MUSCLE (3.8) multiple sequence alignment

ADL215W            ----------------------------------------------MEFYRDASWVLEYI
TBLA0B06960        ----------------------------------------------MNFYRDATWVLEHL
ZYRO0A01892g       ----------------------------------------------MDFYRDSTWILEYL
Ecym_3325          ---------------------------------MISKQFSAQDILKMEFYRDSSWVLEYI
KLLA0E08361g       ----------------------------------------------MEFYRDATWVLEFV
SAKL0E07678g       ----------------------------------------------MNLYRDATWVFEYV
KLTH0G10362g       MDAQVFLVTTQFIKNFIDNMKSKLIAKKHLLLKKPNTADKRLDVPIMNFYRDATWVLEYV
Kwal_27.11532      ----------------------------------------------MNFYRDATWVLEYV
KNAG0H02000        ----------------------------------------------MDFYRDATWVLESI
CAGL0M06941g       ----------------------------------------------MEFYRDSTWVLEYL
TDEL0G02170        ----------------------------------------------MNFYRDATWVLEYV
YNL022C            ----------------------------------------------MNFYRDATWVLEDI
Smik_14.309        ----------------------------------------------MNFYRDATWVLEDI
Suva_14.325        ----------------------------------------------MNFYRDATWVLEDI
Skud_14.307        ----------------------------------------------MNFYRDATWVLEDI
KAFR0H03310        ----------------------------------------------MEFYRDATWVLEYI
NDAI0G00660        ----------------------------------------------MNFYRDATWVLEYV
NCAS0G03790        ----------------------------------------------MEFYRDATWVLEFV
Kpol_1003.38       ----------------------------------------------MDFYRDSTWVLEYL
TPHA0C03400        ----------------------------------------------MNFYRDATWVLEFL
                                                                 *::***::*::* :

ADL215W            EQEFARKSKVAGSLHSLVLQSHKKYKLKSDVRHVYAIVASFWKYKAYLDRIIEKSGLLKD
TBLA0B06960        EAQDKK-GRVSGSLLSLVVKSCKQFKIQSNPKHVYAVVESAWKFKPFIERIMAKSGILDD
ZYRO0A01892g       EAEEKK-GKLSGSLQSNVLKTCTKYKVKNNPKHIYAVVASCWKYRMYLERIMHKSGILKT
Ecym_3325          EQEFSKNSRISGSLQTLVLRSCKRYKLKTNPKHIYAIVSSCWKYKMYLEKIIKNSGLLAD
KLLA0E08361g       EQELSKDKRVAGSLQTLVLTSCKRYKLKTNPRHIYAIVSSTWQYREYLDKIIKKSGILED
SAKL0E07678g       EQEESK-GKIAGSLQTLVLNSCKRYKLKTNPKHLYAIVHSCWKYKPFLEKILKKSGILKD
KLTH0G10362g       ESAEKG-GRVAGSLQTLVLNSCKKYQLKTNPKHIYAAVYSCWRYNEFLDKLLKRSGILKD
Kwal_27.11532      EKAESS-GRVAGSLQTLVLNSCKKYNLKTNPKHLYAAVYSCWRYNEFLEKLLKKSEILKD
KNAG0H02000        ENQDAK-GKLSGSLQTLVLNSCKRFKVKTNPKHIYAVVSSCWRYKPFLEKVMKKSKILDE
CAGL0M06941g       EGQIEKTGRVSGSLQTIVLRCCKQYRIKTNPKHIYAIVSSCWKYKPYLDKIMKKSGLLDA
TDEL0G02170        EQEDEK-GRLSGSMQTLVLKSCQRYKLKSDPKHLYAVVDSCWRYKALLEKIMKRSKIYDD
YNL022C            EKEAAK-ERISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPYLEKVMKKAHILED
Smik_14.309        EKEAAK-ERISGSMQTLVLKSCKRYKLKSNPKHVYAVLDSCWKYKPYLEKVMKKARILED
Suva_14.325        EKEAAK-VRISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPYLEKVMKKARILEE
Skud_14.307        EKEAAK-ERISGSMQTLVLRSCKKYKLKSNPKHIYAVLDSCWKYKPYLEKVMKKARILED
KAFR0H03310        EQQDSK-GRISGSLQSLVLKSCQKYKLKTNPKHIYAVLDSCWKYKPFLEKVMSKSGILKD
NDAI0G00660        EQQEAK-GRISGSLQTLVLQSCTKYKLKCNPKHVYAVIDSCWKYKPYLEKVMKKSGILDD
NCAS0G03790        EQEDAK-GRISGSLQTLVFQSCKRYKLKCNPKHVYAVLDSCWKYKPYLEKVMKKSGILDE
Kpol_1003.38       EKENAK-DKISGSLQGLVLKSCKKYKVKSNPRHVYAAVSSCWKVKPYLEKVMKRSGILDD
TPHA0C03400        EKEDAK-GKISGSMQSIVLKSCKIYKVQSNPKHIYAVMASCWKYKPYLETIMKKSGILNN
                   *       .::**:   *.     :.:: : .*:** : * *. .  :: :: .: :   

ADL215W            VPRKKGEPAFKRSTLGLVVHDLLLSKKKRIHMGKHPLKAFVLKHQTRLRGEYAKQLVKLG
TBLA0B06960        IPKKKGKPIYQRLTLLLLIHDLMFSKSRRIQMGKHPIKTFVLGYKTRLHSELVKLKLKLK
ZYRO0A01892g       IPQKKGKPAFSRLTIMLLCHDLLISKQKRIQMGKHPIKDYVLKYKTRLHAELVKLKVKLK
Ecym_3325          VPLKKGEPVFSKTTIMLLVHDLLLSKNKRIHMGKHPIKAFVLKRQVRLSGEFKKMLVKLK
KLLA0E08361g       VPKKKGKPLFNKDTIRLLVHDLLLSKSKRIQMGKHPIKTFILKHQTRLKAELTKLKVKLK
SAKL0E07678g       IPKKKGQPAFSNTTILLLVHDLLLSKNKRIQMGKHPIKEFVLKHKVRLQAELAKLKVKLR
KLTH0G10362g       IPKKKGKEVFNPTTIKLLVHDLLFSKNKRIQMGKHPLKEFVLKYKARLSSELVRLKIKLK
Kwal_27.11532      VPKKKGKEIFNPTTIKLLVHDLLFTKNKRIQMGKHPLKEFVLKHKTRLNSELVRLKIKLK
KNAG0H02000        VPQKKGAPVFQRLTLLLLCHDLLLSKSKRIQMGKHPIKMFVLKYKTRLNAELAKMKVKLK
CAGL0M06941g       IPRKKGKPAFSKLTLLLLCHDLLLSKAKRIQMGKHPIKNYVLKYKNALNAEFVKLKIKLK
