MUSCLE (3.8) multiple sequence alignment

Ecym_3327          --------------------------MLNTSERS--------SEVEEVSYSD--------
ADL213W            -------------------------------------------MLRDMPLDA--------
KLLA0E08317g       ------------------MTAEELIYPESEPRLY--------SSDSDFDSDN--------
TPHA0D01530        ------------------MSDREITSQIETAAGN-----------TESSSDEESYSKGSN
KLTH0G10406g       -----------------MTSGQDQIAEAEFDEGY--------VVVRADSETSEAFENVGE
Kwal_27.11518      -----------------MTSELDSTPDNDLSNGY--------VLVDASSEESEDFEHVED
SAKL0E07634g       ----------------MDKHVSPLRVSSELPDSH---------STSEYSSSGDASDDHEN
Kpol_1039.45       MTENTSVEASSVDETSHLKGTDHLVTASETSNSG--------SVYTSSSDDC--DDDNSE
CAGL0M06919g       -----------MQDGRTEVTQDEYRHYDDHPDNS--------SLVIGLSEDE------SE
TBLA0B05950        -----------MVQDKEQEQDQETINKQQSSNGK---LFKGHSLVLEFSDDD-ASDSGSD
ZYRO0A01936g       -------------MSGFERSEAEIGMAAQEYDGKDAPQVVDNSLILEFSDDS------DE
KNAG0H01990        -----------------------MIADDGKPDPK--------SLVLNFSSDD--EDSATE
TDEL0G02190        -------------------------MVVEELNQH--------SLVLEFSEDDSDFSSESC
Suva_14.324        ---------------MLQTNERESLDLEQSQNGS---------DVHEHCLNDEHVSGVEV
Skud_14.306        ---------------MLQITEHESLDLEQDQNGG--------GIHKHHSLSNGHVLSVED
Smik_14.308        ------------------MTDHESLDLKQNQEGG--------GVCRRHSLSSEQDSSVED
YNL023C            ------------------MTEHESLGLEQNQDGG--------DTYRHHNLSDGCISSVED
KAFR0H03300        ------------MDDSSADSVDETLNLHTHPDPK--------SLVLEFSEDDTSSAASSD
NDAI0G00670        ------------------MSDTELNEVSTHPDPK--------SLILQASADEIKSSENVS
NCAS0G03780        ------------------MGKDHIS-TGDEPDPK--------SLVLELSDDD---SNGES
                                                                               

Ecym_3327          -------YL-------SEADDD--GLPYYEKAIKDIQNGYLYQCLICTVEIDSTCRMYAC
ADL213W            -----------------TAKLE--GIPYYEQTVLELRDGETYQCLICTVEMDASCPMYAC
KLLA0E08317g       ------------------DEDT--NIPYYEQTVKEIKDGDQYVCMICTVELDSTCRMYAC
TPHA0D01530        ESNFDS----------SEDEDD--GLVYYEQTIRDISKGDRYTCMICTIEMDYTCKMYAC
KLTH0G10406g       DLDEQDEQDEQDEQDELDEQGDTYDQPYYEKTIKEIAKGDRYPCMICTVEMDFTCHMYAC
Kwal_27.11518      ----------------EIDELE--DQPYYEKTVKEIEKGDRYPCMICTVEMDFTCHMYAC
SAKL0E07634g       YTSDT-----------EDDESD--DLPYYEKTIHEIQKGDSYACMICTMEMDYTCHMYAC
Kpol_1039.45       SDSDDSEY--------ESSDNE--DLMHYERAIKDIAKGDFYTCMICTIELDSTSKMYAC
CAGL0M06919g       IETNMGAELSEELSDLDEGDEK--DMAYYEKAVQEIVKGDSYSCLICTVELDYTCKLYAC
TBLA0B05950        NNSDLSRDEDESDVDTDNEYEE--DLMYYERAVREIAKGDSYQCMICTVEMDHTCKMYAC
ZYRO0A01936g       TTDEETT---------DEDEDD--RMMYYERAVKEIARGDTYVCMICTVEMDYTCKMFAC
KNAG0H01990        ANITYSEEEEEEIATSDTEEDQ--DLPYYERAVREIAKGDLYTCMICTVEMDYTCKMFAC
TDEL0G02190        SVH-------------EVRDEH--DMAYYERAVQEIALGDRYVCMICTVEMDYTCKMYAC
Suva_14.324        SHEQSSTYDS------EEESDD--DMQYYERAIQEIAKGDSYICMICTVEMDYTCQMFAC
Skud_14.306        SSEQLSSYEF------EEESDD--DLQYYERAIQEIAKGDSYICMICTVEMDYTCQMFAC
Smik_14.308        NNEQPSSY--------EEETDD--DMQYYERSIQEISKGDSYICMICTVEMDYTCQMFAC
YNL023C            ANEQPSSY--------EEESDD--DMQYYERAIQEISSGDSYVCMICTVEMDYTCQMFAC
KAFR0H03300        DEEMD-----------VLSDND--DMMYYERAIQEIAAGDSYICMICTVEMDYTCKMYAC
NDAI0G00670        STSDNDEYDQEDEYAAATAADE--DMKYYERTIQEIAKGDSYVCMICTVEMDYTCQMYAC
NCAS0G03780        GNSDSSEYESD----FAGMDDD--AMHYYERAIQEIAKGDSYVCMICTVEMDYTCQMYAC
                                              :**.:: ::  *  * *:***:*:* :. ::**

Ecym_3327          SNCYRVYDYECIMEWAKKSSKRSADSTWKCPNCYHSYNKVLPKKRSTCWCGKQINPEKNA
ADL213W            HQCYRVYDYECIRRWALKATSTTVDRTWKCPNCYHVNRKVPPKNRHTCWCGKQVNLDPNY
KLLA0E08317g       DSCYRVFDYECVREWALKSTNKTLDKSWKCPNCYKINHKIPKQKRSTCWCGKVVNPDVNE
TPHA0D01530        QSCYRVFDYECIQEWAEKSASKTIDKVWKCPNCSHSSKQIPLRNRPTCWCGKVINPDPNE
KLTH0G10406g       PECYRVFDYECIREWAVKSTQKSVTKTWKCPNCYFEKKDVPLKNRPTCWCGKNIHPEPNP
Kwal_27.11518      PDCYRVFDFECIREWALKSTQKSVSKTWKCPNCYFERKEVPMKNRPTCWCGKSVQPEPNP
SAKL0E07634g       PECYRVYDHECIREWALKSSQKSLDKTWKCPNCYYVNSEIPVKNRHTCWCGKVVHPESNP
Kpol_1039.45       SHCYRVFDYDCIREWAVKSSQKSLDKVWKCPNCNHTSNKIPLQNRPTCWCGKTVNPDPNP
CAGL0M06919g       EKCYRVYDYECIREWAEKSTSKRTDKLWACPNCFYTKKAIPKKNRPTCWCGEQVNPEPNP
TBLA0B05950        RHCYRVFDYDCIREWALKSTQKTVDKTWKCPNCYHSSKKVPLKDRPTCWCGKVVNPDPNP
ZYRO0A01936g       SKCYRVFDYDCIREWALKSTGRTMDKTWKCPNCLDESNKVPRKSRPTCWCGKVVNPDPNP
KNAG0H01990        RKCYRVFDYDCVREWAIKSTDKTVDRIWKCPNCYLVNKKVPTKNRPTCWCGKVVNPEPNP
TDEL0G02190        EGCYRVFDYECIREWALKSTEKTLDRVWKCPNCYKVNKRVPAKNRPTCWCGKTVNPDPNP
Suva_14.324        KKCYRVFDYACIREWALKSTEKTVDKIWKCPNCYHIGKKVPTRNRPTCWCGKVVNPDHNP
Skud_14.306        KKCYRVFDYACIREWALKSTEKTVDKIWKCPNCYHVGKKVPTRNRPTCWCGNVVNPDPNQ
Smik_14.308        KRCYRVFDYGCIREWAIKSTEKTVDRIWKCPNCYHVGKKVPANNRPTCWCGKVVNPDPNP
YNL023C            KRCYRVFDYGCIREWALKSTEKTVDRIWKCPNCYYVSKRVPVKNRPTCWCGKVVNPDPNP
KAFR0H03300        KKCCRIFDYDCIREWALKSTEKTKERIWKCPNCYHVNKKVPTKNRATCWCGKVVNPEKNP
NDAI0G00670        KECYRVFDYDCIREWAVKSTEKTVDRIWKCPNCYHVNKKVPPKNRSTCWCGKVVNPEANP
NCAS0G03780        KQCYRVFDYECIREWALKSTEKTVDRIWKCPNCYHVNKKVPPKNRPTCWCGKVVNPEPNP
                     * *::*. *:  ** *::       * ****      :  ..* *****: :: : * 

Ecym_3327          TYPNSCGQTCGASICKHGCASTCHLGPHPKCMVPVGLKCKCGKITEQISCYQTKAV---K
ADL213W            INPNSCGQTCGAPICQHGCSKLCHLGPHEECMVRIDFKCRCGKLTEEIPCYEAKAA---K
KLLA0E08317g       LDPNSCGQTCNAYSCVHGCSKVCHLGPHPECLIPVQIKCKCGKHCKQIPCSRSKVL---G
TPHA0D01530        LSPNSCGQTCNKKTCVHGCKNFCHLGPHGECSVITTLKCKCGRNEKDIFCHQLKKSNK-N
KLTH0G10406g       LNPNSCGQTCDAPICVHGCSSTCHLGPHPTCMRMVQTKCRCGKKSKDVFCSEARKH---Q
Kwal_27.11518      LNPNSCGQTCDAQICEHGCSSICHLGPHPTCMRMVQVKCNCGKKNKSVFCHEAGKF---V
SAKL0E07634g       IDPNSCGQTCNAPICSHGCSKPCHLGPHPECMRTTKVKCLCGKHTKDMFCYQSEEE---K
Kpol_1039.45       FYPNSCGQTCNAKSCIHRCSHFCHLGPHPQCHRTTTIHCECGKHTKDVFCYLLDHGKNRN
CAGL0M06919g       LNPNSCGQTCNAKICSHGCSQICHLGPHQECTRMMSIKCSCGKVTKDIVCFQRRLY---S
TBLA0B05950        LDPNSCGQTCNANICPHKCLKQCHLGSHPECTQLLKITCRCGRETKDIYCHESRRQ---K
ZYRO0A01936g       LDPNSCGQTCDAPICEHGCSKVCHLGPHPECTRIISIKCKCGRHTRDVRCSEVGSGR--N
KNAG0H01990        LDPNSCGQTCDAKICIHGCSKICHLGPHPECLRTTSVKCRCGKATKEIPCFETKGRRG-R
TDEL0G02190        LDPNSCGQTCDAPICPHGCSKQCHLGPHPDCVRTITTKCQCGKHTRETFCYQTISMKG-K
Suva_14.324        LDPNSCGQTCNAPTCVHGCSKICHLGPHPECTRTVEIKCRCGKHSKSIFCYQSKAM---K
Skud_14.306        LDPNSCGQTCNAPTCVHGCFKICHLGPHPECTRMVEIKCHCGRHSKTIFCYQSKAM---R
Smik_14.308        LDPNSCGQTCSAPICIHGCSKTCHLGPHPECTRMVEIMCHCGKHSQSIFCYQSKAM---K
YNL023C            LDPNSCGQTCNASTCMHGCSKICHLGPHPECTRMVEIMCHCGKHSKSIFCYQSKVM---K
KAFR0H03300        LNPNSCGQTCNAPVCIHGCSKICHLGPHPECLRTITMKCDCGKHERQISCFQSKSQSGRR
NDAI0G00670        LNPNSCGQTCNAKICVHGCTNICHLGPHPECTRMLSITCRCGKHTKDIFCYQSKTFKG-N
NCAS0G03780        LNPNSCGQTCNAHTCVHGCSKICHLGPHPECTRIITIKCRCGKHTKDISCYQSSLLRG-K
                     ********.   * * *   ****.*  *       * **.      *          

