MUSCLE (3.8) multiple sequence alignment

KAFR0H03290        ------------------------MNEV--FGE-YVGLIDTRPIEHLGSADLSFDGQLSP
Ecym_3328          ------------------------MTDV--FASVFEELVPTPPIEHLGASDLSFQGRLDP
ADL212W            ------------------------MTET--FTAVFEDLVEPRPIEHLGQSDLSYQGQLDP
KLTH0G10428g       ------------------------MAELLDFTAQFTDLVPSRPLEHFGDSDLTFGGRIFP
Kwal_27.11513      ------------------------MTELLDFTTQFIDLVPSRPVEHLGDSDLSFGGQVEP
KLLA0E08295g       MSLLEVLTRDRKERTVLETCKAFIMGDV-PFSSCFEELVPARPIEHLGKIDMSFNGKLPS
CAGL0M06897g       ------------------------MEDI--LG--FGDLIESRPVEHMGQSDLTFNGMLVP
KNAG0H01980        ------------------------MNEI--FGS-FGDLVVARPIEHCGSHDMSFGGRLNP
SAKL0E07612g       ------------------------MEDVLQFTACFNDLVPSRPTEHLGDSDLSFGGKLSP
Suva_14.323        ------------------------MDGI--FGG-FEDLVVPRLKEHFGQTDLSFGGKLLP
Skud_14.305        ------------------------MDTI--FGG-FEDLVVPRATEHLGQTDLSFGGKLLP
Smik_14.307        ------------------------MDSI--FGG-FGDLVVPRPKEHLGQTDLSFSGKLLP
YNL024C            ------------------------MESI--FGG-FGDLVVPRPKEHLGQTDLSFGGKLLP
NDAI0G00680        ------------------------MDDI--FGSGFDDLVVARPLEHLGNSDLSFGGRLKN
NCAS0G03770        ------------------------MDGI--FGD-FEGLVVPRPVEHLGNSDLSFGGKLRS
                                           *     :   :  *: .   ** *  *::: * :  

KAFR0H03290        AMKIYEDGGASGCGGKVWIAGELLCEYLIEKSDSENLLCD--------GSIKNILELGSG
Ecym_3328          PLKIYEDGGESGCGGKVWIAGELLCDFLLEKSKDGQLLSKFVKNG---KQFNKVLELGSG
ADL212W            PLKIHEDGGESGCGGKVWIAGNLLCEFILEKSKDGRVLSQFPGYE---RQFKNIIELGSG
KLTH0G10428g       ALKIHEDGGESGCGGKLWIAGELLCEYLLENSDDNGILSKQMNLLGRDKPFVNILELGSG
Kwal_27.11513      ALKIHEDGGENGCGGKLWVAGELLCDYLLENSDAKGILSKRMVEMDVKAPFLNILELGSG
KLLA0E08295g       PLIINEDGGESGCGGKVWIAGELLCEYILEKSDKEHLLSHLFPD----GNCNSVLELGSG
CAGL0M06897g       GLKIYEDGGESGCGGKVWIAGELLCEFILEKSRDGELLKDWINDDS--VSFGNVLELGSG
KNAG0H01980        ALQIHEDGGESGCGGKVWVAGELLCDYIVEKSDEDDLLANWDTSKV--QKFRNIIELGSG
SAKL0E07612g       PLKIHEDGGESGCGGKVWIAGELLCEFLLEKSDQQGLFSQWNSDTRFQSPIKKIVELGSG
Suva_14.323        ALKICEDGGESGCGGKVWIAGELLCEYILEKSDD-HLLSETVHEK---RPFMKVLELGSG
Skud_14.305        ALKICEDGGESGCGGKVWIAGELLCEYILEKSLH-HLLSEATHGR---RQFKKVLELGSG