TDEL0G02170        IPKKKGKPIYSRLTLLLMCHDLLISKQKRIQMGKLPIKEYVLKHKTRLNSELVKLKLKLK
YNL022C            IPKKKGKPLFSRLTLLLLCHDLLLSKQKRIQMGKHPIKDYVLKFKSPLHSEMVKLKLKLK
Smik_14.309        IPKKKGKPLFSRLTLLLLCHDLLISKQKRIQMGKHPIKDYVLKFKSPLHSEMVKLKLKLK
Suva_14.325        IPKKKGKPLFARLTLLLLCHDLLLSKQKRIQMGKHPIKEYVLKFKSPLHSEMVKLKLKLK
Skud_14.307        IPKKKGKPLFSRLTLLLLCHDLLLSKQKRIQMGKHPIKDYVLKFKSPLHSEMVKLKLKLK
KAFR0H03310        IPKKKGKPVYTRLTLLLLIHDLLLSKQKRIQMGKHPIKLFVLRYKSRLHSELVKLKLKAK
NDAI0G00660        IPKKKGKPMYSRLTLMLLCHDLLFSKSKRIQMGKHPIKEYVLKHKSRLHSELVRLKLKLK
NCAS0G03790        IPKRKGKPMYSRLTLMLMCHDLLFSKAKRIQMGKLPIKTYVLKHKSRLHSELVKLKLKLK
Kpol_1003.38       IPNKKGKPQFERLTLLLLCHDLLLSKSKRIQMGKHPIKTYILKYKTRLHSELVKLKLKLK
TPHA0C03400        IPKKNGKPRFERLTILLLCHDLLFSKSKRIQMGKHPLKEYVLKYKTSLRSEMVKLQVKMK
                   :* .:*   :   *: *: ***:::* .**:*** *:* ::*  :  * .*  .  :*  

ADL215W            VADLSVLV------QDEREDATPVRWIRLNPFRI--RGQREEVLQELQKKFPRRVADWRE
TBLA0B06960        VTNLNDMINANSNSNDSTDDITPVRWIRINPIRIPKQKSSDDIILELRKKFTTKVDHWSK
ZYRO0A01892g       VKELSELV-----DQDDGDDATPVRWIRINPLKC----DIPVVVEQLNKKFPHRVDHWDQ
Ecym_3325          VKSLSELV------EDNDADMSPVRWIRINPFRC--QGKVDDVLKELRKKFPKQVDDWTQ
KLLA0E08361g       VTSLSQLI-----KTDDGEDVTPVRWIRINPILV--KERYDDVLAELNKKFPQRVNSWKQ
SAKL0E07678g       VTNLSQLV------KDDSNDMTPVRWIRINPVRC--NGKVDDVKGELQKKFPTKVSNWSE
KLTH0G10362g       VTDLQQLL------KDDRNDMTPVRWFRLNPIRC--GAKSEDILQELSKKFPTRVNSWTN
Kwal_27.11532      VTDLHQLL------KDDRNDMTPVRWFRINPVRC--HGKHEEVMAELAKKFPTRVDSWKD
KNAG0H02000        VKDLSQLT----DSDDLTNDITPVRWFRVNPLRCTAEKPVQSVVTELRKKFTEKVDSWKD
CAGL0M06941g       ITDLSQVV----DKDDAADDMTPVRWIRINPLRI-SNHDTDQVLNELKKKFPTRVNTWKD
TDEL0G02170        VKSLSEIV----DKEDSSNDVTPVRWIRINPLRC-PKNDVEPVLKELIKKFPQRVSHWSD
YNL022C            VRELSELV----LSEDISNDLPPVRWIRINPLKCHPNGETEPVLAELRKKFTLKVDKWSE
Smik_14.309        VRNLSELV----LSEDIANDLPPVRWIRINPLKCYPNGKTEPVLAELRKKFTLKVEKWSE
Suva_14.325        VRDLSELV----LSEDIVNDLPPVRWIRINPLKCHPDGNTEPVLAELKKKFTQKVDNWSE
Skud_14.307        VRDLSEVV----LSEDITNDLPPVRWIRINPLKCHPNGDTEPVLAELRKKFTLKVNKWSD
KAFR0H03310        VRDLSELV----DTGDSSNDITPVRWFRINPLRC---PDASAVMKELEKKFPQRVESWEG
NDAI0G00660        VKNLSEIV----DNNDSTEDVTPVRWIRINPLRCYQGRDVNAVLEELGKKFPKRVENWND
NCAS0G03790        VKNLSELV----SNADSENDMTPVRWIRINPLRC----DVEATKLEIQKKFPTRVENWSD
Kpol_1003.38       VRDLSELI----EDENSNDDITPVRWIRINPIRAQYDKGLEPIMNELNKKFPTRVNHWSD
TPHA0C03400        LKSWGDLI----SSQDDANDITPVRWFRINPIRTPLSKGVEGILEELEKKFPTRVDHWSK
                   : .   :        :   * .****:*:**.             :: ***. .*  *  

ADL215W            LTPGSIYEDEYVAGLYGVHPADKITSHELYKRGKIIIQDRASCFPAQILAPGRSDVIIDA
TBLA0B06960        IKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPAHILNATPDDYIIDA
ZYRO0A01892g       LSPGSIYYDEYVPNLFGIHPSEKITSHDLYKQGKVIIQDRASCLPAHILNPGKEDVVMDA
Ecym_3325          IVPGSIYRDEYIPNLYGVHPSDKITSHELYKRGKIIIQDRASCFPAYILNPTPHDVVIDA
KLLA0E08361g       IVPGSIYYDEYIPNLFGIHPGDKITSHEQYKRGKIIIQDRASCFPAHILNPNSTDVVIDA
SAKL0E07678g       IVPGTIYHDEFIPNLFGVHPADKITSHELYKRGKIIIQDRASCFPAHILNPTPEDVIIDS
KLTH0G10362g       IAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNASSEDLIIDA
Kwal_27.11532      VVPGSIYHDEYIPNLFGVHPGDKITSHELYKTGKIIIQDRASCFPAHILNPSPSDVIIDA
KNAG0H02000        VVPGSIYYDEYIPNLFCVHPQDKITSHELYKQGKIIIQDRASCFPAHILNPKSDDIVIDA
CAGL0M06941g       IIPGSIYYDEFIPNLYGIHISDKITSHELYKQGKIIIQDRASCFPAHILNPSADDVVIDA
TDEL0G02170        ITSGTLYYDEFVPNLFGVHPRDKITSHELYRQGKIIIQDRSSCFPAHILNPGKNDVVIDA
YNL022C            LVPGSIYYDEFIPNLFGIHPSDKITAHELYKHGKIIIQDRASCFPAHILNPGPSDIVIDS
Smik_14.309        LVPESIYYDEYIPNLFGIHPSDKITAHELYKNGKIIIQDRASCFPAHILNPGPNDIVIDA
Suva_14.325        LVPGSIYHDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHPGSNDIVIDA
Skud_14.307        LVPGSIYYDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHPGADDIVIDA
KAFR0H03310        IVPGSIYHDEFIPYLFGIHPQDKITSHELYKQGRIIIQDRASCFPAHILNPTLEDKIIDA
NDAI0G00660        IVPGSIYYDEYIPHLYGIHPQDKITSHELYKQGKIIIQDRASCFPAHILNPSKDDIIIDA
NCAS0G03790        IVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAHILHPDENDVVIDG
Kpol_1003.38       IVPGTIYHDDYIPNLFGVHTKDKITSHELYKTGKVIIQDRASCFPAHILNPGKNDIVIDA
TPHA0C03400        IEQGTIYHDEFIPNLFGVHTKDKITSHELYKQGKIIIQDRASCFPAHVLNPGKDDIVIDS
                   :    :* *:::. *: :   :***:*: *. *.:*****:**:** :* .   * ::*.