Ecym_3327          PKLSCKLPCGLPLPCGVHTCQKICHSGPCGRCNTVMSGK------------FKCYCGSNH
ADL213W            RNFSCDQPCGLPMPCGIHKCERVCHNGPCGPCKEEIAGD------------IKCYCGLTT
KLLA0E08317g       NSYNCGDVCGLLLPCGKHTCQKTCHTGFCGPCESIIKTE------------LPCYCGSDV
TPHA0D01530        NVYQCNEVCQLPLACGVHKCKRVCHSGLCGACPEILSSEQIQSVESNENRKFKCYCGENS
KLTH0G10406g       ELFRCGNPCGLTLPCGVHKCQRECHNGVCGECPETIAKE------------INCYCGLES
Kwal_27.11518      DSFICDSPCGLTLPCGIHKCQRKCHSGICGECPESIYGT------------INCYCKLES
SAKL0E07634g       ASYQCGEPCNLLLPCGVHKCQRKCHSGPCGNCEETISGK------------IMCYCGMET
Kpol_1039.45       KKFNCGEKCNMTLSCGIHKCSRVCHSGSCGPCPELITKK------------VNCYCGSTT
CAGL0M06919g       KGFNCETVCDKLLPCGIHKCNRKCHTGLCGSCPETIISK-------NTNMKIRCYCGQTS
TBLA0B05950        SIFHCDQECGLTLPCGIHKCRRKCHSGLCGSCPELLIDE-------NVSGKIKCYCGLHS
ZYRO0A01936g       QQFTCEESCGLLLPCGVHKCSKKCHSGLCGGCNETLHSKP------DKGAVIKCYCGLHE
KNAG0H01990        NLFQCNEPCNSLLPCGIHRCQKICHSGLCGSCPENLTVKE------GDDVSISCYCGQHT
TDEL0G02190        SQFQCNEVCGLPLACGIHKCERLCHSGICGPCPAVLNAK-------SNKLKIRCYCGLEH
Suva_14.324        KHFDCQEECGLPLSCGIHKCKKKCHSGLCGPCPELIMSED------KAMDWIKCYCGIHS
Skud_14.306        RRFNCQEECGLSLSCGVHKCKKKCHSGLCGSCPEFIINDD------SSKKQIKCYCGNHI
Smik_14.308        KNFKCQEECGLPLSCSVHNCKRKCHTGLCGPCPELITSKD------STEEQIKCYCGNHS
YNL023C            KNFNCQEVCGLPLSCSIHTCKKKCHPGLCGPCPEMIISKD------SPKKQIKCYCGNHT
KAFR0H03300        NRFSCEEECGLPLSCGIHTCKKKCHSGLCGSCPELLEVNE------EKCATIKCYCGLET
NDAI0G00670        SKFQCKDECGLPLSCGIHKCKRKCHSGLCGVCPERLEVNE------ENAWILKCYCGSET
NCAS0G03780        DKFQCDEPCGLPLACGLHRCQKKCHSGLCGICPEILNTKE------YLDAHIRCYCGSQD
                       *   *   :.*. * * . ** * ** *   :               . ***    

Ecym_3327          LDSIICKDVAVT---KMSRSGKHKKWIGVFSCKNIREVRYRCKEHSFNESCKPSPSPDAR
ADL213W            RNKMVCSEVSVV---ARSKVSKYKSWIGAFACDRMREVPYSCGKHSFHEKCIAPPSLPKR
KLLA0E08317g       KSGIQCSDLRVL---DYSKDVSGKKWIGVYSCGEVRTLHYSCDHHTYVEQCLAPAGIDRS
TPHA0D01530        KNEIMCKKLAIT--GTFSKNSEGDKWIGTFACKTRRIVFYACNEHSFIEPCQAQLSISGK
KLTH0G10406g       LPSIKCQDVKIQ---SKSQDGSGKKWIGAFACSRIRTVEYSCREHSFAEPCKAPPSIAGR
Kwal_27.11518      KPSLKCTEVRIE---GRSRDSSGNKWVGAFSCENIRTVEHSCKKHSFAEPCKAPPSISGQ
SAKL0E07634g       REQIICKDVKSV---AKSKNKSGEIWIGVFSCAHLRSVEYSCGHHSFQESCTAPPTNSGE
Kpol_1039.45       MDKIRCSNVKIHDSGKKSKDQEGNTWIGVFKCNKIRTVEYACKNHSFFETCTSPPTISGT
CAGL0M06919g       KDKIKCKDVRFPANAAYSKDDKGQRWIGVFMCDKIRKVPYECGEHSFYEKCKAPPSISGR
TBLA0B05950        LKEMNCKDVAFPSSGKISRNQEDKEWVGIFDCKEMRSVSYTCNEHVFVEGCIAPPTLPST
ZYRO0A01936g       SPSIRCGDVRVA--DRDSVDDQGNGWIGVFRCKDVRVVEYACGQHSFVESCKPAPSLPKQ
KNAG0H01990        RNSIKCKDVNVT--GRKSKNANGDEWIGVYACKDIRSVEYSCRQHSFFEECIAPPTVTGT
TDEL0G02190        RDSFKCKDVRVA--SDLSKDGKGDSWIGAFGCSGIRKIEYACREHSFVEKCQPSPSISGK
Suva_14.324        KDSIKCCEVNFPKSGRSSKDESGNEWIGVFACKDIRTVDYACHKHSFIEPCISPPTVNGK
Skud_14.306        QNSIKCSEARFPKSGRTSKDESGNEWAGVFACADIRTVDYACHKHSFIEPCLSPPTISGQ
Smik_14.308        RASIKCSEARFPKSGRSSKDGNGNEWIGVFACTDIRTVDFSCRKHSFIEPCLSPPSVNGR
YNL023C            RANIKCSETKFPKSGKSSKDENGNRWIGVFACADNRVVDYSCRKHSFIESCISPPTINGE
KAFR0H03300        KKSFPCKDVKAP--TTLSRDAEGNKWVGVFSCNKIRNVEYSCQKHSFVESCVAPPTVSGT
NDAI0G00670        QKSMKCKDIKIPESAKYSSDAEGNKWIGVFACKEIRTVQYDCDKHSFIERCIAPPTLSME
NCAS0G03780        RDTIKCRDVHVPLSASLSQNLKGEKWVGVFKCDNIRNVDYKCHEHSFVEQCIAPPTIDGT
                      : * .         *   . . * * : *   * : . *  * : * * .       

Ecym_3327          IQCPYSPNICKTCCCGNTTLIDMQQKREKCTDPIPTCDQRCGKPLSCGKHTCPMTCHPGK
ADL213W            TPCPYSPENCTTCPCGKTQLAELGSTRTACTDHISSCGKVCGKQLSCGNHTCPMTCHDGN
KLLA0E08317g       RPCPFSPKTLKTCPCGKTMLKELDKPRRKCTDTIPTCSNVCGKQLSCGKHTCPFSCHTGD
TPHA0D01530        KICPYTPKLLNSCPCGKTSLKQLAQKRKKCTDPIPTCENRCGKALKCGKHTCPYICHNGS
KLTH0G10406g       IPCPYSPKALKTCPCGETPLENMETPRTKCTDPIPTCDATCGKLLSCGRHRCPFKCHTGT
Kwal_27.11518      VPCPFSPRTLKTCPCGRSPLREMDVSRSQCTDPIPTCDSVCGKMLRCGKHKCPFKCHTGS
SAKL0E07634g       LACPFSPRLLKTCPCGSTPLKLLEAPRKKCTDPIPTCENRCNKPLKCGKHSCPFVCHDGP
Kpol_1039.45       KICPYSPKLLKTCPCGKTNLDDFENKRQKCTDPISTCENRCDKPLKCGKHKCPFTCHNGP
CAGL0M06919g       LICEFSPKKLKTCPCGKNELTDLSKPRSKCTDAIPTCGQVCGKMLKCGKHKCPFACHLGD
TBLA0B05950        VVCPFSPNLLKTCPCGKTALQDMDCERTKCTDPIPTCDNVCNKILKCGKHRCPFTCHTGK
ZYRO0A01936g       IGCPFSPNVLRSCPCGRTPLNKLGQARVKCTDHIPTCESKCGKKLACGKHTCPYKCHEGD
KNAG0H01990        KRCPFSPKYLKTCSCGKTPLQALGKARRRCIDPIPHCESRCDKLLKCGKHTCPFQCHDGP
TDEL0G02190        IACPFSPKLLKTCPCGRTSLKVLAEPRKSCTSPIPNCDSTCGKKLACGRHTCPFTCHDGP
Suva_14.324        KTCPFLPSLLKTCPCGRTALEELTKPRKHCTDPIPTCSSRCSKPLKCGKHSCPFICHDGA
Skud_14.306        KTCPFLPSLLKTCPCGRTALEELTKPRKHCHDPIPTCNSRCSKPLKCGKHLCPFTCHDGA
Smik_14.308        KVCPFLPSLLKTCPCGRTALDELTKPRKHCDDPIPTCNSRCSKPLKCGKHSCPFICHDLA
YNL023C            KACPFLPSSLKTCPCGRTALEELTKPRKHCDDPIPTCDSRCGKPLKCGKHSCPFTCHDKA
KAFR0H03300        KQCPFSPNLLKTCPCGRTPLNALSKPRLKCTDPVPTCEACCNKPLKCGKHRCPFTCHNGP
NDAI0G00670        KPCPYSPKLLKTCPCGKTPLQKLAKPRTLCTDPIPTCESHCNKPLKCGKHKCPFKCHTGA
NCAS0G03780        KPCPFSPKLLKTCPCGKTPLKELVESRKKCTDPIPTCDSRCGKPLKCGRHTCPFICHVGP
                     * : *    :* ** . *  :   *  * . :. *   *.* * **.* **  **   

Ecym_3327          CMDPCLQIEERKCSCQERTFLTPCQFDGKPSCNIKCENLMSCRRHRCIKRCCSGKPLALA
ADL213W            CMDPCLVITEQKCACEQRRFLVPCQFPHSPSCTAKCESLMSCRRHRCAERCCSGRPHSVK
KLLA0E08317g       CMDPCLIITKTPCTCHSKTFLTPCQLHDTPRCNIKCESNMSCRRHKCMEICCSGKPAAKK
TPHA0D01530        CMDPCIQLEVTNCSCLQKHFLVPCNFEQTPKCTFKCESLMSCRRHRCPKKCCTGKPEADK
KLTH0G10406g       CMEICTCSDKIKCSCNSRPFIVPCKFQGPPRCNTKCESLMSCRRHRCAERCCDGRSLAQV
Kwal_27.11518      CMEECLCTDKVKCSCHARQFIVPCKFQEKARCNTKCEALMSCRRHRCIERCCDGRSLAQS
SAKL0E07634g       CMDPCVSVDKVSCSCHSKSFLVPCQFHDEAHCNTKCESLMSCRRHRCTERCCSGRSLAIK
Kpol_1039.45       CMDPCTQIELRKCSCNYKEFSVPCQFHEKPRCNMKCESLMSCRRHRCTRRCCSGKPMADK
CAGL0M06919g       CMDPCTQIEKVRCACEQKQFTIPCGFNDHARCNLKCESLMSCRRHRCTERCCAGRPLAER
TBLA0B05950        CMDPCIQIDKMDCACERRTFLVPCQFKGKPVCKFKCESLMSCRRHRCMEYCCSGRPYAER
ZYRO0A01936g       CMDPCVQFEKTNCLCEARSFLVPCQFREDPRCNTKCESLMSCRRHRCTEKCCSGKPGAER
KNAG0H01990        CMDPCIQIDKVKCACERNTFLVPCGFQGAPHCQLKCESLLSCRRHKCAERCCSGRPAAEE
TDEL0G02190        CMDPCIQIETVRCSCHKNLYSVPCQFKEQPRCDTKCESLMSCRRHRCTERCCCGRPFAER
Suva_14.324        CMDPCLQTDSVKCACEQSTFLVPCGFQEKPHCNIKCESLMSCRRHRCIDRCCSGRPSALE
Skud_14.306        CMDPCLQIDSANCSCEQSTFSIPCGFQESPRCNIKCESLMSCRRHRCIDRCCSGRPSAIR
Smik_14.308        CMDPCLQIDSAKCACEQSTFSVPCGFQGRPRCNIKCESLMSCRRHRCTDRCCSGRPSAVK
YNL023C            CMEPCLQIDSVKCACEQSTFSVPCGFQGRPRCNIKCESLMSCRRHRCTDRCCSGRPSAIR
KAFR0H03300        CMDPCIQIDKKPCSCHQSFFLTPCQFEGEPHCNIKCESLMSCRRHRCTERCCSGRPLAEK
NDAI0G00670        CMDPCLQIETRKCSCEQQSFLVPCQFTGSPHCNIKCESLMSCRRHRCLERCCSGRPAAEK
NCAS0G03780        CMDPCLQIDKKKCSCNQQSFLVPCQFHQDPQCTTKCESLMSCRRHRCTERCCAGRPRAEA
                   **: *       * *    :  ** :   . *  ***  :*****.*   ** *.. :  