Smik_14.307        ALKICEDGGESGCGGKVWIAGELLCEYILEKSVD-HLLSKTVDGK---KRFKKVLELGSG
YNL024C            ALKICEDGGESGCGGKVWIAGELLCEYILEKSVD-HLLSKTVNGT---KQFKKVLELGSG
NDAI0G00680        PLKIHEDGGESGCGGKVWIAGELLCEFILEKSNSDDLLNGWASNS---KQFRKIVELGSG
NCAS0G03770        PLKIHEDGGESGCGGKVWIAGELLCDFILEKSGTEDLLNKWPHDGE--RRFRNVLELGSG
                    : * **** .*****:*:**:***::::*:*    ::              .::*****

KAFR0H03290        TGLVGICVGLMEKQRFHKDIKVSITDIGGLVPLMERNILLNKIADATVAKELMWGQQLPS
Ecym_3328          TGLVGLCIGMHNIMHEVNDMDVYITDIDTLCPLMARNVRMNNLEGRVHPRELFWGDELPA
ADL212W            TGLVGLCVGLHGKYNGATDTNVYITDIEGLCPLMQKNVELNGLDGMVHPRPLFWGEPLSD
KLTH0G10428g       TGLVGLCAGSLARANG-GNAKVHITDIDQLVRLMEGNVELNGLASVVSAEKLWWGEPLKY
Kwal_27.11513      TGLVGLCAGSVAQLHG-DRTKVYITDIDRLVGLMETNVNLNHLAETVSVEILSWGEPLKE
KLLA0E08295g       TGLVGLCVGLMDQANEYSDREVYISDIDQLLGLMESNIQVNGLDDKVHAEVLWWGNPLPD
CAGL0M06897g       TGLVGLCVGLVTKKQSQRMVKTYITDIDQLVPLMEKNVELNLIDQQVFAKELLWGEALPI
KNAG0H01980        TGLVGLCVALLEKQFFHKGIKVTITDIDQLVPLMQKNIELNCVNTEMIAEELWWGEPLSG
SAKL0E07612g       TGLVGLCLGLLNKQNKLKDVDIYVTDIDQLVTLMDRNIKLNELEH-VFPKELWWGEPLKP
Suva_14.323        TGLVGLCVGLLEKNKFHDNTKVYVTDIDRLVPLMERNIELDKVQYEVLARELWWGEPLSG
Skud_14.305        TGLVGLCVGLLEKNTFHDGSKVYVTDIDKLVPLLERNIELDKVQYEVLARELWWGEPLSV
Smik_14.307        TGLVGLCVGLLEKNVYHDGTKVYVTDIDKLVPLLKRNIELDKVQYEVLARELCWGEPLSA
YNL024C            TGLVGLCVGLLEKNTFHDGTKVYVTDIDKLIPLLKRNIELDEVQYEVLARELWWGEPLSA
NDAI0G00680        TGLVGLCIGLLEKNNFHKDIDAYITDIDQIVPLMKQNIQLNGIENEVSAEELWWGEPLRK
NCAS0G03770        TGLVGLCVGLLEKNRFHKNIGVHITDIDQLVPLMQRNIELNGVSKEVVAEGLWWGEPLLE
                   *****:* .              ::**  :  *:  *: :: :        * **: *  

KAFR0H03290        EYMTT----SVDGNCDNVSNVDLVVAADCVYAEKAFPLLEKILLDLT-NCDNPPIILMAY
Ecym_3328          EFRN------------KDSPVDLILAADCVYLEKAFPLLEMKLLELTANQEVQPVVLMSY
ADL212W            EFTR--------------QPIDLVLAADCVYLEKAFPLLEKTLLDLT-AGESQPLVLMSY
KLTH0G10428g       EFGP----------DAISNKTDLVLAADCVYLETAFPLLEKTLLDLT-KGETPPVVLMSY
Kwal_27.11513      KFGP----------DAKADKVDLVLAADCVYLETAFPLLEKTLLDLT-EGDTPPAVLMSY
KLLA0E08295g       VFVK--------------KPVDLVLAADCVYLEAAFPLLEKTLLELT-DGENVPIILMAY
CAGL0M06897g       EFAP------VKTGHATTSSLDLVLAADCVYLEKAFPLLEKTLLDLT-ECDNPPVILMAY
