MUSCLE (3.8) multiple sequence alignment

ADL218C            -------------------MSYILQQKVSFGADNWCLRLRPLYQ--AGVLAALSNGHVHL
TPHA0C03370        -------------------MSAKLVNQITFGNDNWCLELKPLYS--RGLLCSSSNGSVNL
CAGL0G01628g       --------------------MYSLAGSCNFGSNNWCLKLQPVHN---GILTSVSSGEVHL
Ecym_3321          -------------------MSYTKCDTISFGSDNWCLKLQPLYS--RGLLSALSNGHVHL
KLLA0E08449g       -------------------MSFNKYKCRYFEENNWCLKLQPLYQ--HGLMTSISDGSVHL
KNAG0H02040        ------------------MSQCSQIGSYFFGSENWCFQIQPLYK--AGILTSLSNGEVHL
SAKL0E07766g       -------------------MSYSKLHTASFGCENWCLQLQPLYN--RGLLTSLSNGHIHL
KLTH0G10296g       MIINLLISQSSRTSRTTYSMSYSKLESIEFGPNNWCLKLQPIYN--SGLLTSLSNGRVEL
Kwal_27.11550      -------------------MSYSKVDSINFGADNWCLKLQPLYN--RGLLASLSNGSVQL
Kpol_1003.34       ------------------MSSYSLLHSNSLGRTDWCLELQPLYR--HGLLSSLSNGDVNL
TBLA0B05920        -------------------MSVIPINLTSFGSNNWCLKFKPLYN--YGLLTSLSNGEISI
TDEL0G02140        ------------------MASYSNLHTQDFGSDNWCLGLQPFYN--HHLLTSLSNGEVHH
NCAS0G03870        -----------------MSSSYSLVNSRSFGSNNWALKLQPLQHGNNGLLTSLSNGEVHY
NDAI0G00630        ----------------MSISPYSLLNSHSFGSNNWCFKFQPLDKA-NGLLLSLSNGEIHC
Suva_14.311        ------------------MNSYSLVDLNSFGSENWCLKLQPAYK--HGLLTGLSNGEICL
Skud_14.298        ------------------MSSYSLVESNSFGSENWCLKLQPSYK--YGLLTGLSNGEIRL
Smik_14.296        ------------------MASYSLVESNFFGSENWCLKLQPSYK--HGLLTGLSNGEIRL
YNL035C            ------------------MASYSLVESNSFGSENWCLKLQPSYK--HGLLTGLSNGEIRL
ZYRO0A01804g       -------------------MSYSLVNSESFGNNNWCLNLQPAYQ--HSLLASLSNGQVHQ
KAFR0H03340        -------------------MSYSLVQEQSFGSDNWCLKFQPLYN--HGLLTSLSNGEVKL
                                                :   :*.: :.*       :: . *.* :  

ADL218C            VDWATGKSVLDVAAHESSINGLQVLDSAHDRGTVFATAADDGVKLFDIR--TRG-CVATL
TPHA0C03370        IDWNSPSIIKKFEVGETNINSLRVINNDFENGCIFAATSLASVKIYDVR--NGDSPVATI
CAGL0G01628g       LGLDLSKQ-DSFKVGETSINALSRVDGQ---ENLFAASNGNKVKVFDLR--ENK-EVATL
Ecym_3321          IDWNSLTSIQDIPVHGTSISALKVLDNDVDSGNTFVTASEDSVKIFDLR--LNQ-CVATV
KLLA0E08449g       LDWGNLKTISSIQCHTTSINDMKVINSDFDTGAVFATAAEDGVKVWDIR--ARN-NVASL
KNAG0H02040        MDWKSNKSINKFKSDETAINALQIVNTDWHNETRFITASMHAVKLFDVR--SNA-CIGTI
SAKL0E07766g       VDWCTGEIIHEFAAHSASISNLKVLNNEFTNSDLFASASKDSVKIFDVR--TSS-CVATL
KLTH0G10296g       IDWATHKSILQIQTHATSVNDMVIINNDRMNGSLIATAAEDAVKIYDLK--SND-CVATL
Kwal_27.11550      IDWVKNKQISQIQAHGTTISDMVVLNNDRNNGFLIATAAEDSVKIFDLR--SSD-TVATL
Kpol_1003.34       LDWNTGNCIRTVKAGNTSINRMRVLDSDYDNGSVFSVAMNDAVKVLDLRVQGNS-IVAEL
TBLA0B05920        LDWKTNQIKDKIKIGETSINDFEIVNNNYNGGSLMVTATNESVKIYDLK--SND-CIKTI
TDEL0G02140        IDWVTGKSVRVDQAGNSSINKLKIIDSNFNEGSSYAVASNDSVNILDVR--SRD-KLASL
NCAS0G03870        LDPSTLTTIQKYNISETSINDLQLINHNPTSSPLFTTATSNSVKIFDIH--STK-EVATI
NDAI0G00630        LDFGTCQSKQSIRVSNLSINDLKILNSDFHCGSLFSTATAESVKIFDIN--SNNGPIATL
Suva_14.311        LDWNTGKPLQKIRASETAINDMKIIDSDFVAGNLISSASIDSVKVFDIR--SND-CVAKI
Skud_14.298        LDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSSASIDAVKVFDIR--TNA-CVAKI
Smik_14.296        LDWATCKSLQNIKASETAINDLKVIDSDFSAGHLVSSASIDAVKVFDIR--TNS-CIATI
YNL035C            LDWSTGKSVQKIKASETAINDMKVIGSDFSAGHLVSSASIDAVKVFDIR--TND-RIAQI
ZYRO0A01804g       LDWQTGKSIAHIKTGEVAVNKLKLINNDHENESTYATATMGAVKIWDIR--SNN-CLATI
KAFR0H03340        LDWETLNPVRNFKIDQVSINSMKLINNDYNNASLFATATLNSVKIYDIK--SND-CIATI
                   :.                :. :  :.           :    *:: *:.       :  :