Ecym_3327          RSSTI-TPWLDKNDESLIEAEHICFKNCNRKLSCGLHHCTNKCHPGKCPPCLESDSNDLV
ADL213W            RNSRR--RRESPDDESEVEAQHVCLKDCNRVLLCGIHMCNYKCHAGKCPPCLESDSNDLI
KLLA0E08317g       REKTL-FLKRDLNNETLVEPEHVCLKQCNLKLSCGIHDCTWKCHPGKCPPCLESDPNDLV
TPHA0D01530        RKKML-LTREELNDESLVEAVHICLKECNLKLSCGIHDCTRKCHPGRCPSCLISDSNDLV
KLTH0G10406g       REKKV-FLTRDKLDESLVEAQHICLKKCNLKLSCGRHFCQRKCHPGNCPPCLESDSNDLV
Kwal_27.11518      REKKV-FLTRDKLDESLVEAQHICLKQCNLKLSCGKHFCKRKCHPGNCAPCLESDSNDLV
SAKL0E07634g       REKTI-FLARDRLDESLVEAQHICLKPCNLKLSCGIHYCRRKCHPGKCSPCLESDSNDLS
Kpol_1039.45       RKKML-FSQADLLDESLVEAEHICLKDCNLKLSCGIHNCTRKCHAGKCPPCLESDSSDLV
CAGL0M06919g       RRKTMKINVRDLADESTIEPIHICLKDCNLTLSCGIHKCNRKCHAGKCPPCLESDSNDLV
TBLA0B05950        RKKTI-LRSSDRNDETLVEAEHVCLKDCNLKLSCGIHTCQRKCHPGPCPPCLESDSNDLV
ZYRO0A01936g       RKKTP-FTSRELLDESLVEAEHVCLKSCNLTLTCGRHKCQRKCHPGRCPPCLESDPNDLV
KNAG0H01990        RRKNS-SRFQDVNDETLMEAEHVCLKACNLTLSCGQHQCQRKCHPGKCPPCLESDSNDLV
TDEL0G02190        RRKTP-LSSRELMDESSVESEHICLKDCNLTLSCGCHKCQRKCHPGKCPPCLESDSNDLV
Suva_14.324        RKKRI-FRSQDLMDESLVEAQHICLKPCNLTLSCGIHKCQRKCHPGKCPPCLESDSNDLV
Skud_14.306        RKKSF-FRSQDLLDESLVEAKHICLKPCNLTLSCGLHKCQRKCHPGKCPPCLESDSNDLI
Smik_14.308        RRKNF-FRSQDLLDESLVEAKHICLKPCNLTLSCGIHKCQRKCHPGKCPPCLESDSNDLI
YNL023C            RKKNL-FRTQDLLDESLVEAKHICLKPCNLTLSCGIHKCQRKCHPGKCPPCLESDSNDLV
KAFR0H03300        RKKTL-FRSSDINDETLVEAQHVCLKECNLMLSCGKHRCQRKCHPGKCPPCLESDSNDLV
NDAI0G00670        RKKTL-FRSQDLMDETLVEAEHICLKECNLLLSCGIHRCQRKCHPGKCPPCLESDSNDLV
NCAS0G03780        RKKRL-FRSQDLMDESLVEPQHICLKECNLMLSCGKHKCQRKCHPGKCPPCLESDSNDLV
                   * .       .  :*: :*. *:*:* **  * ** * *  ***.* *..** **..** 

Ecym_3327          CPCGKSVILAPVRCGTVRPNCNYPCINTLRGSMPCGHRAPFHKCHPSTEDCPPCTAFVYK
ADL213W            CPCGKTIVPAPVRCGTKLPRCTHPCRNSLLDTWPCGHSPPSHNCHPLDEPCPPCTITVKK
KLLA0E08317g       CPCGKTVVPAPVRCGTKLPPCPNPCIKISEGPAPCGHRVGPHKCHPAGTDCPPCTANVIK
TPHA0D01530        CPCGKTVIEAPVRCGSKLPPCPFECIKVIERSYPCGHKPPPHQCHPSTEPCPPCTAVVER
KLTH0G10406g       CPCGKTVAPAPVRCGTVLPPCRNPCIKTLQGPLDCGHPPMPHACHSLDEPCPSCTAPVFK
Kwal_27.11518      CPCGKTVVPAPVRCGTVLPRCLHPCIKTLQGPAPCGHPPMPHPCHPLEEPCPSCTAPVFK
SAKL0E07634g       CPCGKTVVPAPVRCGTKLPPCRHPCIKTLQADTVCGHPPMPHECHSLEQPCPQCTAPIYK
Kpol_1039.45       CPCGKTVVEAPVRCGTKLPECIFPCIKYIEGSYPCGHKPGNHYCHPADIPCPPCTEVVFK
CAGL0M06919g       CPCGKTIVEAPVRCGTKLPNCPYPCIRVVRGETDCGHSPMPHECHPPDIPCPDCTATVFK
TBLA0B05950        CPCGKTVIPAPVRCGTTLPPCKYPCIKVIRGESDCGHKPMPHSCHSLDQPCPVCTAPVFK
ZYRO0A01936g       CPCGKTVVEAPVRCGTKLPPCPYSCISVVRDGYPCGHTPMPHLCHPPEEKCPPCTANVKK
KNAG0H01990        CPCGKTIVPAPVRCGTKLPSCRHPCIKVVEGISECGHKPIPHACHPLDQPCPPCTATVFK
TDEL0G02190        CPCGKTVVEAPVRCGTRLPPCHYPCIRVIQNAYKCGHKPMPHTCHPLNEPCPSCTAPVFK
Suva_14.324        CPCGKTVIPAPVRCGTKLPLCNYACIKVVRGESECGHKPMPHTCHPLDLACPPCTETVFK
Skud_14.306        CACGKTVVPAPVRCGTKLPTCNHPCIKVVRGESWCGHKPMPHTCHPSNISCPPCTETVFK
Smik_14.308        CPCGKTVVPAPVRCGTELPVCNHPCIKVVRGESSCGHKPMPHTCHPLGVPCPPCTETVFK
YNL023C            CPCGNTVVPAPVRCGTKLPTCNHPCIKVVRGESTCGHKPMPHTCHSLDVSCPPCTETVFK
KAFR0H03300        CPCGKTVVEAPVRCGTKLSPCLFPCIKVIRNESVCGHPPVPHSCHPLDQPCPPCTATVFK
NDAI0G00670        CPCGKTIVEAPVRCGTKLPPCPFQCIKVVRNEYPCGHTPMPHTCHPLDEPCPPCTAPVFK
NCAS0G03780        CPCGRTIIEAPVRCGTKLPPCPYPCIKVVRGEYPCGHTPMPHTCHPLNEPCPPCTASVFK
                   *.**.::  ******:  . *   *         ***    * **.    ** **  : .

Ecym_3327          PCKCGKLTAARTICFQND--ISCGRKCAAKLTNCHHLCQKQCHPPGECPNTCTEVCGLKR
ADL213W            TCRCGKNE-IRTFCYNDD--VSCSRPCKKPLSYCNHFCQVPCHSDGQCQQTCKQACGLPR
KLLA0E08317g       KCRCYKKHDMRTLCLVPDSQVACGTECGLPLATCHHKCQKKCHVEGECEIKCAKPCGLKR
TPHA0D01530        PCKCGKHHAVKAVCFQEF--GSCGEICNKELENCHHKCQYKCHEIGQCQKSCKQVCNKDR
KLTH0G10406g       QCKCGKNKKVRTLCFQNN--VSCGRVCGKQLVSCHHSCTKTCHREGECQSICKQVCGISR
Kwal_27.11518      SCKCRKNDKVRTLCFQND--VSCGRVCGKQLAGCQHICQKACHKEGECQTSCKQPCGKTR
SAKL0E07634g       KCKCNKVEKVRTLCFQND--VSCGKICGLPLKNCSHTCKRTCHEPGQCQTICKQICGLPR
Kpol_1039.45       PCKCGKEQKAKALCFQET--ASCGKLCEKKLDGCHHYCQLKCHLPGECQKKCTQICNKRR
CAGL0M06919g       PCKCGKEQRVRTVCFMKD--VSCGKVCGERLQTCYHKCQKKCHEPGACQTVCKQTCNMPR
TBLA0B05950        PCKCGKKDKVRTMCFQED--VSCGLPCGLPLKDCYHKCQKRCHLPGECQNTCIQICNAKR
ZYRO0A01936g       PCKCGKKSDVRTLCFQQD--VSCGQICNKPLGSCRHTCQKKCHDGG-CQVKCRQICGKKR
KNAG0H01990        PCKCGKNSRVRTICFQKD--VSCGQTCGKPLPNCHHFCQKTCHLPGQCQATCKQVCNKPP
TDEL0G02190        PCKCGKKDKVRTLCFQND--VSCGTTCGKPLDNCPHMCQKSCHIPGECQKKCKQICNRKR
Suva_14.324        PCKCGKKDKVRTVCFQTD--VSCGTTCGKPLSGCHHTCQKTCHLPENCQKVCKQICRQKR
Skud_14.306        PCRCGKKDKVRTVCFQAD--VSCGTSCGIPLSGCYHTCQKTCHLLGKCQKVCKQICGQKR
Smik_14.308        PCKCGKKDKVRTVCFQKD--VSCGTKCGLLLHFCRHTCQKTCHLPGNCQKVCKQICGHER
YNL023C            PCKCGKKTKVRTVCFQTD--VSCGIKCGIPLSYCYHTCQKTCHLPGNCQKVCKQTCGQKR
KAFR0H03300        PCKCGKRDKVRTVCFQKD--VSCGKICGLPLLTCHHKCQKVCHPNGECQVKCKQVCRKKR
NDAI0G00670        PCKCGKVKEVRTLCFQND--VSCGKICGLPLKDCPHKCMKRCHIPGDCQTKCKQICGKRR
NCAS0G03780        PCKCGKVDKVRTLCFQND--VSCGKICGLPLENCNHTCQKRCHLLGECQKTCKQICKKKR
                    *.* *    .:.*       :*.  *   *  * * *   **    *   * : *    

Ecym_3327          SACEHLCTANCHGDEICPDVPCLEEVVVSCGCGRRSLKVPCGAYKDKES-ATATQSLLCD
ADL213W            KACEHVCKAKCHGHTACPESPCTEKKTITCSCGHKSSTKICSEYAGKDDGIGASQHLSCD
KLLA0E08317g       SLCGHLCKEKCHGNSPCPEKVCHEKVVITCDCNRRTKQVECGATHDTQS-RSETEKLPCD
TPHA0D01530        ANCNHQCKSKCHGSSPCPDVPCNEVTKVSCKCGRKQEYRKCYATLDNSS-ASI-ELLPCD
KLTH0G10406g       SNCSHICRFKCHTGSPCPDVPCNVTVEVKCGCGHRSSFATCAAHEGQDP-ADQRP-LECT
Kwal_27.11518      ENCEHRCRALCHSGTPCPDKPCLNLVDIKCNCGHRSTTVTCGANENRAP-AEETA-LECN
SAKL0E07634g       KFCEHKCFARCHPGKDCPDEACQVKVKVTCSCGRKESILPCDAHADQPS-SKLLITLPCD
Kpol_1039.45       VNCSHTCDQKCHGDSNCPDIPCKVKCEVYCGCGRRKELLLCGATSTTQS-VELTKVLPCD
CAGL0M06919g       LYCNHRCPKPCHKFEECPDIPCTALVKITCPCGRIEKEVTCGVYSKNKE-AQDSTRIVCD
TBLA0B05950        SNCSHGCTQRCHKNAPCPDIPCTVPVTVVCDCGRRKLVKPCSSTSTIDS-VTITSHLECD
ZYRO0A01936g       VNCDHKCPKPCHGGEPCPDFPCPFSVVIKCACGRKESTEPCGTNSQTLS-ASVTRELSCD
KNAG0H01990        VNCAHKCRKSCHGRLTCPDILCIALVKIRCPCGRKEVEVTCGATSTLSS-SLFTERLECD
TDEL0G02190        IYCDHKCRLICHGNDKCPDIPCPLSVKIKCECEVKESFITCGANSETPS-KATTTILPCD
Suva_14.324        PNCDHACPKPCHGRSECPDLPCASLVKITCKCGRIEKKVACGAKSNVVS-VTEAPQLDCN
Skud_14.306        LDCIHTCPKPCHGKTECPDLPCAALVKITCECGRIKKSITCSAKRDTVS-VITSSILDCN
Smik_14.308        LSCRHTCPKPCHGKTECPDLPCPTLVKITCKCGRNEKSVTCSAKSGVVP-ANESSVLDCD
YNL023C            LNCNHECPKPCHGKTECPDLPCATLVKIYCKCGRIKKSVTCGAKSDRVS-VTESSVLDCN
KAFR0H03300        VNCVHECLKSCHGSTECSDSPCPVSTKISCPCGRRESYVTCNATSTIDS-AALITRLDCN
NDAI0G00670        INCDHTCSRPCHGNTECPDVPCTVSAKVTCECGRRETYVTCGAMSNIAS-AVTTTILECD
NCAS0G03780        INCEHTCLKPCHGKTDCPDIPCSVSIKITCECGRKETYVTCGATSTIPS-AATKTHIECD
                     * * *   **    *.:  *     : * *        *               : * 