KNAG0H01980        AFAP------HSEGLSKVTSVDLILAADCVYLEKAFPLLEKTLLDLT-NCSKPPVILMAY
SAKL0E07612g       EFAP---------TRSNQRQVDLILAADCVYLEKAFPLLEVTLLDLT-SCKDPPIILMSY
Suva_14.323        DFSP-------QEGDLQVNNVDLVLAADCVYLEKAFPLLEKTLLDLT-NCISPPVILMAY
Skud_14.305        DFSP-------QEGDLQTNNVDLVLAADCVYLEKAFPLLERTLLDLT-NCISPPVILMAY
Smik_14.307        DFSP-------QEGDLQTNNVDLVLAADCVYLEKAFPLLEKTLLDLT-DCVSPPVILMAY
YNL024C            DFSP-------QEGAMQANNVDLVLAADCVYLEEAFPLLEKTLLDLT-HCINPPVILMAY
NDAI0G00680        TFAPSEHSRDKEEDFREEKKVDLILAADCVYLEKAFPLLEKTLLDLT-EGETPPTILMAY
NCAS0G03770        SFAP-----STVDNLPKTNVVDLILAADCVYLEDAFPLLERTLLDLT-ESETPPVILMSY
                    :                   **::****** * ******  **:**      * :**:*

KAFR0H03290        RKRRKADKRFFVRIRKNFDVIEIDDFSSHEKYMKQRTHLFELKRK----------
Ecym_3328          RKRRKADKKFFLKIKKHFVITELTDFKRYDEYIKQRTHIFQLVRRSSIKQQQARA
ADL212W            KKRRKADKKFFIKIKKEFDIIEIKDFKSYEDYRRQRTYLFQLVRKPARAPHALAP
KLTH0G10428g       RKRRKADRIFFKAIRKNFKVVPITSFDRCDDFLKQRTHLFQLIRVQK--------
Kwal_27.11513      RKRRKADKNFFRLIRKNFKIVPITNFIRYDYYLKKQTHLFQLVRIPK--------
KLLA0E08295g       KKRRKADKHFFQKIKKNFKIVEIRDFINFDKYLKQRTHLFQLMREK---------
CAGL0M06897g       RKRRKADKHFFQKIRKNFNVIVINDFKNYDQYLKQRTHLFQLVRK----------
KNAG0H01980        RKRRNADKRFFRKIGKHFTVREITDFSTYDQYLKQRTHLFELIRN----------
SAKL0E07612g       KKRRKADKHFFKQIKKNFDVLEINEFTRFDHYLKQKTHLFQLVRKFK--------
Suva_14.323        KKRRKADKQFFNKIKRNFDVLEIKDFIKFDYYLKQKTHLFQLVRKCSSHSEA---
Skud_14.305        KKRRKADKHFFSKIKRNFDVLEITDFSKFDHYLKQRTHLFQLIRKHTV-------
Smik_14.307        KKRRKADKHFFNKIKRNFDVLEISNFSKFDYYLKQRTHLFQLIRK----------
YNL024C            KKRRKADKHFFNKIKRNFDVLEITDFSKFEHYLKERTHLFQLIRK----------
NDAI0G00680        RKRRKADKHFFQKIKKNFDIVEIKDFEKYEYYLKQRTHLFQLIRQ----------
NCAS0G03770        RKRRKADKHFFNKIKKNFDVIEVKDFTKYEMYLKMRTHLFQLARRF---------
                   .***:**. **  * . * :  : .*   : : . .*::*:* *           

FASTA FORMAT for MUSCLE Version 3.6

>KAFR0H03290
------------------------MNEV--FGE-YVGLIDTRPIEHLGSADLSFDGQLSP
AMKIYEDGGASGCGGKVWIAGELLCEYLIEKSDSENLLCD--------GSIKNILELGSG
TGLVGICVGLMEKQRFHKDIKVSITDIGGLVPLMERNILLNKIADATVAKELMWGQQLPS
EYMTT----SVDGNCDNVSNVDLVVAADCVYAEKAFPLLEKILLDLT-NCDNPPIILMAY