ADL215W            CAAPGNKTTHVAAHIFPEGG-----ADHAQIHAFERDPQRAKTLRKMIATAGCDNAIEVH
TBLA0B06960        CAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDKMVKIAGCKKLVEIN
ZYRO0A01892g       CAAPGNKTTHLAAHIISAAGDSN--GGQAQIHAFEKEPARAKVLQKMTSQAGCGSLVKIH
Ecym_3325          CSAPGNKTTHIAAHIFPDG--N---ASDVKIYAFERDAKRAEILEKMVTSAGCESCIQIS
KLLA0E08361g       CAAPGNKTTHVAAHIFGDV-DTK--VDSVKIHAFEKDPERAKTLQMMVATAGCAKGVKIH
SAKL0E07678g       CSAPGNKTTHVAAHMFDPEFVPK----QKQIHAFEKDPERAKTLQKMIQVAGCDKSIEVH
KLTH0G10362g       CAAPGNKTTHVAAHIFQDQA-----VESVRIHAFEKDPERAKTLRTMINTAGCTKGIEVH
Kwal_27.11532      CAAPGNKTTHVAAHMFLND--QP---QEPLIHAFEKDPERAKTLRTMVKTAGCSKGINIH
KNAG0H02000        CAAPGNKTTHLAAHMFQDKTADE--KPKVQIYAFEKDPERAQVLNKMIKIAGCSKEIEVI
CAGL0M06941g       CSAPGNKTTHVAAHIFGDPENPR--NDNVQIYAFEKDPERAQILQKMIKTAGCHKNIDVN
TDEL0G02170        CAAPGNKTTHVAAHILPEY--TR--EQTPKIYAFEKDPARANILKKMTSVAGCGQTVEIH
YNL022C            CSAPGNKTTHTASYIYPEP--PK--DNNTRIYAFEKDPERAKVLQKMIKIAGCSPNISVN
Smik_14.309        CSAPGNKTTHTASYICSEP--PK--DSRTRIYAFEKDPERAKILQKMIKIAGCSSNIDVS
Suva_14.325        CSAPGNKTTHTASYIFSEP--PK--DKKIQIYAFEKDPERAKILQKMIKVAGCSANIDVN
Skud_14.307        CSAPGNKTTHTASYICSGP--PK--DNIIRIYAFEKDPERAKILQKMVKVAGCSSNIDVK
KAFR0H03310        CSAPGNKTTHVASYMFGNGL-----VDDVRIFAFEKDPERAKVLQKMIKVAGCSKQISVN
NDAI0G00660        CAAPGNKTTHVASYMFGDA--KQ-EDPHVQIYAFEKDPERAKILEKMIKVAGCSKNIQVT
NCAS0G03790        CAAPGNKTTHTASYMIKEP--SK--DPKIQIYAFEKNPERAKILDKMIKVAGCSKNIKIN
Kpol_1003.38       CAAPGNKTTHTASYILGGP--KK--DQTTQIYAFEKDPERAKILQHMIKVAGCSNTIQVN
TPHA0C03400        CAAPGNKTTHTAAYILGGP--SK--DQKIQIHAFEKDPERAKVLQKMVRTAGCARTIEVN
                   *:******** *:::               :.***.:. *:: *  *   ***   :.: 

ADL215W            VGDFTRDAQPEIFKNVTGFIVDPSCSGSGIFGRQLVDATQETQKGT-------ETDPSAD
TBLA0B06960        TGDFTKIATPEKYPNVTGFIVDPSCSGSGIFGRKFIDNINSNKKLTEKVKDEGEDDEQDI
ZYRO0A01892g       VGDFTRLAVPDQFEDVTAALVDPSCSGSGIFGRKSLESSNDSQDQ---------------
Ecym_3325          VGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGRQSVDLANKSKLAE---------KVPNE
KLLA0E08361g       VGDFTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKTGS----SNTDEDQTSV
SAKL0E07678g       VGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGRKIIDDTNNK---------------NEV
KLTH0G10362g       VGDFTQLAKPGKFPDVTGFILDPSCSGSGIFGRKMIDDRNKSKADG-----------ASP
Kwal_27.11532      VGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQIIDDHNKSREEG-------------A
KNAG0H02000        VGDFTKLATPQACPNVNGLIVDPSCSGSGIFGRKYIDSINHKKTDE---EKEEEERELDA
CAGL0M06941g       VGDFTQIATPSKYSDVTGFILDPSCSGSGIFGRKSVDILNNHGKKS-----------NDE
TDEL0G02170        VGDFTKLAVPANFKDVTGLIVDPSCSGSGIFGRKSVDSHNVAKKKT---------ETDSE
YNL022C            VGDFTKLATPEKYKDVTCFIVDPSCSGSGIFGRKFFDSFNRRKIDD-------KDDDGGI
Smik_14.309        VGDFTKLATPEKFKDATGFIVDPSCSGSGIFGRKFFDSLNRKKMDD-------KDDDNDI
Suva_14.325        VGDFTKLATPEKCKGVTGFIVDPSCSGSGIFGRKFFDSLNRRKIDE-------KDDEDDA
Skud_14.307        VGDFTKLATPDKCKGATGFIVDPSCSGSGIFGRKFFDSLNKRKMDE-------KDDDNDV
KAFR0H03310        VGDFTKLATPSKFPDVTGFIVDPSCSGSGIFGRKYIDSLNRQKKTQ--------DIVDNG
NDAI0G00660        VGDFTKAATPDKFKDVTGFIVDPSCSGSGIFGRKYVDSLNRQRNNDTTDKDKKSTEEDDE
NCAS0G03790        VGDFTKIALPEKYKDVTGFIVDPSCSGSGIFGRKFIDSLNRKKMNK-DEADKKEGDEEEE
Kpol_1003.38       VGDFTKIATPEKFRNVTGFIVDPSCSGSGIFGRKYVDSINKKKQES--SGDNGNQDDEDA
TPHA0C03400        VGDFTKIATPEKFKNVTGFIVDPSCSGSGIFGRKFIDTLNKKKEGE----DVDEDDESES
                   .****. . *     ..  ::************: .:  :                    