Ecym_3327          DDCAKVQKHQMLLQTLRSSES-TNK-------AEHGSSSVINKPTSYEDLGLPYSEQMMC
ADL213W            EDCAKFQRHQQLMRAFGVVEK-ATS-------EEDEALLLAQRSQSFDDLHLPFTEYVLS
KLLA0E08317g       EECAKLQRHMELMEAFGMNEK-PKN-------TKEQLESIVLVAKKFDDLNMPYSELVLN
TPHA0D01530        EDCEAHARHLQLRDAFGYDSS-LDTSNK----NIQDIQSLMEKVSTYEELRLPYPQSVIS
KLTH0G10406g       EDCAAARRRLELMEAFGMNTE-TVQPTE----GIVDLAALAEKVTTFQELMLPFTEASLS
Kwal_27.11518      NDCDVARRHHELMEAFGIKND-ANQGSK----SLEDLEALAEKVSTFQELLLPFSEATLS
SAKL0E07634g       DKCEESKRHRMLMEAFGIKEK-LTA-------PVEELRDLVESAKSFDELHLPFTESTLS
Kpol_1039.45       DACLKYQRLEELRNAFGMKSS-SEDPES----ELERLKKIVEKVTSYEELELPFSETVLS
CAGL0M06919g       EECAVLQRHMQLKEAFGIVDK-PQNTHNE---EMARLEQVISTASTFADLDLPFTEPVIT
TBLA0B05950        EECMLLLRRMELKAAFGIVNGLGDDKTSV---AIERIQNRISVAKAYEELELPFVEAVLT
ZYRO0A01936g       EECERVKRCAQLKDALGLKEN-GDS-------SVENTVSNALVASNFEELGLPFRETVLA
KNAG0H01990        EECEAYTRHRQLKEAFGITDK-VANGSAMKEKEGTRLEGLASKATTFEELQFPFTESTIS
TDEL0G02190        EECERHKRHLQLREAFGISNF-SDNPSRS---KTASLENLAAVANSFEELELPFSEPALG
Suva_14.324        EECEALKRLKELREAFGISEE-SNESTNN---ELDTLKKLVSVATTFEELQLPFTETVLS
Skud_14.306        EECETLKRLKELREAFGVSEG-PNNVIRN---ELDALSELVSVAKTFEELQLPFTEATLS
Smik_14.308        EECEALKRLKELREAFGIKEE-SNNVTSN---ELDALKKLVSVATTFEELHLPFTETTLS
YNL023C            EECEALKRLKELKEAFGIKEE-TNNFTSN---ELDALKKLVSVATTFEELQLPFTEAALS
KAFR0H03300        EECEVVKRHRELREAFGIVEK--EEPENL---GTERLQSFAQSATNYDDLQLPYTEPALV
NDAI0G00670        EECEMLERHRQLKEAFGIKEI-ISSSTDL---EFERLKDIVPTAIAFEELQLPFTEATLS
NCAS0G03780        EECELLERHRQLKEAFGIVD--SNRSTSL---EVEKLKDLAKVATTFEELQLPYNETTLS
                   : *    .   *  ::                              : :* :*: :  : 

Ecym_3327          VFSKQATWCKNIQDSLIRLLEDKSRKSLHFKPMKAPQRQFVHELSKAFGLYSESQDREPK
ADL213W            VFTKQSQWCTQIEQYLIKLMDDSSPKALHFKPMRAAQRRFVHELSSSFGLYSESQDPEPK
KLLA0E08317g       VYKKQVNWCDQICAVFDKFIEDTQKLSLHLKPMRVPQRQFIKELASAYALYSESQDREPN
TPHA0D01530        TYSKQIKWCSQIEDILRKFVLDKAKNNLHFKPMKPAQRHFVRELSTSFNLYSESQDPEPK
KLTH0G10406g       IFAKQSNWCSQIEEHLNRLMSDISKPSLHFKPMKPPQRHFIHELAQAYKLYCESQDKEPK
Kwal_27.11518      IFSKQTTWCTQIEECLERLMNDKNKPSLHFKPMRPPQRHFIHELGQAYHLYCESQDQEPK
SAKL0E07634g       VYSKQRAWCNQIESFLSKLMRDVTRTSLHFKPMKLPQRRFIHELANAYALYSESQDREPK
Kpol_1039.45       VYSKQTNWCNQIEELINKFVNDKNKPSLHFKPMPAPQRNFIHALVEAYEMYSESQDREPK
CAGL0M06919g       TYIRHENWCTDIENTLNKLIDDNNRTSLHFKPMRPPQRYFIRELAKAYNLYSESQDPEPN
TBLA0B05950        VYAKQPKWCSQIEGILNKFMDEKLKSSLHFKHMKAPQRSFVHNLADAYKIYSESQDPEPV
ZYRO0A01936g       IYSRQQRYCDNIESVLNNFIDDEKKSSLHFKPMKPAQRHFVHELAKAYKLYSESQDPEPK
KNAG0H01990        TYIRQNKWCGEIEETLNNFMDNEGKSSLHFKPMKPPQRLFIRELAKAYNLYSEAQDPEPK
TDEL0G02190        TFAKQEAWCTQIENVLNSFMDNEEKTSLHFKPMRPAQRHFIHELAKSYNLYVESQDREPK
Suva_14.324        VYAKQEGWCLQIENIVNKLMSDKTRSSLHFKPMRPPQRHFIRELAKAYNLYSESQDREPM
Skud_14.306        VYSKQERWCLQIEGILNKLMDSEIRSSLHFKPMRPPQRHFIHEMAKAYNLYAESQDREPM
Smik_14.308        VYSKQERWCSQIEVILNKLMDDKTRSSLHFKPMRPPQRHFIRELAKAYGLYSESQDREPM
YNL023C            VYSKQERWCSQIEAILNKLMDDKTRSSLHFKPMRPPQRHFIRELAKAYGLYSESQDREPM
KAFR0H03300        AYTKQPNWCEQIEELLIKFMDDNSRPSLHFKPMRPPQRYFIHEIAKAFNLYAESQDREPK
NDAI0G00670        IFSRQERWCQQIEEIINKFMDDKSRPSLHFKPMRPPQRHFIHELSKAYNLYCESQDPEPK
NCAS0G03780        IYAKQEKWCDQIEEILNKLMDDKARPSLHFKPMRPPQRHFIQEFAKSFNLYAEAQDREPK
                    : .:  :* :*   .  :: .     **:* *  .** *:. :  :: :* *:** ** 

Ecym_3327          RSVFVKILKT--SKIPAIGLSEALLLYQRMKTFQKERRDLELQHNTTKILISIPIDD-GS
ADL213W            RSVYVKK--TGISRVPAIGLSKAAPLYTSFKKLEREFKANS-ESAVTKKLVSVHIDD--S
KLLA0E08317g       RSVYLKKIQS-QSKKPELTLKDASELYQLFKTLEKERMQEHYSTKVTKTLINIPASE--T
TPHA0D01530        RSVFVKRKVD--TRIPNISLEEVLPLWTGFKKLEKERKIQHFESTSQRKYINYEPKE---
KLTH0G10406g       RSVYVKKTVD--SRKPSLSLKEALPLYQSFKNAQKERKLKELERSTTTRILNYTSTG---
Kwal_27.11518      RSVFVKKTAD--SQRPSISLKVALPLYYSFKSAQREKKLKETERHTTTRIINYAVTD--Q
SAKL0E07634g       RSVFVKKVEN-KSHIPLLCLGEALPLYHSFKQLQKERKVKELEKSTTRRLFNYTVDD--A
Kpol_1039.45       RSVYLKKNKY--TRIPNISLEEALPLYQSYKKIEKERKVQSFESKKNVTYLNYQPPE---
CAGL0M06919g       RSVFVKKNLDGSSTKPILSISEAAPLYQSYKKLEKEKKQANFESMTTTRLINFTPEM--S
TBLA0B05950        RSVFVKKLTNGTSSKPILTLEEALPLYESFKEVQKEKKKQEYEARTHKTLINVEAET---
ZYRO0A01936g       RSVYVKKELNGESNKPSITLQEALPIYQAFKQREKETKIRRYEMQNVTNLVNFVPKF---
KNAG0H01990        RSVFVKKNDDGSSAKPIFSLSEIAPLYQSFKLLEKERKMQDFLAKTTTHLINVKLNDDVA
TDEL0G02190        RSVFVKKQDNGGSCKPVIQLKDSLPIYQFFKENEKEKKAQRFEAQTTTEFVNFIPKE---
Suva_14.324        RSVFIKKEDNSKSSRPILSLAEAFPLYESFKELQKERKIQEFQARTTAKLINFEVRD--A
Skud_14.306        RSVFIKKEDNCTSKKPVLSLAEAYPLYESFKQSQKERKLQEFQARTTAKLINFEVQD--A
Smik_14.308        RSVFIKKEDNGTSNKPVLSLGEALPLYESFKQLQKERKVQEFQSRTTAKLINFEVQD--A
YNL023C            RSVFIKKEDNGASNKPVLSLAEAYPLYESFKQLQKERKAQEFQARTTAKLINFEVQD--T
KAFR0H03300        RSVFLKKNDDGTSLKPALRLSDVLPVYQNFKKLEKERKAKQFEARTTARLMNITLDD--T
NDAI0G00670        RSVFIKKNTT--SSKPSFSLSKVLPLYQTFKELEKERKLQEFEARTSKRLVNVEVPE--G
NCAS0G03780        RSVFVKKEEDGSSSKPIISLHDALPLYQTFKELEKERKLKEFEARTTTRLINVEAPQ---
                   ***::*      :  * : :     ::   *  :.*              ..        

Ecym_3327          DSKTLEASCNAILITGVPRTVTVENIKACFDECLKQTLLKDPQFRLINS--NAYIYPSNF
ADL213W            PESQHDAAINAILLSGLTSFASESALRDCFADYFSQTLLNCPQYVV--RGTEGYIFPTDY
KLLA0E08317g       PLPAPYEGPNAIVISGVFDSSQIDNIEPLVHDFLKYTLVKTPQYRFLKDLNSVLIFPENY
TPHA0D01530        VIVKSSNDTNGFFIKKISPGITEEDLSEVFGKALKSTLIKNVCYKILPESSDAIIYPEQY
KLTH0G10406g       ESSPPVAQINGLLIQKVFEGTDEKTIEACFADYLKHTLIKDPNYLKLDSG-DVMVFAENY
Kwal_27.11518      AQTPPAARFNGLLVQNVLNGINEKAIQESFSEYLKHTLLKDPHYLLLASG-DVLVYCDDY
SAKL0E07634g       NDVPHNAEFNCFLVKGVAPGVTKDELSDCLAEYLQFTLIQNPSYQTLENG-DFLIYPEDH
Kpol_1039.45       RSLTPDVKYNGFLIKGITFGTTTDDLNTLFGVHLKPTLIKDAQYSILPDGKSAIVYPKDY
CAGL0M06919g       PELESAARFNGFLVTNVGEFTSTDDLQNLFAPYLKSTLVVEPQFQILPERKQAVIYPNKY
TBLA0B05950        QTQQSATKYNGFLIKNLVKGTTEEDLERIFGESLKPTLVKDPQYLVMDESHHGFICPADY
ZYRO0A01936g       EPTVELAKYNGFLIRNLTDGTNGEDLQRIYGEHLKPTLVRNPVYKALPDRNIALIFPESY
KNAG0H01990        TGAQHSGQNNAFLIKNISAGTTLQDLKNLFGKYMEKTLIRNPQYQELPEENSAIVYPEDY
TDEL0G02190        EPQLERAKNNAFKLKNVSTGTTKEDLERIFADHLKPTLVKNPQFKIQDSTKNGLIYPEDY
Suva_14.324        EPKVELAKNNGFLVQKLVNGNDVDDLRRFFEPHLKHTLVVKPQYLIIDDGKTALVYPENY
Skud_14.306        ESKIEAAKNNGFLVQNLVSGNTVEDLKRFFEPHLKHTLVANPQYLILDDSRSALIYPENY
Smik_14.308        QPKVEVAKNNGFLVRNLVTGNTVEDLKRFFEPHLKHTLVVNPQYLILDDGKTALVYPENY
YNL023C            EPKVEVAKKNGFLVQNLVAGNTAEDLRRFFEPHLKHTLVVNPQYLILDDGKTALVYPENY
KAFR0H03300        LEERKKFENNGLIIKNLSNGITLEFLSEFFNKFFKSTLIKNPQYLIIEN--NGLIYPESH
NDAI0G00670        PTDNYIAEANGFLIKDLSPGTTVEDLERIFGQYLKSTLIKNPQYLVLQDGKSGVIYPEDY
NCAS0G03780        EDNVYHAKYSGFLIKKISPGTTVEDLQRIFGQFLTSTLIVNPQYLIIQDGKDALIYPENY
                            . : :  :      . :       :  **:    :          :   ..