ADL218C            TDANGAPALSLDSRHGMLAFGTELVGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFH
TPHA0C03370        KNDKNSVFLSLESRHDMLVCGTELTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFH
CAGL0G01628g       EQENGANVLSLGSGHGMLAYGSEQQGVDAHLHLFDIRNWSKPVRSFVDSHQDDITSIAFH
Ecym_3321          QNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFH
KLLA0E08449g       QNDKASPFFSLDSRHNMLACGTELKDYDAELHIYDIRNWTKPVRSFVDSHHDDITDIKFH
KNAG0H02040        HNEVGAPFLSLDSRYDKIACGTELKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFH
SAKL0E07766g       HNDKSAPFLSLDSRHDMLACGTELSGVDAELHIYDIKKLSKPLRSFVDSHHDDITDTKFH
KLTH0G10296g       KNGKSAPFLSLDSRHGLLGCGTELSGVDAELHVYDIRSWQQPLRSLVDSHHDDITSIKFH
Kwal_27.11550      KNEKSAPFLSLDSRHGMLACGTELSGVDAELHIYDMKAWHQPLRSLVDSHHDDITNIKFH
Kpol_1003.34       NNEKKTPFLSLDSRHGMLACGTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFH
TBLA0B05920        TNEKNSPFLSLDSLHNMMACGTELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFH
TDEL0G02140        KNDKNAPFLSLDSRHGMLACGTELSGVDAELHIYDVRNWSTPIRSFVDSHHDDVTDIRFH
NCAS0G03870        HSQGNVPFPSLDSRHGLLACGTELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWH
NDAI0G00630        HNDKNVPFLSLDSRHGLLAMGTELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFH
Suva_14.311        NNETNSPFLSLDSRHGLLACGTELQGIDAAIHIYDVRKWDAPLRSLVDSHHDDVTCIKFH
Skud_14.298        HNEANSPFISLDSRHGLLACGTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFH
Smik_14.296        QNESNSPFLSLDSRHGLLACGTELQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFH
YNL035C            QNEANSPFISLDSRHGLLACGTELQGIDAAVYIYDIRKWDTPLRSLIDSHHDDVTCIKFH
ZYRO0A01804g       SNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFH
KAFR0H03340        TNDKKSPFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFH
                    .       ** * :. :  *:*  . ** : :: :     * . : ***:**:*   :*

ADL218C            PTDSNLLLSGSTDGYVNVYDLKQSEEDEALHQVINFASIHSCGWLSPKRIWSLSHMETFA
TPHA0C03370        PSDKNILLSGSTDGYTNIYDLAQEDEDEALHQVINYASIHSCGWLSPKRIYTLSHMETFA
CAGL0G01628g       PADANVLLSGSTDGYTNVYDLLEPEEEDALHQVINYASIHSCGWLAPRRIFTLSHMETFA
Ecym_3321          ASDPSVLLSGSTDGYVNVYDLKQQEEEEALHQVINFASIHSCGWLSPKRIWALSHMETFS
KLLA0E08449g       PCDSNLLMSGSTDGYVNIYDLTQDDEEDALHQVINFASIHSCGWLGPKRIWSLSHMETFG
KNAG0H02040        PSDCNVLLSGSTDGYTNIYDLSQEEEDDSLHQVINFTSIHSCGWVNPKRIYTLSHMETFA
SAKL0E07766g       PGDPGVLMSGSTDGYVNIYDLTNSDEEDALHQVINFASVHSCGWLAPRRIYTLSHMETFA
KLTH0G10296g       PSDPNVLLSGSTDGYVNIYDLTQQEEDDALHQVINFASIHSCGWLSPKRIYTLSHMETYG
Kwal_27.11550      PTDPNVLLSGSTDGYVNIYDLTQPEEDDALHQVINFASIHSSGWCAPKRIYTLSHMETFG
Kpol_1003.34       PSDPNVLLSGSTDGYTNVYDLTQVEEEDALHQVINYESVHSCGWLSPKRIYTLSHMETFA
TBLA0B05920        PNDSKVLMSGSTDGYTNIYDLTETEEEDSLHQVINYSSIHSCGWLSSRRIFTLSHMETFA
TDEL0G02140        PSDRNVLLSGSTDGYTNVYDLKQQEEDDALHQVINYASIHSCGWLSPKRIFTLSHMETLA
NCAS0G03870        PNDPNILLSGSTDGYTNVYDLSEAEEEDSLHQVINFASIHSCGWLSPRRIFTLSHMETFA
NDAI0G00630        PSDPTVLLSGSTDGYTNVYDLTQQDEDDALHQVMNYASIHSCGWLSPNRIFTLSHMETFA
Suva_14.311        PSDVNVLLSGSTDGYTNIYDLKQDDEEDALHQVINYASIHSCGWLSPKRIYTLSHMETFS
Skud_14.298        PSDVNVLLSGSTDGYTNIYDLKQDEEEDALHQVINYASIHSCGWLSQKRIYTLSHMETFA
Smik_14.296        PSDVNILLSGSTDGYTNIYDLKQDEEEDALHQVINYASIHSCGWLSPKRIYTLSHMETFA
YNL035C            PSDVNILLSGSTDGYTNIYDLKQDEEEDALHQVINYASIHSCGWLSPKRIFTLSHMETFA
ZYRO0A01804g       PSDPNVLMSGSTDGYTNIYDLRQAEEEDALHQVINFASIHSCGWLAPRRIFTLSHMETFS
KAFR0H03340        PSDSNFLLSGSTDGYTNVYDLTQQEEDDALYQVINYASIHSCGWLSPRRIYTLSHMETFS
                   . *  .*:*******.*:*** : :*:::*:**:*: *:**.**   .**::****** .