ADL215W            VPEEETFEATKSAV--ELKNRLAKLSSFQFQIVKHAMSFPSAKKLIYSTCSVHAEENERV
TBLA0B06960        PLEQETLAEAKAKD--DLETRLSKLSSFQFQVVKHAMSFPSAKKIVYSTCSIHAEENERV
ZYRO0A01892g       ----------------KLQDRLSKLSSFQFQVVKHAMSMPNARKIVYSTCSVHAEENERV
Ecym_3325          VFEEQDPKEMEQNE--LYKTRLAKLSSFQFQIVKHAMSFPNAKKLVYSTCSIHAEENERV
KLLA0E08361g       EPVEQEKELFEKEQ--DLKNRLAKLSSFQYQIVKHAMSFPSAKKICYSTCSIHAEENERV
SAKL0E07678g       LPEEEQEKEEMDQ---DLKTRLTKLSSFQFQILKHAMSFPNAKKLVYSTCSIHAEENERV
KLTH0G10362g       VEEEEKEEEREDISDKDLKNRLEKLASFQFEIVKHAMSFPSAKKLVYSTCSVHAEENERI
Kwal_27.11532      LPTQEEERQEIEGK--DIKNRLAKLASFQFEIVKYALSFPSAKKLVYSTCSIHAEENERI
KNAG0H02000        VPEEQ--EEQELDD--NLKTRLSKLSSFQFQIVKYALSFPQATKVVYSTCSIHAEENERV
CAGL0M06941g       VPDENDAEETTDSKNEQLKERLSKLASFQFQIVRHAMSFPNAKKIVYSTCSIHAEENERV
TDEL0G02170        IPDE---EEKMVGD--DVANRLSKLASFQFQVVKHAMSMPNAKKIVYSTCSIHAEENERV
YNL022C            VPDEQ--EEFIAKE--ELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERV
Smik_14.309        VPDEQ--EEFMAKE--ELQTRLAKLSSFQFQMVKHAMSFPVAKKIVYSTCSIHAEENERV
Suva_14.325        VPDEQ--EEFMAKE--ELQTRLAKLSSFQFQMVKHAMSFPGAKKIVYSTCSIHAEENERV
Skud_14.307        IPDEQ--EEFMAKE--ELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERV
KAFR0H03310        VPDEQ--EEMAEKENGNLQERLSKLSSFQFQVVKHAMSFPKAKRIVYSTCSIHAEENERV
NDAI0G00660        VPDEQ--EDYNKKE--DLKTRLAKLSSFQFQVIKHAMSFPTAKKIVYSTCSIHAEENERV
NCAS0G03790        VPDEQ--EEYNKRE--DLKTRLSKLSSFQFQVVKHAMSFPNAKKIVYSTCSIHAEENERV
Kpol_1003.38       VPDEQEEEFDLKRD--DLKTRLSKLASFQFQVVKHAMSFPKAKKIVYSTCSIHAEENEGV
TPHA0C03400        IPVEQD-EEFSKKD--DLKTRLSKLASFQFQVVKHAMTFPKARKLVYSTCSIHAEENERV
                                       ** **:***::::.:*:::* * .: *****:****** :

ADL215W            VIDLLLDSKVQKGGWKVASRSKVIPAWPRRGHQAEFEEVFPDQ-----AEELAGGCIRVL
TBLA0B06960        VIDLLLDKKVKEWGWKVTPRSLSIPTWERRGLVSEFEDVFKND-PAMDPKQLAEGCIRTL
ZYRO0A01892g       VIDLLLDSKVKEWGWQLSPRSEVVPTWPRRGIAEEFEEVFRDD--KPKCQLLAESCIRAL
Ecym_3325          VIDLLLDQNIKQYGWKVAKRDSVIPAWQRRGILSEFEEVFPHE----QAQELADGCIRAL
KLLA0E08361g       VIDLLLDSKVKEWGWKVRKRTGVIPTWPRRGWTSEFEEVFPKE----EAKELAEGCIRAL
SAKL0E07678g       VIDLLLDDKVQQWGWRVRKRAGVIPTWSRRGFVEEFQQVYQDK---QQAQELADGCIRAL
KLTH0G10362g       VVDLLLDSKVKEWGWRVRKRAGVIPTWSRRGFYKEFEEVFRDE---DTAKELAEACIRVA
Kwal_27.11532      VIDLLLDSKVKEWGWRVRKRAGAIPTWPRRGFYHEFEDVFREG---DTAKELAEACIRVA
KNAG0H02000        VIDLLLDKKVKESGWRVAPRSKVIPTWERRGLVDEFQQVFREDSESSNCQEMADGCIRAL
CAGL0M06941g       VIDLLLDKKVQSWGWRVAKKELVLPTWYRRGFKEEFQEVFTDK-TEQECQELADGCVRAL
TDEL0G02170        VIDLLLDRNIKEWGWKVASREEVIPKWPRRGKVKEFEQVFRDD--PVKCNELADGCIRAL
YNL022C            VIDLLLDKSVREWGWKVAPKREVIPSWPRRGKVEEFEEVFRDG-VTYDPQQLAEGCIRAL
Smik_14.309        VIDLLLDKAVQEWGWRVAPRSEVIPFWPRRGKVEEFEEVFREG-AAHDPQELAEGCIRAL
Suva_14.325        VIDLLLDKAVQEWGWKVASRTEVVPSWPRRGKVEEFEEVFRDG-SAHDPQQLAEGCIRAL
Skud_14.307        VIDLLLDKAVQEWGWKVAPRTEVIPSWPRRGKVEEFGEVFRDG-TAHNPRQLAEGCIRAL
KAFR0H03310        ALDLLLDEKVKQWGWKIAKRESVIPQWPRRGFVSEFQEIFRDK-TASECQEMADGCIRAL
NDAI0G00660        VLDLLLDSKVKQWGWKVAAKESVIPTWPRRGKIEEFEEVFRDD--PAKCQALADGCIRAL
NCAS0G03790        VIDLMLDSKVKQWGWKVAPRSKVIPTWPRRGKVEEFEEVFREDGNSSKCEELAGGCIRAL
Kpol_1003.38       VIDLLLDKKVQEWGWKVAPRSEVIPTWPRRGFQAEFSKVFRDE--DEKCQELADGCIRVL
TPHA0C03400        VIDLLLDETIKKAGWRVANREKVIPTWPRRGWVDEFKEVFRDD--EEKCKEIAGGCIRAL
                   .:**:**  :.. **.:  .   :* * ***   ** .::           :* .*:*. 