Ecym_3327          LEISANVETDIQRLVPYFSHVCERKQIGYNVSAHKLTADF------------NKTSQALN
ADL213W            LSLSANAEKDLTKLAGYFRLLFQEQNLWTDISTCKLDSNL------------NRIGSCES
KLLA0E08317g       SGITKNTASDMEKVIPFIKTALQDQMLATGVEMCQVDENL-----------------SLV
TPHA0D01530        NSITESVHQDLEVLVGHFDFIGKEALIFDSIMLCNVEGYINQ--------ISDCTDTDKE
KLTH0G10406g       ATASINVERDINRVVGHLDLIAKDSFLAEGVTVCRVEQVMAE----------ETNRSDES
Kwal_27.11518      STASVNVENDIERIVGHLDHIVKEQLLAEGVYATRVQSFL------------DDLESSTS
SAKL0E07634g       MSISENVENDIKRLAPYISSICKEKQISEGVKLYKIDENLKT------FTSEEYLQEEQP
Kpol_1039.45       LTISENVERDIESLAGHFDYMTKEAMLGESVEMCNITDIL-------------QTESAEP
CAGL0M06919g       KEISINVERDMETLVQHFDFLIKESLLAGGVELCNIENVLAE------------------
TBLA0B05950        AEISINVERDMEQLIGFFDSLCKEHFIGDIVELCNIDEALLQENVDLEDSEEEKLTSPEV
ZYRO0A01936g       SDVTVNTECDMERLVGHFDFICKEMFIGDGVELCQVGEYL----------------QPEA
KNAG0H01990        RTISANAVNDMENLVGHINFIVNDAFLADSAELCDASSKLPEEIS--ENDISERLETPEV
TDEL0G02190        AEISVNVERDLEALVGHFDYLCKESFIGDGIELCHIDLKV--------------LQESE-
Suva_14.324        QEVSVNTERDMDILVGHFDFMAKEAFLADSISLCSIDEELG-----------RRLDPPVT
Skud_14.306        ETASVNTERDMELLVGHFDFMAKEAFLADSIHLCSVDEEIG-----------KRLDSPAI
Smik_14.308        ETASVNTERDMELLVGHFDFMAKEAFLADSILLCSTDEEVG-----------KRLDTPVI
YNL023C            ETASVNTERDMELLVGHFDFMAKEAFLADSISLCSTEEELE-----------RRLDTPVI
KAFR0H03300        NEITQGVYNDLDMLVGHFNVIVKEELIGDSVEMCNIENELPE----------ERLETPRL
NDAI0G00670        PTITANVERDFKSLVGHFDVLAKDTFISEGVELCKIDDVLST----------ERLATPAI
NCAS0G03780        QEMSAGVERDLETLVGHFDFISKENFIADGVELCDVEVAMLG----------ERLETPIL
                      : ..  *:  :  .:    :   :            .                    

Ecym_3327          NSFISTEDPDF---------------------
ADL213W            PAADCLGQ------------------------
KLLA0E08317g       SQA-----------------------------
TPHA0D01530        KDSTSTSNE-----------------------
KLTH0G10406g       SVAEAPEDPLFV--------------------
Kwal_27.11518      DAATSISNSELTTLAQENSEQ-----------
SAKL0E07634g       EKQASFEINTDGEVAVINTDKGTCEFPDSVST
Kpol_1039.45       SEETTTV-------------------------
CAGL0M06919g       --------------------------------
TBLA0B05950        ENDSDIHDSPKN--------------------
ZYRO0A01936g       PTESS---------------------------
KNAG0H01990        QEQN----------------------------
TDEL0G02190        --------------------------------
Suva_14.324        QGDSLAKEEN----------------------
Skud_14.306        QEVSSPEEKDM---------------------
Smik_14.308        QEDTSIEDKNK---------------------
YNL023C            QEDSPVMDNNT---------------------
KAFR0H03300        ETPGLESDDE----------------------
NDAI0G00670        DESTP---------------------------
NCAS0G03780        EE------------------------------
                                                   

