNSLVFSNKNHIYWG
D--KENKKPRKKYGRVLRCDTDGISNIMEERFEEATDFILDSFEEWSDSE--
>NCAS0G03800
MVKHLPLTLNHRWKTKESATVLLQTNKQFTQSDTTQKRNMTAVKEE-------PELKKQK
ITDVSERPVIVPPRDAELSYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI
YKILAENGLIKDPTLSGIEDIGDLMLKIPVRDATEEEILEVHSKEHYDFIEKTSTMNREE
LLKATEKGDSVYFNNDSFASAKLPVGGSIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAG
GFCLFSNVAIAAKNILKNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELG
KYYPGTINGQYDQTGEGKGEGFNCNITWPVGGVGDAEYIWAFEQVVMPMAREFQPDLVII
SSGFDAADGDSIGQCHVTPSCYGHMTHMLKSLAKGNLCVVLEGGYNLDAIARSALSVAKI
LIGEPPDELPDPLRDPKPEAIEIIDK-VIRLQSKYWKCFKRRYGNAGCNFKD-EINESLI
SKNFPLQQAIR-EQQLNTLSQDFKFATLPLLKPE--------------------------
------------------------------------------------------------
--LPKDTVLCSPNVYQSKTVIICAHDTPEIWAKRDVIQGTIDPSSSIIVDSTLDFIKWAN
EKKYGVIDINIPQNLF----EQENYSAIVTSQEVLTYIWDNYLKYFPNVEKVAFIGIGDA
YSGIVHLLGHRDTRSVVKSVINFIAQKQLRALVPLVDESLSDWYFKNSLVFSDKSHTYWG
D--KENKKPRKKYGRLLRCETDGINNIVEERFEEATDFILDSFEEWSDSE--