ADL215W            PKEDGGIGFFAVCFERE-
TBLA0B06960        PKEDGGIGFFAVCFERNI
ZYRO0A01892g       PREDGGIGFFAVCFQR--
Ecym_3325          PKEDGGIGFFAVCFERE-
KLLA0E08361g       PKEDGGIGFFAVCFERD-
SAKL0E07678g       PKEDGGIGFFAVCFERD-
KLTH0G10362g       PKEDGGIGFFAVCFERD-
Kwal_27.11532      PKEDGGIGFFAVCFERD-
KNAG0H02000        PREDGGIGFFAVCFERTL
CAGL0M06941g       PKEDGGIGFFAVCFVRD-
TDEL0G02170        PQEDGGIGFFAVCFKR--
YNL022C            PKSDGGIGFFAVCFERD-
Smik_14.309        PKDDGGIGFFAVCFERK-
Suva_14.325        PKEDGGIGFFAVCFVRK-
Skud_14.307        PKEDGGIGFFAVCFERK-
KAFR0H03310        PREDGGIGFFAICFERDI
NDAI0G00660        PRDDGGIGFFAVCFER--
NCAS0G03790        PRSDGGIGFFAVCFER--
Kpol_1003.38       PKEDGGIGFFAVCFERN-
TPHA0C03400        PKEDGGIGFFAVCFERDI
                   *..********:** *  

FASTA FORMAT for MUSCLE Version 3.6

>ADL215W
----------------------------------------------MEFYRDASWVLEYI
EQEFARKSKVAGSLHSLVLQSHKKYKLKSDVRHVYAIVASFWKYKAYLDRIIEKSGLLKD
VPRKKGEPAFKRSTLGLVVHDLLLSKKKRIHMGKHPLKAFVLKHQTRLRGEYAKQLVKLG
VADLSVLV------QDEREDATPVRWIRLNPFRI--RGQREEVLQELQKKFPRRVADWRE
LTPGSIYEDEYVAGLYGVHPADKITSHELYKRGKIIIQDRASCFPAQILAPGRSDVIIDA
CAAPGNKTTHVAAHIFPEGG-----ADHAQIHAFERDPQRAKTLRKMIATAGCDNAIEVH
VGDFTRDAQPEIFKNVTGFIVDPSCSGSGIFGRQLVDATQETQKGT-------ETDPSAD
VPEEETFEATKSAV--ELKNRLAKLSSFQFQIVKHAMSFPSAKKLIYSTCSVHAEENERV
VIDLLLDSKVQKGGWKVASRSKVIPAWPRRGHQAEFEEVFPDQ-----AEELAGGCIRVL
PKEDGGIGFFAVCFERE-
>TBLA0B06960
----------------------------------------------MNFYRDATWVLEHL
EAQDKK-GRVSGSLLSLVVKSCKQFKIQSNPKHVYAVVESAWKFKPFIERIMAKSGILDD
IPKKKGKPIYQRLTLLLLIHDLMFSKSRRIQMGKHPIKTFVLGYKTRLHSELVKLKLKLK
VTNLNDMINANSNSNDSTDDITPVRWIRINPIRIPKQKSSDDIILELRKKFTTKVDHWSK
IKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPAHILNATPDDYIIDA
CAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDKMVKIAGCKKLVEIN
TGDFTKIATPEKYPNVTGFIVDPSCSGSGIFGRKFIDNINSNKKLTEKVKDEGEDDEQDI
PLEQETLAEAKAKD--DLETRLSKLSSFQFQVVKHAMSFPSAKKIVYSTCSIHAEENERV
VIDLLLDKKVKEWGWKVTPRSLSIPTWERRGLVSEFEDVFKND-PAMDPKQLAEGCIRTL
PKEDGGIGFFAVCFERNI
>ZYRO0A01892g
----------------------------------------------MDFYRDSTWILEYL
EAEEKK-GKLSGSLQSNVLKTCTKYKVKNNPKHIYAVVASCWKYRMYLERIMHKSGILKT
IPQKKGKPAFSRLTIMLLCHDLLISKQKRIQMGKHPIKDYVLKYKTRLHAELVKLKVKLK
VKELSELV-----DQDDGDDATPVRWIRINPLKC----DIPVVVEQLNKKFPHRVDHWDQ
LSPGSIYYDEYVPNLFGIHPSEKITSHDLYKQGKVIIQDRASCLPAHILNPGKEDVVMDA
CAAPGNKTTHLAAHIISAAGDSN--GGQAQIHAFEKEPARAKVLQKMTSQAGCGSLVKIH
VGDFTRLAVPDQFEDVTAALVDPSCSGSGIFGRKSLESSNDSQDQ---------------
----------------KLQDRLSKLSSFQFQVVKHAMSMPNARKIVYSTCSVHAEENERV
VIDLLLDSKVKEWGWQLSPRSEVVPTWPRRGIAEEFEEVFRDD--KPKCQLLAESCIRAL
PREDGGIGFFAVCFQR--
>Ecym_3325
---------------------------------MISKQFSAQDILKMEFYRDSSWVLEYI
EQEFSKNSRISGSLQTLVLRSCKRYKLKTNPKHIYAIVSSCWKYKMYLEKIIKNSGLLAD
VPLKKGEPVFSKTTIMLLVHDLLLSKNKRIHMGKHPIKAFVLKRQVRLSGEFKKMLVKLK
VKSLSELV------EDNDADMSPVRWIRINPFRC--QGKVDDVLKELRKKFPKQVDDWTQ
IVPGSIYRDEYIPNLYGVHPSDKITSHELYKRGKIIIQDRASCFPAYILNPTPHDVVIDA
CSAPGNKTTHIAAHIFPDG--N---ASDVKIYAFERDAKRAEILEKMVTSAGCESCIQIS
VGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGRQSVDLANKSKLAE---------KVPNE
VFEEQDPKEMEQNE--LYKTRLAKLSSFQFQIVKHAMSFPNAKKLVYSTCSIHAEENERV
VIDLLLDQNIKQYGWKVAKRDSVIPAWQRRGILSEFEEVFPHE----QAQELADGCIRAL