FASTA FORMAT for MUSCLE Version 3.6

>Ecym_3327
--------------------------MLNTSERS--------SEVEEVSYSD--------
-------YL-------SEADDD--GLPYYEKAIKDIQNGYLYQCLICTVEIDSTCRMYAC
SNCYRVYDYECIMEWAKKSSKRSADSTWKCPNCYHSYNKVLPKKRSTCWCGKQINPEKNA
TYPNSCGQTCGASICKHGCASTCHLGPHPKCMVPVGLKCKCGKITEQISCYQTKAV---K
PKLSCKLPCGLPLPCGVHTCQKICHSGPCGRCNTVMSGK------------FKCYCGSNH
LDSIICKDVAVT---KMSRSGKHKKWIGVFSCKNIREVRYRCKEHSFNESCKPSPSPDAR
IQCPYSPNICKTCCCGNTTLIDMQQKREKCTDPIPTCDQRCGKPLSCGKHTCPMTCHPGK
CMDPCLQIEERKCSCQERTFLTPCQFDGKPSCNIKCENLMSCRRHRCIKRCCSGKPLALA
RSSTI-TPWLDKNDESLIEAEHICFKNCNRKLSCGLHHCTNKCHPGKCPPCLESDSNDLV
CPCGKSVILAPVRCGTVRPNCNYPCINTLRGSMPCGHRAPFHKCHPSTEDCPPCTAFVYK
PCKCGKLTAARTICFQND--ISCGRKCAAKLTNCHHLCQKQCHPPGECPNTCTEVCGLKR
SACEHLCTANCHGDEICPDVPCLEEVVVSCGCGRRSLKVPCGAYKDKES-ATATQSLLCD
DDCAKVQKHQMLLQTLRSSES-TNK-------AEHGSSSVINKPTSYEDLGLPYSEQMMC
VFSKQATWCKNIQDSLIRLLEDKSRKSLHFKPMKAPQRQFVHELSKAFGLYSESQDREPK
RSVFVKILKT--SKIPAIGLSEALLLYQRMKTFQKERRDLELQHNTTKILISIPIDD-GS
DSKTLEASCNAILITGVPRTVTVENIKACFDECLKQTLLKDPQFRLINS--NAYIYPSNF
LEISANVETDIQRLVPYFSHVCERKQIGYNVSAHKLTADF------------NKTSQALN
NSFISTEDPDF---------------------
>ADL213W
-------------------------------------------MLRDMPLDA--------
-----------------TAKLE--GIPYYEQTVLELRDGETYQCLICTVEMDASCPMYAC
HQCYRVYDYECIRRWALKATSTTVDRTWKCPNCYHVNRKVPPKNRHTCWCGKQVNLDPNY
INPNSCGQTCGAPICQHGCSKLCHLGPHEECMVRIDFKCRCGKLTEEIPCYEAKAA---K
RNFSCDQPCGLPMPCGIHKCERVCHNGPCGPCKEEIAGD------------IKCYCGLTT
RNKMVCSEVSVV---ARSKVSKYKSWIGAFACDRMREVPYSCGKHSFHEKCIAPPSLPKR
TPCPYSPENCTTCPCGKTQLAELGSTRTACTDHISSCGKVCGKQLSCGNHTCPMTCHDGN
CMDPCLVITEQKCACEQRRFLVPCQFPHSPSCTAKCESLMSCRRHRCAERCCSGRPHSVK
RNSRR--RRESPDDESEVEAQHVCLKDCNRVLLCGIHMCNYKCHAGKCPPCLESDSNDLI
CPCGKTIVPAPVRCGTKLPRCTHPCRNSLLDTWPCGHSPPSHNCHPLDEPCPPCTITVKK
TCRCGKNE-IRTFCYNDD--VSCSRPCKKPLSYCNHFCQVPCHSDGQCQQTCKQACGLPR
KACEHVCKAKCHGHTACPESPCTEKKTITCSCGHKSSTKICSEYAGKDDGIGASQHLSCD
EDCAKFQRHQQLMRAFGVVEK-ATS-------EEDEALLLAQRSQSFDDLHLPFTEYVLS
VFTKQSQWCTQIEQYLIKLMDDSSPKALHFKPMRAAQRRFVHELSSSFGLYSESQDPEPK
RSVYVKK--TGISRVPAIGLSKAAPLYTSFKKLEREFKANS-ESAVTKKLVSVHIDD--S
PESQHDAAINAILLSGLTSFASESALRDCFADYFSQTLLNCPQYVV--RGTEGYIFPTDY
LSLSANAEKDLTKLAGYFRLLFQEQNLWTDISTCKLDSNL------------NRIGSCES
PAADCLGQ------------------------
>KLLA0E08317g
------------------MTAEELIYPESEPRLY--------SSDSDFDSDN--------
------------------DEDT--NIPYYEQTVKEIKDGDQYVCMICTVELDSTCRMYAC
DSCYRVFDYECVREWALKSTNKTLDKSWKCPNCYKINHKIPKQKRSTCWCGKVVNPDVNE
LDPNSCGQTCNAYSCVHGCSKVCHLGPHPECLIPVQIKCKCGKHCKQIPCSRSKVL---G
NSYNCGDVCGLLLPCGKHTCQKTCHTGFCGPCESIIKTE------------LPCYCGSDV
KSGIQCSDLRVL---DYSKDVSGKKWIGVYSCGEVRTLHYSCDHHTYVEQCLAPAGIDRS
RPCPFSPKTLKTCPCGKTMLKELDKPRRKCTDTIPTCSNVCGKQLSCGKHTCPFSCHTGD
CMDPCLIITKTPCTCHSKTFLTPCQLHDTPRCNIKCESNMSCRRHKCMEICCSGKPAAKK
REKTL-FLKRDLNNETLVEPEHVCLKQCNLKLSCGIHDCTWKCHPGKCPPCLESDPNDLV
CPCGKTVVPAPVRCGTKLPPCPNPCIKISEGPAPCGHRVGPHKCHPAGTDCPPCTANVIK
KCRCYKKHDMRTLCLVPDSQVACGTECGLPLATCHHKCQKKCHVEGECEIKCAKPCGLKR
SLCGHLCKEKCHGNSPCPEKVCHEKVVITCDCNRRTKQVECGATHDTQS-RSETEKLPCD
EECAKLQRHMELMEAFGMNEK-PKN-------TKEQLESIVLVAKKFDDLNMPYSELVLN
VYKKQVNWCDQICAVFDKFIEDTQKLSLHLKPMRVPQRQFIKELASAYALYSESQDREPN
RSVYLKKIQS-QSKKPELTLKDASELYQLFKTLEKERMQEHYSTKVTKTLINIPASE--T
PLPAPYEGPNAIVISGVFDSSQIDNIEPLVHDFLKYTLVKTPQYRFLKDLNSVLIFPENY
SGITKNTASDMEKVIPFIKTALQDQMLATGVEMCQVDENL-----------------SLV
SQA-----------------------------
>TPHA0D01530
------------------MSDREITSQIETAAGN-----------TESSSDEESYSKGSN
ESNFDS----------SEDEDD--GLVYYEQTIRDISKGDRYTCMICTIEMDYTCKMYAC
QSCYRVFDYECIQEWAEKSASKTIDKVWKCPNCSHSSKQIPLRNRPTCWCGKVINPDPNE
LSPNSCGQTCNKKTCVHGCKNFCHLGPHGECSVITTLKCKCGRNEKDIFCHQLKKSNK-N
NVYQCNEVCQLPLACGVHKCKRVCHSGLCGACPEILSSEQIQSVESNENRKFKCYCGENS
KNEIMCKKLAIT--GTFSKNSEGDKWIGTFACKTRRIVFYACNEHSFIEPCQAQLSISGK
KICPYTPKLLNSCPCGKTSLKQLAQKRKKCTDPIPTCENRCGKALKCGKHTCPYICHNGS
CMDPCIQLEVTNCSCLQKHFLVPCNFEQTPKCTFKCESLMSCRRHRCPKKCCTGKPEADK
RKKML-LTREELNDESLVEAVHICLKECNLKLSCGIHDCTRKCHPGRCPSCLISDSNDLV
CPCGKTVIEAPVRCGSKLPPCPFECIKVIERSYPCGHKPPPHQCHPSTEPCPPCTAVVER
PCKCGKHHAVKAVCFQEF--GSCGEICNKELENCHHKCQYKCHEIGQCQKSCKQVCNKDR
ANCNHQCKSKCHGSSPCPDVPCNEVTKVSCKCGRKQEYRKCYATLDNSS-ASI-ELLPCD
EDCEAHARHLQLRDAFGYDSS-LDTSNK----NIQDIQSLMEKVSTYEELRLPYPQSVIS
TYSKQIKWCSQIEDILRKFVLDKAKNNLHFKPMKPAQRHFVRELSTSFNLYSESQDPEPK
RSVFVKRKVD--TRIPNISLEEVLPLWTGFKKLEKERKIQHFESTSQRKYINYEPKE---
VIVKSSNDTNGFFIKKISPGITEEDLSEVFGKALKSTLIKNVCYKILPESSDAIIYPEQY
NSITESVHQDLEVLVGHFDFIGKEALIFDSIMLCNVEGYINQ--------ISDCTDTDKE
KDSTSTSNE-----------------------
>KLTH0G10406g
-----------------MTSGQDQIAEAEFDEGY--------VVVRADSETSEAFENVGE
DLDEQDEQDEQDEQDELDEQGDTYDQPYYEKTIKEIAKGDRYPCMICTVEMDFTCHMYAC
PECYRVFDYECIREWAVKSTQKSVTKTWKCPNCYFEKKDVPLKNRPTCWCGKNIHPEPNP
LNPNSCGQTCDAPICVHGCSSTCHLGPHPTCMRMVQTKCRCGKKSKDVFCSEARKH---Q
ELFRCGNPCGLTLPCGVHKCQRECHNGVCGECPETIAKE------------INCYCGLES
LPSIKCQDVKIQ---SKSQDGSGKKWIGAFACSRIRTVEYSCREHSFAEPCKAPPSIAGR
IPCPYSPKALKTCPCGETPLENMETPRTKCTDPIPTCDATCGKLLSCGRHRCPFKCHTGT
CMEICTCSDKIKCSCNSRPFIVPCKFQGPPRCNTKCESLMSCRRHRCAERCCDGRSLAQV
REKKV-FLTRDKLDESLVEAQHICLKKCNLKLSCGRHFCQRKCHPGNCPPCLESDSNDLV
CPCGKTVAPAPVRCGTVLPPCRNPCIKTLQGPLDCGHPPMPHACHSLDEPCPSCTAPVFK
QCKCGKNKKVRTLCFQNN--VSCGRVCGKQLVSCHHSCTKTCHREGECQSICKQVCGISR
SNCSHICRFKCHTGSPCPDVPCNVTVEVKCGCGHRSSFATCAAHEGQDP-ADQRP-LECT
EDCAAARRRLELMEAFGMNTE-TVQPTE----GIVDLAALAEKVTTFQELMLPFTEASLS
IFAKQSNWCSQIEEHLNRLMSDISKPSLHFKPMKPPQRHFIHELAQAYKLYCESQDKEPK
RSVYVKKTVD--SRKPSLSLKEALPLYQSFKNAQKERKLKELERSTTTRILNYTSTG---
ESSPPVAQINGLLIQKVFEGTDEKTIEACFADYLKHTLIKDPNYLKLDSG-DVMVFAENY
ATASINVERDINRVVGHLDLIAKDSFLAEGVTVCRVEQVMAE----------ETNRSDES
SVAEAPEDPLFV--------------------
>Kwal_27.11518
-----------------MTSELDSTPDNDLSNGY--------VLVDASSEESEDFEHVED
----------------EIDELE--DQPYYEKTVKEIEKGDRYPCMICTVEMDFTCHMYAC
PDCYRVFDFECIREWALKSTQKSVSKTWKCPNCYFERKEVPMKNRPTCWCGKSVQPEPNP
LNPNSCGQTCDAQICEHGCSSICHLGPHPTCMRMVQVKCNCGKKNKSVFCHEAGKF---V
DSFICDSPCGLTLPCGIHKCQRKCHSGICGECPESIYGT------------INCYCKLES
KPSLKCTEVRIE---GRSRDSSGNKWVGAFSCENIRTVEHSCKKHSFAEPCKAPPSISGQ
VPCPFSPRTLKTCPCGRSPLREMDVSRSQCTDPIPTCDSVCGKMLRCGKHKCPFKCHTGS
CMEECLCTDKVKCSCHARQFIVPCKFQEKARCNTKCEALMSCRRHRCIERCCDGRSLAQS
REKKV-FLTRDKLDESLVEAQHICLKQCNLKLSCGKHFCKRKCHPGNCAPCLESDSNDLV
CPCGKTVVPAPVRCGTVLPRCLHPCIKTLQGPAPCGHPPMPHPCHPLEEPCPSCTAPVFK
SCKCRKNDKVRTLCFQND--VSCGRVCGKQLAGCQHICQKACHKEGECQTSCKQPCGKTR
ENCEHRCRALCHSGTPCPDKPCLNLVDIKCNCGHRSTTVTCGANENRAP-AEETA-LECN
NDCDVARRHHELMEAFGIKND-ANQGSK----SLEDLEALAEKVSTFQELLLPFSEATLS
IFSKQTTWCTQIEECLERLMNDKNKPSLHFKPMRPPQRHFIHELGQAYHLYCESQDQEPK
RSVFVKKTAD--SQRPSISLKVALPLYYSFKSAQREKKLKETERHTTTRIINYAVTD--Q
AQTPPAARFNGLLVQNVLNGINEKAIQESFSEYLKHTLLKDPHYLLLASG-DVLVYCDDY
STASVNVENDIERIVGHLDHIVKEQLLAEGVYATRVQSFL------------DDLESSTS
DAATSISNSELTTLAQENSEQ-----------
>SAKL0E07634g
----------------MDKHVSPLRVSSELPDSH---------STSEYSSSGDASDDHEN
YTSDT-----------EDDESD--DLPYYEKTIHEIQKGDSYACMICTMEMDYTCHMYAC
PECYRVYDHECIREWALKSSQKSLDKTWKCPNCYYVNSEIPVKNRHTCWCGKVVHPESNP
IDPNSCGQTCNAPICSHGCSKPCHLGPHPECMRTTKVKCLCGKHTKDMFCYQSEEE---K
ASYQCGEPCNLLLPCGVHKCQRKCHSGPCGNCEETISGK------------IMCYCGMET
REQIICKDVKSV---AKSKNKSGEIWIGVFSCAHLRSVEYSCGHHSFQESCTAPPTNSGE
LACPFSPRLLKTCPCGSTPLKLLEAPRKKCTDPIPTCENRCNKPLKCGKHSCPFVCHDGP
CMDPCVSVDKVSCSCHSKSFLVPCQFHDEAHCNTKCESLMSCRRHRCTERCCSGRSLAIK
REKTI-FLARDRLDESLVEAQHICLKPCNLKLSCGIHYCRRKCHPGKCSPCLESDSNDLS
CPCGKTVVPAPVRCGTKLPPCRHPCIKTLQADTVCGHPPMPHECHSLEQPCPQCTAPIYK
KCKCNKVEKVRTLCFQND--VSCGKICGLPLKNCSHTCKRTCHEPGQCQTICKQICGLPR