RKRRKADKRFFVRIRKNFDVIEIDDFSSHEKYMKQRTHLFELKRK----------
>Ecym_3328
------------------------MTDV--FASVFEELVPTPPIEHLGASDLSFQGRLDP
PLKIYEDGGESGCGGKVWIAGELLCDFLLEKSKDGQLLSKFVKNG---KQFNKVLELGSG
TGLVGLCIGMHNIMHEVNDMDVYITDIDTLCPLMARNVRMNNLEGRVHPRELFWGDELPA
EFRN------------KDSPVDLILAADCVYLEKAFPLLEMKLLELTANQEVQPVVLMSY
RKRRKADKKFFLKIKKHFVITELTDFKRYDEYIKQRTHIFQLVRRSSIKQQQARA
>ADL212W
------------------------MTET--FTAVFEDLVEPRPIEHLGQSDLSYQGQLDP
PLKIHEDGGESGCGGKVWIAGNLLCEFILEKSKDGRVLSQFPGYE---RQFKNIIELGSG
TGLVGLCVGLHGKYNGATDTNVYITDIEGLCPLMQKNVELNGLDGMVHPRPLFWGEPLSD
EFTR--------------QPIDLVLAADCVYLEKAFPLLEKTLLDLT-AGESQPLVLMSY
KKRRKADKKFFIKIKKEFDIIEIKDFKSYEDYRRQRTYLFQLVRKPARAPHALAP
>KLTH0G10428g
------------------------MAELLDFTAQFTDLVPSRPLEHFGDSDLTFGGRIFP
ALKIHEDGGESGCGGKLWIAGELLCEYLLENSDDNGILSKQMNLLGRDKPFVNILELGSG
TGLVGLCAGSLARANG-GNAKVHITDIDQLVRLMEGNVELNGLASVVSAEKLWWGEPLKY
EFGP----------DAISNKTDLVLAADCVYLETAFPLLEKTLLDLT-KGETPPVVLMSY
RKRRKADRIFFKAIRKNFKVVPITSFDRCDDFLKQRTHLFQLIRVQK--------
>Kwal_27.11513
------------------------MTELLDFTTQFIDLVPSRPVEHLGDSDLSFGGQVEP
ALKIHEDGGENGCGGKLWVAGELLCDYLLENSDAKGILSKRMVEMDVKAPFLNILELGSG
TGLVGLCAGSVAQLHG-DRTKVYITDIDRLVGLMETNVNLNHLAETVSVEILSWGEPLKE
KFGP----------DAKADKVDLVLAADCVYLETAFPLLEKTLLDLT-EGDTPPAVLMSY
RKRRKADKNFFRLIRKNFKIVPITNFIRYDYYLKKQTHLFQLVRIPK--------
>KLLA0E08295g
MSLLEVLTRDRKERTVLETCKAFIMGDV-PFSSCFEELVPARPIEHLGKIDMSFNGKLPS
PLIINEDGGESGCGGKVWIAGELLCEYILEKSDKEHLLSHLFPD----GNCNSVLELGSG
TGLVGLCVGLMDQANEYSDREVYISDIDQLLGLMESNIQVNGLDDKVHAEVLWWGNPLPD
VFVK--------------KPVDLVLAADCVYLEAAFPLLEKTLLELT-DGENVPIILMAY
KKRRKADKHFFQKIKKNFKIVEIRDFINFDKYLKQRTHLFQLMREK---------
>CAGL0M06897g
------------------------MEDI--LG--FGDLIESRPVEHMGQSDLTFNGMLVP
GLKIYEDGGESGCGGKVWIAGELLCEFILEKSRDGELLKDWINDDS--VSFGNVLELGSG
TGLVGLCVGLVTKKQSQRMVKTYITDIDQLVPLMEKNVELNLIDQQVFAKELLWGEALPI
EFAP------VKTGHATTSSLDLVLAADCVYLEKAFPLLEKTLLDLT-ECDNPPVILMAY
RKRRKADKHFFQKIRKNFNVIVINDFKNYDQYLKQRTHLFQLVRK----------
>KNAG0H01980
------------------------MNEI--FGS-FGDLVVARPIEHCGSHDMSFGGRLNP
ALQIHEDGGESGCGGKVWVAGELLCDYIVEKSDEDDLLANWDTSKV--QKFRNIIELGSG
TGLVGLCVALLEKQFFHKGIKVTITDIDQLVPLMQKNIELNCVNTEMIAEELWWGEPLSG
AFAP------HSEGLSKVTSVDLILAADCVYLEKAFPLLEKTLLDLT-NCSKPPVILMAY