PKEDGGIGFFAVCFERE-
>KLLA0E08361g
----------------------------------------------MEFYRDATWVLEFV
EQELSKDKRVAGSLQTLVLTSCKRYKLKTNPRHIYAIVSSTWQYREYLDKIIKKSGILED
VPKKKGKPLFNKDTIRLLVHDLLLSKSKRIQMGKHPIKTFILKHQTRLKAELTKLKVKLK
VTSLSQLI-----KTDDGEDVTPVRWIRINPILV--KERYDDVLAELNKKFPQRVNSWKQ
IVPGSIYYDEYIPNLFGIHPGDKITSHEQYKRGKIIIQDRASCFPAHILNPNSTDVVIDA
CAAPGNKTTHVAAHIFGDV-DTK--VDSVKIHAFEKDPERAKTLQMMVATAGCAKGVKIH
VGDFTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKTGS----SNTDEDQTSV
EPVEQEKELFEKEQ--DLKNRLAKLSSFQYQIVKHAMSFPSAKKICYSTCSIHAEENERV
VIDLLLDSKVKEWGWKVRKRTGVIPTWPRRGWTSEFEEVFPKE----EAKELAEGCIRAL
PKEDGGIGFFAVCFERD-
>SAKL0E07678g
----------------------------------------------MNLYRDATWVFEYV
EQEESK-GKIAGSLQTLVLNSCKRYKLKTNPKHLYAIVHSCWKYKPFLEKILKKSGILKD
IPKKKGQPAFSNTTILLLVHDLLLSKNKRIQMGKHPIKEFVLKHKVRLQAELAKLKVKLR
VTNLSQLV------KDDSNDMTPVRWIRINPVRC--NGKVDDVKGELQKKFPTKVSNWSE
IVPGTIYHDEFIPNLFGVHPADKITSHELYKRGKIIIQDRASCFPAHILNPTPEDVIIDS
CSAPGNKTTHVAAHMFDPEFVPK----QKQIHAFEKDPERAKTLQKMIQVAGCDKSIEVH
VGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGRKIIDDTNNK---------------NEV
LPEEEQEKEEMDQ---DLKTRLTKLSSFQFQILKHAMSFPNAKKLVYSTCSIHAEENERV
VIDLLLDDKVQQWGWRVRKRAGVIPTWSRRGFVEEFQQVYQDK---QQAQELADGCIRAL
PKEDGGIGFFAVCFERD-
>KLTH0G10362g
MDAQVFLVTTQFIKNFIDNMKSKLIAKKHLLLKKPNTADKRLDVPIMNFYRDATWVLEYV
ESAEKG-GRVAGSLQTLVLNSCKKYQLKTNPKHIYAAVYSCWRYNEFLDKLLKRSGILKD
IPKKKGKEVFNPTTIKLLVHDLLFSKNKRIQMGKHPLKEFVLKYKARLSSELVRLKIKLK
VTDLQQLL------KDDRNDMTPVRWFRLNPIRC--GAKSEDILQELSKKFPTRVNSWTN
IAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNASSEDLIIDA
CAAPGNKTTHVAAHIFQDQA-----VESVRIHAFEKDPERAKTLRTMINTAGCTKGIEVH
VGDFTQLAKPGKFPDVTGFILDPSCSGSGIFGRKMIDDRNKSKADG-----------ASP
VEEEEKEEEREDISDKDLKNRLEKLASFQFEIVKHAMSFPSAKKLVYSTCSVHAEENERI
VVDLLLDSKVKEWGWRVRKRAGVIPTWSRRGFYKEFEEVFRDE---DTAKELAEACIRVA
PKEDGGIGFFAVCFERD-
>Kwal_27.11532
----------------------------------------------MNFYRDATWVLEYV
EKAESS-GRVAGSLQTLVLNSCKKYNLKTNPKHLYAAVYSCWRYNEFLEKLLKKSEILKD
VPKKKGKEIFNPTTIKLLVHDLLFTKNKRIQMGKHPLKEFVLKHKTRLNSELVRLKIKLK
VTDLHQLL------KDDRNDMTPVRWFRINPVRC--HGKHEEVMAELAKKFPTRVDSWKD
VVPGSIYHDEYIPNLFGVHPGDKITSHELYKTGKIIIQDRASCFPAHILNPSPSDVIIDA
CAAPGNKTTHVAAHMFLND--QP---QEPLIHAFEKDPERAKTLRTMVKTAGCSKGINIH
VGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQIIDDHNKSREEG-------------A
LPTQEEERQEIEGK--DIKNRLAKLASFQFEIVKYALSFPSAKKLVYSTCSIHAEENERI
VIDLLLDSKVKEWGWRVRKRAGAIPTWPRRGFYHEFEDVFREG---DTAKELAEACIRVA
PKEDGGIGFFAVCFERD-
>KNAG0H02000
----------------------------------------------MDFYRDATWVLESI
ENQDAK-GKLSGSLQTLVLNSCKRFKVKTNPKHIYAVVSSCWRYKPFLEKVMKKSKILDE
VPQKKGAPVFQRLTLLLLCHDLLLSKSKRIQMGKHPIKMFVLKYKTRLNAELAKMKVKLK
VKDLSQLT----DSDDLTNDITPVRWFRVNPLRCTAEKPVQSVVTELRKKFTEKVDSWKD
VVPGSIYYDEYIPNLFCVHPQDKITSHELYKQGKIIIQDRASCFPAHILNPKSDDIVIDA
CAAPGNKTTHLAAHMFQDKTADE--KPKVQIYAFEKDPERAQVLNKMIKIAGCSKEIEVI
VGDFTKLATPQACPNVNGLIVDPSCSGSGIFGRKYIDSINHKKTDE---EKEEEERELDA
VPEEQ--EEQELDD--NLKTRLSKLSSFQFQIVKYALSFPQATKVVYSTCSIHAEENERV
VIDLLLDKKVKESGWRVAPRSKVIPTWERRGLVDEFQQVFREDSESSNCQEMADGCIRAL
PREDGGIGFFAVCFERTL
>CAGL0M06941g
----------------------------------------------MEFYRDSTWVLEYL
EGQIEKTGRVSGSLQTIVLRCCKQYRIKTNPKHIYAIVSSCWKYKPYLDKIMKKSGLLDA