KFCEHKCFARCHPGKDCPDEACQVKVKVTCSCGRKESILPCDAHADQPS-SKLLITLPCD
DKCEESKRHRMLMEAFGIKEK-LTA-------PVEELRDLVESAKSFDELHLPFTESTLS
VYSKQRAWCNQIESFLSKLMRDVTRTSLHFKPMKLPQRRFIHELANAYALYSESQDREPK
RSVFVKKVEN-KSHIPLLCLGEALPLYHSFKQLQKERKVKELEKSTTRRLFNYTVDD--A
NDVPHNAEFNCFLVKGVAPGVTKDELSDCLAEYLQFTLIQNPSYQTLENG-DFLIYPEDH
MSISENVENDIKRLAPYISSICKEKQISEGVKLYKIDENLKT------FTSEEYLQEEQP
EKQASFEINTDGEVAVINTDKGTCEFPDSVST
>Kpol_1039.45
MTENTSVEASSVDETSHLKGTDHLVTASETSNSG--------SVYTSSSDDC--DDDNSE
SDSDDSEY--------ESSDNE--DLMHYERAIKDIAKGDFYTCMICTIELDSTSKMYAC
SHCYRVFDYDCIREWAVKSSQKSLDKVWKCPNCNHTSNKIPLQNRPTCWCGKTVNPDPNP
FYPNSCGQTCNAKSCIHRCSHFCHLGPHPQCHRTTTIHCECGKHTKDVFCYLLDHGKNRN
KKFNCGEKCNMTLSCGIHKCSRVCHSGSCGPCPELITKK------------VNCYCGSTT
MDKIRCSNVKIHDSGKKSKDQEGNTWIGVFKCNKIRTVEYACKNHSFFETCTSPPTISGT
KICPYSPKLLKTCPCGKTNLDDFENKRQKCTDPISTCENRCDKPLKCGKHKCPFTCHNGP
CMDPCTQIELRKCSCNYKEFSVPCQFHEKPRCNMKCESLMSCRRHRCTRRCCSGKPMADK
RKKML-FSQADLLDESLVEAEHICLKDCNLKLSCGIHNCTRKCHAGKCPPCLESDSSDLV
CPCGKTVVEAPVRCGTKLPECIFPCIKYIEGSYPCGHKPGNHYCHPADIPCPPCTEVVFK
PCKCGKEQKAKALCFQET--ASCGKLCEKKLDGCHHYCQLKCHLPGECQKKCTQICNKRR
VNCSHTCDQKCHGDSNCPDIPCKVKCEVYCGCGRRKELLLCGATSTTQS-VELTKVLPCD
DACLKYQRLEELRNAFGMKSS-SEDPES----ELERLKKIVEKVTSYEELELPFSETVLS
VYSKQTNWCNQIEELINKFVNDKNKPSLHFKPMPAPQRNFIHALVEAYEMYSESQDREPK
RSVYLKKNKY--TRIPNISLEEALPLYQSYKKIEKERKVQSFESKKNVTYLNYQPPE---
RSLTPDVKYNGFLIKGITFGTTTDDLNTLFGVHLKPTLIKDAQYSILPDGKSAIVYPKDY
LTISENVERDIESLAGHFDYMTKEAMLGESVEMCNITDIL-------------QTESAEP
SEETTTV-------------------------
>CAGL0M06919g
-----------MQDGRTEVTQDEYRHYDDHPDNS--------SLVIGLSEDE------SE
IETNMGAELSEELSDLDEGDEK--DMAYYEKAVQEIVKGDSYSCLICTVELDYTCKLYAC
EKCYRVYDYECIREWAEKSTSKRTDKLWACPNCFYTKKAIPKKNRPTCWCGEQVNPEPNP
LNPNSCGQTCNAKICSHGCSQICHLGPHQECTRMMSIKCSCGKVTKDIVCFQRRLY---S
KGFNCETVCDKLLPCGIHKCNRKCHTGLCGSCPETIISK-------NTNMKIRCYCGQTS
KDKIKCKDVRFPANAAYSKDDKGQRWIGVFMCDKIRKVPYECGEHSFYEKCKAPPSISGR
LICEFSPKKLKTCPCGKNELTDLSKPRSKCTDAIPTCGQVCGKMLKCGKHKCPFACHLGD
CMDPCTQIEKVRCACEQKQFTIPCGFNDHARCNLKCESLMSCRRHRCTERCCAGRPLAER
RRKTMKINVRDLADESTIEPIHICLKDCNLTLSCGIHKCNRKCHAGKCPPCLESDSNDLV
CPCGKTIVEAPVRCGTKLPNCPYPCIRVVRGETDCGHSPMPHECHPPDIPCPDCTATVFK
PCKCGKEQRVRTVCFMKD--VSCGKVCGERLQTCYHKCQKKCHEPGACQTVCKQTCNMPR
LYCNHRCPKPCHKFEECPDIPCTALVKITCPCGRIEKEVTCGVYSKNKE-AQDSTRIVCD
EECAVLQRHMQLKEAFGIVDK-PQNTHNE---EMARLEQVISTASTFADLDLPFTEPVIT
TYIRHENWCTDIENTLNKLIDDNNRTSLHFKPMRPPQRYFIRELAKAYNLYSESQDPEPN
RSVFVKKNLDGSSTKPILSISEAAPLYQSYKKLEKEKKQANFESMTTTRLINFTPEM--S
PELESAARFNGFLVTNVGEFTSTDDLQNLFAPYLKSTLVVEPQFQILPERKQAVIYPNKY
KEISINVERDMETLVQHFDFLIKESLLAGGVELCNIENVLAE------------------
--------------------------------
>TBLA0B05950
-----------MVQDKEQEQDQETINKQQSSNGK---LFKGHSLVLEFSDDD-ASDSGSD
NNSDLSRDEDESDVDTDNEYEE--DLMYYERAVREIAKGDSYQCMICTVEMDHTCKMYAC
RHCYRVFDYDCIREWALKSTQKTVDKTWKCPNCYHSSKKVPLKDRPTCWCGKVVNPDPNP
LDPNSCGQTCNANICPHKCLKQCHLGSHPECTQLLKITCRCGRETKDIYCHESRRQ---K
SIFHCDQECGLTLPCGIHKCRRKCHSGLCGSCPELLIDE-------NVSGKIKCYCGLHS
LKEMNCKDVAFPSSGKISRNQEDKEWVGIFDCKEMRSVSYTCNEHVFVEGCIAPPTLPST
VVCPFSPNLLKTCPCGKTALQDMDCERTKCTDPIPTCDNVCNKILKCGKHRCPFTCHTGK
CMDPCIQIDKMDCACERRTFLVPCQFKGKPVCKFKCESLMSCRRHRCMEYCCSGRPYAER
RKKTI-LRSSDRNDETLVEAEHVCLKDCNLKLSCGIHTCQRKCHPGPCPPCLESDSNDLV
CPCGKTVIPAPVRCGTTLPPCKYPCIKVIRGESDCGHKPMPHSCHSLDQPCPVCTAPVFK
PCKCGKKDKVRTMCFQED--VSCGLPCGLPLKDCYHKCQKRCHLPGECQNTCIQICNAKR
SNCSHGCTQRCHKNAPCPDIPCTVPVTVVCDCGRRKLVKPCSSTSTIDS-VTITSHLECD
EECMLLLRRMELKAAFGIVNGLGDDKTSV---AIERIQNRISVAKAYEELELPFVEAVLT
VYAKQPKWCSQIEGILNKFMDEKLKSSLHFKHMKAPQRSFVHNLADAYKIYSESQDPEPV
RSVFVKKLTNGTSSKPILTLEEALPLYESFKEVQKEKKKQEYEARTHKTLINVEAET---
QTQQSATKYNGFLIKNLVKGTTEEDLERIFGESLKPTLVKDPQYLVMDESHHGFICPADY
AEISINVERDMEQLIGFFDSLCKEHFIGDIVELCNIDEALLQENVDLEDSEEEKLTSPEV
ENDSDIHDSPKN--------------------
>ZYRO0A01936g
-------------MSGFERSEAEIGMAAQEYDGKDAPQVVDNSLILEFSDDS------DE
TTDEETT---------DEDEDD--RMMYYERAVKEIARGDTYVCMICTVEMDYTCKMFAC
SKCYRVFDYDCIREWALKSTGRTMDKTWKCPNCLDESNKVPRKSRPTCWCGKVVNPDPNP
LDPNSCGQTCDAPICEHGCSKVCHLGPHPECTRIISIKCKCGRHTRDVRCSEVGSGR--N
QQFTCEESCGLLLPCGVHKCSKKCHSGLCGGCNETLHSKP------DKGAVIKCYCGLHE
SPSIRCGDVRVA--DRDSVDDQGNGWIGVFRCKDVRVVEYACGQHSFVESCKPAPSLPKQ
IGCPFSPNVLRSCPCGRTPLNKLGQARVKCTDHIPTCESKCGKKLACGKHTCPYKCHEGD
CMDPCVQFEKTNCLCEARSFLVPCQFREDPRCNTKCESLMSCRRHRCTEKCCSGKPGAER
RKKTP-FTSRELLDESLVEAEHVCLKSCNLTLTCGRHKCQRKCHPGRCPPCLESDPNDLV
CPCGKTVVEAPVRCGTKLPPCPYSCISVVRDGYPCGHTPMPHLCHPPEEKCPPCTANVKK
PCKCGKKSDVRTLCFQQD--VSCGQICNKPLGSCRHTCQKKCHDGG-CQVKCRQICGKKR
VNCDHKCPKPCHGGEPCPDFPCPFSVVIKCACGRKESTEPCGTNSQTLS-ASVTRELSCD
EECERVKRCAQLKDALGLKEN-GDS-------SVENTVSNALVASNFEELGLPFRETVLA
IYSRQQRYCDNIESVLNNFIDDEKKSSLHFKPMKPAQRHFVHELAKAYKLYSESQDPEPK
RSVYVKKELNGESNKPSITLQEALPIYQAFKQREKETKIRRYEMQNVTNLVNFVPKF---
EPTVELAKYNGFLIRNLTDGTNGEDLQRIYGEHLKPTLVRNPVYKALPDRNIALIFPESY
SDVTVNTECDMERLVGHFDFICKEMFIGDGVELCQVGEYL----------------QPEA
PTESS---------------------------
>KNAG0H01990
-----------------------MIADDGKPDPK--------SLVLNFSSDD--EDSATE
ANITYSEEEEEEIATSDTEEDQ--DLPYYERAVREIAKGDLYTCMICTVEMDYTCKMFAC
RKCYRVFDYDCVREWAIKSTDKTVDRIWKCPNCYLVNKKVPTKNRPTCWCGKVVNPEPNP
LDPNSCGQTCDAKICIHGCSKICHLGPHPECLRTTSVKCRCGKATKEIPCFETKGRRG-R
NLFQCNEPCNSLLPCGIHRCQKICHSGLCGSCPENLTVKE------GDDVSISCYCGQHT
RNSIKCKDVNVT--GRKSKNANGDEWIGVYACKDIRSVEYSCRQHSFFEECIAPPTVTGT
KRCPFSPKYLKTCSCGKTPLQALGKARRRCIDPIPHCESRCDKLLKCGKHTCPFQCHDGP
CMDPCIQIDKVKCACERNTFLVPCGFQGAPHCQLKCESLLSCRRHKCAERCCSGRPAAEE
RRKNS-SRFQDVNDETLMEAEHVCLKACNLTLSCGQHQCQRKCHPGKCPPCLESDSNDLV
CPCGKTIVPAPVRCGTKLPSCRHPCIKVVEGISECGHKPIPHACHPLDQPCPPCTATVFK
PCKCGKNSRVRTICFQKD--VSCGQTCGKPLPNCHHFCQKTCHLPGQCQATCKQVCNKPP
VNCAHKCRKSCHGRLTCPDILCIALVKIRCPCGRKEVEVTCGATSTLSS-SLFTERLECD
EECEAYTRHRQLKEAFGITDK-VANGSAMKEKEGTRLEGLASKATTFEELQFPFTESTIS
TYIRQNKWCGEIEETLNNFMDNEGKSSLHFKPMKPPQRLFIRELAKAYNLYSEAQDPEPK
RSVFVKKNDDGSSAKPIFSLSEIAPLYQSFKLLEKERKMQDFLAKTTTHLINVKLNDDVA
TGAQHSGQNNAFLIKNISAGTTLQDLKNLFGKYMEKTLIRNPQYQELPEENSAIVYPEDY
RTISANAVNDMENLVGHINFIVNDAFLADSAELCDASSKLPEEIS--ENDISERLETPEV
QEQN----------------------------
>TDEL0G02190
-------------------------MVVEELNQH--------SLVLEFSEDDSDFSSESC
SVH-------------EVRDEH--DMAYYERAVQEIALGDRYVCMICTVEMDYTCKMYAC
EGCYRVFDYECIREWALKSTEKTLDRVWKCPNCYKVNKRVPAKNRPTCWCGKTVNPDPNP
LDPNSCGQTCDAPICPHGCSKQCHLGPHPDCVRTITTKCQCGKHTRETFCYQTISMKG-K
SQFQCNEVCGLPLACGIHKCERLCHSGICGPCPAVLNAK-------SNKLKIRCYCGLEH
RDSFKCKDVRVA--SDLSKDGKGDSWIGAFGCSGIRKIEYACREHSFVEKCQPSPSISGK
IACPFSPKLLKTCPCGRTSLKVLAEPRKSCTSPIPNCDSTCGKKLACGRHTCPFTCHDGP
CMDPCIQIETVRCSCHKNLYSVPCQFKEQPRCDTKCESLMSCRRHRCTERCCCGRPFAER
RRKTP-LSSRELMDESSVESEHICLKDCNLTLSCGCHKCQRKCHPGKCPPCLESDSNDLV
CPCGKTVVEAPVRCGTRLPPCHYPCIRVIQNAYKCGHKPMPHTCHPLNEPCPSCTAPVFK
PCKCGKKDKVRTLCFQND--VSCGTTCGKPLDNCPHMCQKSCHIPGECQKKCKQICNRKR
IYCDHKCRLICHGNDKCPDIPCPLSVKIKCECEVKESFITCGANSETPS-KATTTILPCD
EECERHKRHLQLREAFGISNF-SDNPSRS---KTASLENLAAVANSFEELELPFSEPALG
TFAKQEAWCTQIENVLNSFMDNEEKTSLHFKPMRPAQRHFIHELAKSYNLYVESQDREPK
RSVFVKKQDNGGSCKPVIQLKDSLPIYQFFKENEKEKKAQRFEAQTTTEFVNFIPKE---
EPQLERAKNNAFKLKNVSTGTTKEDLERIFADHLKPTLVKNPQFKIQDSTKNGLIYPEDY
AEISVNVERDLEALVGHFDYLCKESFIGDGIELCHIDLKV--------------LQESE-
--------------------------------
>Suva_14.324
---------------MLQTNERESLDLEQSQNGS---------DVHEHCLNDEHVSGVEV
SHEQSSTYDS------EEESDD--DMQYYERAIQEIAKGDSYICMICTVEMDYTCQMFAC
KKCYRVFDYACIREWALKSTEKTVDKIWKCPNCYHIGKKVPTRNRPTCWCGKVVNPDHNP
LDPNSCGQTCNAPTCVHGCSKICHLGPHPECTRTVEIKCRCGKHSKSIFCYQSKAM---K
KHFDCQEECGLPLSCGIHKCKKKCHSGLCGPCPELIMSED------KAMDWIKCYCGIHS