RKRRNADKRFFRKIGKHFTVREITDFSTYDQYLKQRTHLFELIRN----------
>SAKL0E07612g
------------------------MEDVLQFTACFNDLVPSRPTEHLGDSDLSFGGKLSP
PLKIHEDGGESGCGGKVWIAGELLCEFLLEKSDQQGLFSQWNSDTRFQSPIKKIVELGSG
TGLVGLCLGLLNKQNKLKDVDIYVTDIDQLVTLMDRNIKLNELEH-VFPKELWWGEPLKP
EFAP---------TRSNQRQVDLILAADCVYLEKAFPLLEVTLLDLT-SCKDPPIILMSY
KKRRKADKHFFKQIKKNFDVLEINEFTRFDHYLKQKTHLFQLVRKFK--------
>Suva_14.323
------------------------MDGI--FGG-FEDLVVPRLKEHFGQTDLSFGGKLLP
ALKICEDGGESGCGGKVWIAGELLCEYILEKSDD-HLLSETVHEK---RPFMKVLELGSG
TGLVGLCVGLLEKNKFHDNTKVYVTDIDRLVPLMERNIELDKVQYEVLARELWWGEPLSG
DFSP-------QEGDLQVNNVDLVLAADCVYLEKAFPLLEKTLLDLT-NCISPPVILMAY
KKRRKADKQFFNKIKRNFDVLEIKDFIKFDYYLKQKTHLFQLVRKCSSHSEA---
>Skud_14.305
------------------------MDTI--FGG-FEDLVVPRATEHLGQTDLSFGGKLLP
ALKICEDGGESGCGGKVWIAGELLCEYILEKSLH-HLLSEATHGR---RQFKKVLELGSG
TGLVGLCVGLLEKNTFHDGSKVYVTDIDKLVPLLERNIELDKVQYEVLARELWWGEPLSV
DFSP-------QEGDLQTNNVDLVLAADCVYLEKAFPLLERTLLDLT-NCISPPVILMAY
KKRRKADKHFFSKIKRNFDVLEITDFSKFDHYLKQRTHLFQLIRKHTV-------
>Smik_14.307
------------------------MDSI--FGG-FGDLVVPRPKEHLGQTDLSFSGKLLP
ALKICEDGGESGCGGKVWIAGELLCEYILEKSVD-HLLSKTVDGK---KRFKKVLELGSG
TGLVGLCVGLLEKNVYHDGTKVYVTDIDKLVPLLKRNIELDKVQYEVLARELCWGEPLSA
DFSP-------QEGDLQTNNVDLVLAADCVYLEKAFPLLEKTLLDLT-DCVSPPVILMAY
KKRRKADKHFFNKIKRNFDVLEISNFSKFDYYLKQRTHLFQLIRK----------
>YNL024C
------------------------MESI--FGG-FGDLVVPRPKEHLGQTDLSFGGKLLP
ALKICEDGGESGCGGKVWIAGELLCEYILEKSVD-HLLSKTVNGT---KQFKKVLELGSG
TGLVGLCVGLLEKNTFHDGTKVYVTDIDKLIPLLKRNIELDEVQYEVLARELWWGEPLSA
DFSP-------QEGAMQANNVDLVLAADCVYLEEAFPLLEKTLLDLT-HCINPPVILMAY
KKRRKADKHFFNKIKRNFDVLEITDFSKFEHYLKERTHLFQLIRK----------
>NDAI0G00680
------------------------MDDI--FGSGFDDLVVARPLEHLGNSDLSFGGRLKN
PLKIHEDGGESGCGGKVWIAGELLCEFILEKSNSDDLLNGWASNS---KQFRKIVELGSG
TGLVGLCIGLLEKNNFHKDIDAYITDIDQIVPLMKQNIQLNGIENEVSAEELWWGEPLRK
TFAPSEHSRDKEEDFREEKKVDLILAADCVYLEKAFPLLEKTLLDLT-EGETPPTILMAY
RKRRKADKHFFQKIKKNFDIVEIKDFEKYEYYLKQRTHLFQLIRQ----------
>NCAS0G03770
------------------------MDGI--FGD-FEGLVVPRPVEHLGNSDLSFGGKLRS
PLKIHEDGGESGCGGKVWIAGELLCDFILEKSGTEDLLNKWPHDGE--RRFRNVLELGSG
TGLVGLCVGLLEKNRFHKNIGVHITDIDQLVPLMQRNIELNGVSKEVVAEGLWWGEPLLE
SFAP-----STVDNLPKTNVVDLILAADCVYLEDAFPLLERTLLDLT-ESETPPVILMSY
RKRRKADKHFFNKIKKNFDVIEVKDFTKYEMYLKMRTHLFQLARRF---------