IPRKKGKPAFSKLTLLLLCHDLLLSKAKRIQMGKHPIKNYVLKYKNALNAEFVKLKIKLK
ITDLSQVV----DKDDAADDMTPVRWIRINPLRI-SNHDTDQVLNELKKKFPTRVNTWKD
IIPGSIYYDEFIPNLYGIHISDKITSHELYKQGKIIIQDRASCFPAHILNPSADDVVIDA
CSAPGNKTTHVAAHIFGDPENPR--NDNVQIYAFEKDPERAQILQKMIKTAGCHKNIDVN
VGDFTQIATPSKYSDVTGFILDPSCSGSGIFGRKSVDILNNHGKKS-----------NDE
VPDENDAEETTDSKNEQLKERLSKLASFQFQIVRHAMSFPNAKKIVYSTCSIHAEENERV
VIDLLLDKKVQSWGWRVAKKELVLPTWYRRGFKEEFQEVFTDK-TEQECQELADGCVRAL
PKEDGGIGFFAVCFVRD-
>TDEL0G02170
----------------------------------------------MNFYRDATWVLEYV
EQEDEK-GRLSGSMQTLVLKSCQRYKLKSDPKHLYAVVDSCWRYKALLEKIMKRSKIYDD
IPKKKGKPIYSRLTLLLMCHDLLISKQKRIQMGKLPIKEYVLKHKTRLNSELVKLKLKLK
VKSLSEIV----DKEDSSNDVTPVRWIRINPLRC-PKNDVEPVLKELIKKFPQRVSHWSD
ITSGTLYYDEFVPNLFGVHPRDKITSHELYRQGKIIIQDRSSCFPAHILNPGKNDVVIDA
CAAPGNKTTHVAAHILPEY--TR--EQTPKIYAFEKDPARANILKKMTSVAGCGQTVEIH
VGDFTKLAVPANFKDVTGLIVDPSCSGSGIFGRKSVDSHNVAKKKT---------ETDSE
IPDE---EEKMVGD--DVANRLSKLASFQFQVVKHAMSMPNAKKIVYSTCSIHAEENERV
VIDLLLDRNIKEWGWKVASREEVIPKWPRRGKVKEFEQVFRDD--PVKCNELADGCIRAL
PQEDGGIGFFAVCFKR--
>YNL022C
----------------------------------------------MNFYRDATWVLEDI
EKEAAK-ERISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPYLEKVMKKAHILED
IPKKKGKPLFSRLTLLLLCHDLLLSKQKRIQMGKHPIKDYVLKFKSPLHSEMVKLKLKLK
VRELSELV----LSEDISNDLPPVRWIRINPLKCHPNGETEPVLAELRKKFTLKVDKWSE
LVPGSIYYDEFIPNLFGIHPSDKITAHELYKHGKIIIQDRASCFPAHILNPGPSDIVIDS
CSAPGNKTTHTASYIYPEP--PK--DNNTRIYAFEKDPERAKVLQKMIKIAGCSPNISVN
VGDFTKLATPEKYKDVTCFIVDPSCSGSGIFGRKFFDSFNRRKIDD-------KDDDGGI
VPDEQ--EEFIAKE--ELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERV
VIDLLLDKSVREWGWKVAPKREVIPSWPRRGKVEEFEEVFRDG-VTYDPQQLAEGCIRAL
PKSDGGIGFFAVCFERD-
>Smik_14.309
----------------------------------------------MNFYRDATWVLEDI
EKEAAK-ERISGSMQTLVLKSCKRYKLKSNPKHVYAVLDSCWKYKPYLEKVMKKARILED
IPKKKGKPLFSRLTLLLLCHDLLISKQKRIQMGKHPIKDYVLKFKSPLHSEMVKLKLKLK
VRNLSELV----LSEDIANDLPPVRWIRINPLKCYPNGKTEPVLAELRKKFTLKVEKWSE
LVPESIYYDEYIPNLFGIHPSDKITAHELYKNGKIIIQDRASCFPAHILNPGPNDIVIDA
CSAPGNKTTHTASYICSEP--PK--DSRTRIYAFEKDPERAKILQKMIKIAGCSSNIDVS
VGDFTKLATPEKFKDATGFIVDPSCSGSGIFGRKFFDSLNRKKMDD-------KDDDNDI
VPDEQ--EEFMAKE--ELQTRLAKLSSFQFQMVKHAMSFPVAKKIVYSTCSIHAEENERV
VIDLLLDKAVQEWGWRVAPRSEVIPFWPRRGKVEEFEEVFREG-AAHDPQELAEGCIRAL
PKDDGGIGFFAVCFERK-
>Suva_14.325
----------------------------------------------MNFYRDATWVLEDI
EKEAAK-VRISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPYLEKVMKKARILEE
IPKKKGKPLFARLTLLLLCHDLLLSKQKRIQMGKHPIKEYVLKFKSPLHSEMVKLKLKLK
VRDLSELV----LSEDIVNDLPPVRWIRINPLKCHPDGNTEPVLAELKKKFTQKVDNWSE
LVPGSIYHDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHPGSNDIVIDA
CSAPGNKTTHTASYIFSEP--PK--DKKIQIYAFEKDPERAKILQKMIKVAGCSANIDVN
VGDFTKLATPEKCKGVTGFIVDPSCSGSGIFGRKFFDSLNRRKIDE-------KDDEDDA
VPDEQ--EEFMAKE--ELQTRLAKLSSFQFQMVKHAMSFPGAKKIVYSTCSIHAEENERV
VIDLLLDKAVQEWGWKVASRTEVVPSWPRRGKVEEFEEVFRDG-SAHDPQQLAEGCIRAL
PKEDGGIGFFAVCFVRK-
>Skud_14.307
----------------------------------------------MNFYRDATWVLEDI
EKEAAK-ERISGSMQTLVLRSCKKYKLKSNPKHIYAVLDSCWKYKPYLEKVMKKARILED
IPKKKGKPLFSRLTLLLLCHDLLLSKQKRIQMGKHPIKDYVLKFKSPLHSEMVKLKLKLK
VRDLSEVV----LSEDITNDLPPVRWIRINPLKCHPNGDTEPVLAELRKKFTLKVNKWSD
LVPGSIYYDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHPGADDIVIDA
CSAPGNKTTHTASYICSGP--PK--DNIIRIYAFEKDPERAKILQKMVKVAGCSSNIDVK
VGDFTKLATPDKCKGATGFIVDPSCSGSGIFGRKFFDSLNKRKMDE-------KDDDNDV
IPDEQ--EEFMAKE--ELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERV
VIDLLLDKAVQEWGWKVAPRTEVIPSWPRRGKVEEFGEVFRDG-TAHNPRQLAEGCIRAL
PKEDGGIGFFAVCFERK-
>KAFR0H03310
----------------------------------------------MEFYRDATWVLEYI
EQQDSK-GRISGSLQSLVLKSCQKYKLKTNPKHIYAVLDSCWKYKPFLEKVMSKSGILKD
IPKKKGKPVYTRLTLLLLIHDLLLSKQKRIQMGKHPIKLFVLRYKSRLHSELVKLKLKAK
VRDLSELV----DTGDSSNDITPVRWFRINPLRC---PDASAVMKELEKKFPQRVESWEG
IVPGSIYHDEFIPYLFGIHPQDKITSHELYKQGRIIIQDRASCFPAHILNPTLEDKIIDA
CSAPGNKTTHVASYMFGNGL-----VDDVRIFAFEKDPERAKVLQKMIKVAGCSKQISVN
VGDFTKLATPSKFPDVTGFIVDPSCSGSGIFGRKYIDSLNRQKKTQ--------DIVDNG
VPDEQ--EEMAEKENGNLQERLSKLSSFQFQVVKHAMSFPKAKRIVYSTCSIHAEENERV
ALDLLLDEKVKQWGWKIAKRESVIPQWPRRGFVSEFQEIFRDK-TASECQEMADGCIRAL
PREDGGIGFFAICFERDI
>NDAI0G00660
----------------------------------------------MNFYRDATWVLEYV
EQQEAK-GRISGSLQTLVLQSCTKYKLKCNPKHVYAVIDSCWKYKPYLEKVMKKSGILDD
IPKKKGKPMYSRLTLMLLCHDLLFSKSKRIQMGKHPIKEYVLKHKSRLHSELVRLKLKLK
VKNLSEIV----DNNDSTEDVTPVRWIRINPLRCYQGRDVNAVLEELGKKFPKRVENWND
IVPGSIYYDEYIPHLYGIHPQDKITSHELYKQGKIIIQDRASCFPAHILNPSKDDIIIDA
CAAPGNKTTHVASYMFGDA--KQ-EDPHVQIYAFEKDPERAKILEKMIKVAGCSKNIQVT
VGDFTKAATPDKFKDVTGFIVDPSCSGSGIFGRKYVDSLNRQRNNDTTDKDKKSTEEDDE
VPDEQ--EDYNKKE--DLKTRLAKLSSFQFQVIKHAMSFPTAKKIVYSTCSIHAEENERV
VLDLLLDSKVKQWGWKVAAKESVIPTWPRRGKIEEFEEVFRDD--PAKCQALADGCIRAL
PRDDGGIGFFAVCFER--
>NCAS0G03790
----------------------------------------------MEFYRDATWVLEFV
EQEDAK-GRISGSLQTLVFQSCKRYKLKCNPKHVYAVLDSCWKYKPYLEKVMKKSGILDE
IPKRKGKPMYSRLTLMLMCHDLLFSKAKRIQMGKLPIKTYVLKHKSRLHSELVKLKLKLK
VKNLSELV----SNADSENDMTPVRWIRINPLRC----DVEATKLEIQKKFPTRVENWSD
IVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAHILHPDENDVVIDG
CAAPGNKTTHTASYMIKEP--SK--DPKIQIYAFEKNPERAKILDKMIKVAGCSKNIKIN
VGDFTKIALPEKYKDVTGFIVDPSCSGSGIFGRKFIDSLNRKKMNK-DEADKKEGDEEEE
VPDEQ--EEYNKRE--DLKTRLSKLSSFQFQVVKHAMSFPNAKKIVYSTCSIHAEENERV
VIDLMLDSKVKQWGWKVAPRSKVIPTWPRRGKVEEFEEVFREDGNSSKCEELAGGCIRAL
PRSDGGIGFFAVCFER--
>Kpol_1003.38
----------------------------------------------MDFYRDSTWVLEYL
EKENAK-DKISGSLQGLVLKSCKKYKVKSNPRHVYAAVSSCWKVKPYLEKVMKRSGILDD
IPNKKGKPQFERLTLLLLCHDLLLSKSKRIQMGKHPIKTYILKYKTRLHSELVKLKLKLK
VRDLSELI----EDENSNDDITPVRWIRINPIRAQYDKGLEPIMNELNKKFPTRVNHWSD
IVPGTIYHDDYIPNLFGVHTKDKITSHELYKTGKVIIQDRASCFPAHILNPGKNDIVIDA
CAAPGNKTTHTASYILGGP--KK--DQTTQIYAFEKDPERAKILQHMIKVAGCSNTIQVN
VGDFTKIATPEKFRNVTGFIVDPSCSGSGIFGRKYVDSINKKKQES--SGDNGNQDDEDA
VPDEQEEEFDLKRD--DLKTRLSKLASFQFQVVKHAMSFPKAKKIVYSTCSIHAEENEGV
VIDLLLDKKVQEWGWKVAPRSEVIPTWPRRGFQAEFSKVFRDE--DEKCQELADGCIRVL
PKEDGGIGFFAVCFERN-
>TPHA0C03400
----------------------------------------------MNFYRDATWVLEFL
EKEDAK-GKISGSMQSIVLKSCKIYKVQSNPKHIYAVMASCWKYKPYLETIMKKSGILNN
IPKKNGKPRFERLTILLLCHDLLFSKSKRIQMGKHPLKEYVLKYKTSLRSEMVKLQVKMK
LKSWGDLI----SSQDDANDITPVRWFRINPIRTPLSKGVEGILEELEKKFPTRVDHWSK
IEQGTIYHDEFIPNLFGVHTKDKITSHELYKQGKIIIQDRASCFPAHVLNPGKDDIVIDS
CAAPGNKTTHTAAYILGGP--SK--DQKIQIHAFEKDPERAKVLQKMVRTAGCARTIEVN
VGDFTKIATPEKFKNVTGFIVDPSCSGSGIFGRKFIDTLNKKKEGE----DVDEDDESES
IPVEQD-EEFSKKD--DLKTRLSKLASFQFQVVKHAMTFPKARKLVYSTCSIHAEENERV
VIDLLLDETIKKAGWRVANREKVIPTWPRRGWVDEFKEVFRDD--EEKCKEIAGGCIRAL
PKEDGGIGFFAVCFERDI