KDSIKCCEVNFPKSGRSSKDESGNEWIGVFACKDIRTVDYACHKHSFIEPCISPPTVNGK
KTCPFLPSLLKTCPCGRTALEELTKPRKHCTDPIPTCSSRCSKPLKCGKHSCPFICHDGA
CMDPCLQTDSVKCACEQSTFLVPCGFQEKPHCNIKCESLMSCRRHRCIDRCCSGRPSALE
RKKRI-FRSQDLMDESLVEAQHICLKPCNLTLSCGIHKCQRKCHPGKCPPCLESDSNDLV
CPCGKTVIPAPVRCGTKLPLCNYACIKVVRGESECGHKPMPHTCHPLDLACPPCTETVFK
PCKCGKKDKVRTVCFQTD--VSCGTTCGKPLSGCHHTCQKTCHLPENCQKVCKQICRQKR
PNCDHACPKPCHGRSECPDLPCASLVKITCKCGRIEKKVACGAKSNVVS-VTEAPQLDCN
EECEALKRLKELREAFGISEE-SNESTNN---ELDTLKKLVSVATTFEELQLPFTETVLS
VYAKQEGWCLQIENIVNKLMSDKTRSSLHFKPMRPPQRHFIRELAKAYNLYSESQDREPM
RSVFIKKEDNSKSSRPILSLAEAFPLYESFKELQKERKIQEFQARTTAKLINFEVRD--A
EPKVELAKNNGFLVQKLVNGNDVDDLRRFFEPHLKHTLVVKPQYLIIDDGKTALVYPENY
QEVSVNTERDMDILVGHFDFMAKEAFLADSISLCSIDEELG-----------RRLDPPVT
QGDSLAKEEN----------------------
>Skud_14.306
---------------MLQITEHESLDLEQDQNGG--------GIHKHHSLSNGHVLSVED
SSEQLSSYEF------EEESDD--DLQYYERAIQEIAKGDSYICMICTVEMDYTCQMFAC
KKCYRVFDYACIREWALKSTEKTVDKIWKCPNCYHVGKKVPTRNRPTCWCGNVVNPDPNQ
LDPNSCGQTCNAPTCVHGCFKICHLGPHPECTRMVEIKCHCGRHSKTIFCYQSKAM---R
RRFNCQEECGLSLSCGVHKCKKKCHSGLCGSCPEFIINDD------SSKKQIKCYCGNHI
QNSIKCSEARFPKSGRTSKDESGNEWAGVFACADIRTVDYACHKHSFIEPCLSPPTISGQ
KTCPFLPSLLKTCPCGRTALEELTKPRKHCHDPIPTCNSRCSKPLKCGKHLCPFTCHDGA
CMDPCLQIDSANCSCEQSTFSIPCGFQESPRCNIKCESLMSCRRHRCIDRCCSGRPSAIR
RKKSF-FRSQDLLDESLVEAKHICLKPCNLTLSCGLHKCQRKCHPGKCPPCLESDSNDLI
CACGKTVVPAPVRCGTKLPTCNHPCIKVVRGESWCGHKPMPHTCHPSNISCPPCTETVFK
PCRCGKKDKVRTVCFQAD--VSCGTSCGIPLSGCYHTCQKTCHLLGKCQKVCKQICGQKR
LDCIHTCPKPCHGKTECPDLPCAALVKITCECGRIKKSITCSAKRDTVS-VITSSILDCN
EECETLKRLKELREAFGVSEG-PNNVIRN---ELDALSELVSVAKTFEELQLPFTEATLS
VYSKQERWCLQIEGILNKLMDSEIRSSLHFKPMRPPQRHFIHEMAKAYNLYAESQDREPM
RSVFIKKEDNCTSKKPVLSLAEAYPLYESFKQSQKERKLQEFQARTTAKLINFEVQD--A
ESKIEAAKNNGFLVQNLVSGNTVEDLKRFFEPHLKHTLVANPQYLILDDSRSALIYPENY
ETASVNTERDMELLVGHFDFMAKEAFLADSIHLCSVDEEIG-----------KRLDSPAI
QEVSSPEEKDM---------------------
>Smik_14.308
------------------MTDHESLDLKQNQEGG--------GVCRRHSLSSEQDSSVED
NNEQPSSY--------EEETDD--DMQYYERSIQEISKGDSYICMICTVEMDYTCQMFAC
KRCYRVFDYGCIREWAIKSTEKTVDRIWKCPNCYHVGKKVPANNRPTCWCGKVVNPDPNP
LDPNSCGQTCSAPICIHGCSKTCHLGPHPECTRMVEIMCHCGKHSQSIFCYQSKAM---K
KNFKCQEECGLPLSCSVHNCKRKCHTGLCGPCPELITSKD------STEEQIKCYCGNHS
RASIKCSEARFPKSGRSSKDGNGNEWIGVFACTDIRTVDFSCRKHSFIEPCLSPPSVNGR
KVCPFLPSLLKTCPCGRTALDELTKPRKHCDDPIPTCNSRCSKPLKCGKHSCPFICHDLA
CMDPCLQIDSAKCACEQSTFSVPCGFQGRPRCNIKCESLMSCRRHRCTDRCCSGRPSAVK
RRKNF-FRSQDLLDESLVEAKHICLKPCNLTLSCGIHKCQRKCHPGKCPPCLESDSNDLI
CPCGKTVVPAPVRCGTELPVCNHPCIKVVRGESSCGHKPMPHTCHPLGVPCPPCTETVFK
PCKCGKKDKVRTVCFQKD--VSCGTKCGLLLHFCRHTCQKTCHLPGNCQKVCKQICGHER
LSCRHTCPKPCHGKTECPDLPCPTLVKITCKCGRNEKSVTCSAKSGVVP-ANESSVLDCD
EECEALKRLKELREAFGIKEE-SNNVTSN---ELDALKKLVSVATTFEELHLPFTETTLS
VYSKQERWCSQIEVILNKLMDDKTRSSLHFKPMRPPQRHFIRELAKAYGLYSESQDREPM
RSVFIKKEDNGTSNKPVLSLGEALPLYESFKQLQKERKVQEFQSRTTAKLINFEVQD--A
QPKVEVAKNNGFLVRNLVTGNTVEDLKRFFEPHLKHTLVVNPQYLILDDGKTALVYPENY
ETASVNTERDMELLVGHFDFMAKEAFLADSILLCSTDEEVG-----------KRLDTPVI
QEDTSIEDKNK---------------------
>YNL023C
------------------MTEHESLGLEQNQDGG--------DTYRHHNLSDGCISSVED
ANEQPSSY--------EEESDD--DMQYYERAIQEISSGDSYVCMICTVEMDYTCQMFAC
KRCYRVFDYGCIREWALKSTEKTVDRIWKCPNCYYVSKRVPVKNRPTCWCGKVVNPDPNP
LDPNSCGQTCNASTCMHGCSKICHLGPHPECTRMVEIMCHCGKHSKSIFCYQSKVM---K
KNFNCQEVCGLPLSCSIHTCKKKCHPGLCGPCPEMIISKD------SPKKQIKCYCGNHT
RANIKCSETKFPKSGKSSKDENGNRWIGVFACADNRVVDYSCRKHSFIESCISPPTINGE
KACPFLPSSLKTCPCGRTALEELTKPRKHCDDPIPTCDSRCGKPLKCGKHSCPFTCHDKA
CMEPCLQIDSVKCACEQSTFSVPCGFQGRPRCNIKCESLMSCRRHRCTDRCCSGRPSAIR
RKKNL-FRTQDLLDESLVEAKHICLKPCNLTLSCGIHKCQRKCHPGKCPPCLESDSNDLV
CPCGNTVVPAPVRCGTKLPTCNHPCIKVVRGESTCGHKPMPHTCHSLDVSCPPCTETVFK
PCKCGKKTKVRTVCFQTD--VSCGIKCGIPLSYCYHTCQKTCHLPGNCQKVCKQTCGQKR
LNCNHECPKPCHGKTECPDLPCATLVKIYCKCGRIKKSVTCGAKSDRVS-VTESSVLDCN
EECEALKRLKELKEAFGIKEE-TNNFTSN---ELDALKKLVSVATTFEELQLPFTEAALS
VYSKQERWCSQIEAILNKLMDDKTRSSLHFKPMRPPQRHFIRELAKAYGLYSESQDREPM
RSVFIKKEDNGASNKPVLSLAEAYPLYESFKQLQKERKAQEFQARTTAKLINFEVQD--T
EPKVEVAKKNGFLVQNLVAGNTAEDLRRFFEPHLKHTLVVNPQYLILDDGKTALVYPENY
ETASVNTERDMELLVGHFDFMAKEAFLADSISLCSTEEELE-----------RRLDTPVI
QEDSPVMDNNT---------------------
>KAFR0H03300
------------MDDSSADSVDETLNLHTHPDPK--------SLVLEFSEDDTSSAASSD
DEEMD-----------VLSDND--DMMYYERAIQEIAAGDSYICMICTVEMDYTCKMYAC
KKCCRIFDYDCIREWALKSTEKTKERIWKCPNCYHVNKKVPTKNRATCWCGKVVNPEKNP
LNPNSCGQTCNAPVCIHGCSKICHLGPHPECLRTITMKCDCGKHERQISCFQSKSQSGRR
NRFSCEEECGLPLSCGIHTCKKKCHSGLCGSCPELLEVNE------EKCATIKCYCGLET
KKSFPCKDVKAP--TTLSRDAEGNKWVGVFSCNKIRNVEYSCQKHSFVESCVAPPTVSGT
KQCPFSPNLLKTCPCGRTPLNALSKPRLKCTDPVPTCEACCNKPLKCGKHRCPFTCHNGP
CMDPCIQIDKKPCSCHQSFFLTPCQFEGEPHCNIKCESLMSCRRHRCTERCCSGRPLAEK
RKKTL-FRSSDINDETLVEAQHVCLKECNLMLSCGKHRCQRKCHPGKCPPCLESDSNDLV
CPCGKTVVEAPVRCGTKLSPCLFPCIKVIRNESVCGHPPVPHSCHPLDQPCPPCTATVFK
PCKCGKRDKVRTVCFQKD--VSCGKICGLPLLTCHHKCQKVCHPNGECQVKCKQVCRKKR
VNCVHECLKSCHGSTECSDSPCPVSTKISCPCGRRESYVTCNATSTIDS-AALITRLDCN
EECEVVKRHRELREAFGIVEK--EEPENL---GTERLQSFAQSATNYDDLQLPYTEPALV
AYTKQPNWCEQIEELLIKFMDDNSRPSLHFKPMRPPQRYFIHEIAKAFNLYAESQDREPK
RSVFLKKNDDGTSLKPALRLSDVLPVYQNFKKLEKERKAKQFEARTTARLMNITLDD--T
LEERKKFENNGLIIKNLSNGITLEFLSEFFNKFFKSTLIKNPQYLIIEN--NGLIYPESH
NEITQGVYNDLDMLVGHFNVIVKEELIGDSVEMCNIENELPE----------ERLETPRL
ETPGLESDDE----------------------
>NDAI0G00670
------------------MSDTELNEVSTHPDPK--------SLILQASADEIKSSENVS
STSDNDEYDQEDEYAAATAADE--DMKYYERTIQEIAKGDSYVCMICTVEMDYTCQMYAC
KECYRVFDYDCIREWAVKSTEKTVDRIWKCPNCYHVNKKVPPKNRSTCWCGKVVNPEANP
LNPNSCGQTCNAKICVHGCTNICHLGPHPECTRMLSITCRCGKHTKDIFCYQSKTFKG-N
SKFQCKDECGLPLSCGIHKCKRKCHSGLCGVCPERLEVNE------ENAWILKCYCGSET
QKSMKCKDIKIPESAKYSSDAEGNKWIGVFACKEIRTVQYDCDKHSFIERCIAPPTLSME
KPCPYSPKLLKTCPCGKTPLQKLAKPRTLCTDPIPTCESHCNKPLKCGKHKCPFKCHTGA
CMDPCLQIETRKCSCEQQSFLVPCQFTGSPHCNIKCESLMSCRRHRCLERCCSGRPAAEK
RKKTL-FRSQDLMDETLVEAEHICLKECNLLLSCGIHRCQRKCHPGKCPPCLESDSNDLV
CPCGKTIVEAPVRCGTKLPPCPFQCIKVVRNEYPCGHTPMPHTCHPLDEPCPPCTAPVFK
PCKCGKVKEVRTLCFQND--VSCGKICGLPLKDCPHKCMKRCHIPGDCQTKCKQICGKRR
INCDHTCSRPCHGNTECPDVPCTVSAKVTCECGRRETYVTCGAMSNIAS-AVTTTILECD
EECEMLERHRQLKEAFGIKEI-ISSSTDL---EFERLKDIVPTAIAFEELQLPFTEATLS
IFSRQERWCQQIEEIINKFMDDKSRPSLHFKPMRPPQRHFIHELSKAYNLYCESQDPEPK
RSVFIKKNTT--SSKPSFSLSKVLPLYQTFKELEKERKLQEFEARTSKRLVNVEVPE--G
PTDNYIAEANGFLIKDLSPGTTVEDLERIFGQYLKSTLIKNPQYLVLQDGKSGVIYPEDY
PTITANVERDFKSLVGHFDVLAKDTFISEGVELCKIDDVLST----------ERLATPAI
DESTP---------------------------
>NCAS0G03780
------------------MGKDHIS-TGDEPDPK--------SLVLELSDDD---SNGES
GNSDSSEYESD----FAGMDDD--AMHYYERAIQEIAKGDSYVCMICTVEMDYTCQMYAC
KQCYRVFDYECIREWALKSTEKTVDRIWKCPNCYHVNKKVPPKNRPTCWCGKVVNPEPNP
LNPNSCGQTCNAHTCVHGCSKICHLGPHPECTRIITIKCRCGKHTKDISCYQSSLLRG-K
DKFQCDEPCGLPLACGLHRCQKKCHSGLCGICPEILNTKE------YLDAHIRCYCGSQD
RDTIKCRDVHVPLSASLSQNLKGEKWVGVFKCDNIRNVDYKCHEHSFVEQCIAPPTIDGT
KPCPFSPKLLKTCPCGKTPLKELVESRKKCTDPIPTCDSRCGKPLKCGRHTCPFICHVGP
CMDPCLQIDKKKCSCNQQSFLVPCQFHQDPQCTTKCESLMSCRRHRCTERCCAGRPRAEA
RKKRL-FRSQDLMDESLVEPQHICLKECNLMLSCGKHKCQRKCHPGKCPPCLESDSNDLV
CPCGRTIIEAPVRCGTKLPPCPYPCIKVVRGEYPCGHTPMPHTCHPLNEPCPPCTASVFK
PCKCGKVDKVRTLCFQND--VSCGKICGLPLENCNHTCQKRCHLLGECQKTCKQICKKKR
INCEHTCLKPCHGKTDCPDIPCSVSIKITCECGRKETYVTCGATSTIPS-AATKTHIECD
EECELLERHRQLKEAFGIVD--SNRSTSL---EVEKLKDLAKVATTFEELQLPYNETTLS
IYAKQEKWCDQIEEILNKLMDDKARPSLHFKPMRPPQRHFIQEFAKSFNLYAEAQDREPK
RSVFVKKEEDGSSSKPIISLHDALPLYQTFKELEKERKLKEFEARTTTRLINVEAPQ---
EDNVYHAKYSGFLIKKISPGTTVEDLQRIFGQFLTSTLIVNPQYLIIQDGKDALIYPENY
QEMSAGVERDLETLVGHFDFISKENFIADGVELCDVEVAMLG----------ERLETPIL
EE------------------------------