ADL218C            IHELNDKSEHANEPQPQLFGDVREPWACDYVVDVYPGFIAAGST-RENAGELRLLPLRDE
TPHA0C03370        IHELNDKSDELTEPRPLDFGDIRGQWDCDYVVDLYPGYVAMGKS-AENAGELKICGFENE
CAGL0G01628g       IHELNDKSEELREPQPLDFGDIRQPWDCNYVVDIYPGYISAGVS-EEGKGALRIIPFRNE
Ecym_3321          IHELNDKSDELVEPKPLEFGDIRKPWNCDYVVDIFPGCIITGST-QE-QSMLQLLPFSNE
KLLA0E08449g       IHELNDKSDEMIEPKPLEFGDVRDKWGCDYVIDIYPSFIATGKT-HESQGELKIIPFQNE
KNAG0H02040        IHELNNKSDELTEPQPLDFGDIRAAWGCDYVVDIYPGYVATGKSHEEGKGELKLIPLKGE
SAKL0E07766g       IHELNDKSDDLREPKPVEFGDVRQPWGCDYIININPGFIAAGRS-QETQGELKLIAFNDE
KLTH0G10296g       IHELNDKRDEPTEPKPVDFGDVRKPWDCNYVIDVYPGFIATGKS-EEGRGELKLIPLDHE
Kwal_27.11550      IHELNDKLEEPTEPHPKDFGDIRQSWGCDYVVDVYPGFIATGKS-QEGQGEVKLIPFTGE
Kpol_1003.34       IHELNNKSDELTEPKPLDFGDIRGTWDCDYVVDVYPGYIAVGKS-EENNGNLKIIPFHNE
TBLA0B05920        IHQLNDKSEVLKEPKPIEFGDIRNDWGCNYVIDVYPGYIATGKT-EESKGQLKISPFNNE
TDEL0G02140        MHELNDKSDELREPQPLDFGDIREKWGCSYVVDLYPGYVAVGSS-QERSSFLKLMALENE
NCAS0G03870        IHELNDKSDTLKEPQPIDMGDVREKWGCDYVVDVYPGFIATGKS-QERQGELKLIPLQDE
NDAI0G00630        IHELNDKSEELKEPQPLDFGDVREKWGCDYVIDVYPGYIAAGKS-QEGNGQLKLIPTNGE
Suva_14.311        IHELNDKSDELKEPQPLDFGDIRKAWNCDYVVDVYPGFIATGKT-QEGAGELRLLPFKDE
Skud_14.298        IHELNDKSDEFKEPRPADFGDIREAWNCDYVVDVYPGLIATGKT-QEGAGELRLLPFRDE
Smik_14.296        IHELNDKSDELREPQPLDFGDVRKAWDCDYVVDIYPGLIATGKT-QENAGELRLIPFKNE
YNL035C            IHELNDKSDELKEPQPLDFGDVREIWNCDYVVDIYPGLIATGKT-QENCGELCLLPFKDE
ZYRO0A01804g       IHELNDKSDEAKEPRPVEFNDVRESWGCDYVVDIHPGYVACGNS-QEGIGKLRILPFQGE
KAFR0H03340        ISELNDRTDELREPQPLDFGDIRDQWNCDYVIDIYPGYIATGRS-QEGNGNLQIIPMDGE
                   : :**:. :   **.*  :.*:*  * *.*:::: *. :  * :  *  . : :     *

ADL218C            CVDA--ANAIVLPQAHGDEVVRDVLVPA----SSPELLYSAGEDGNMAIWK--STLGPLN
TPHA0C03370        IMNT--ENHIIIPNAHGDEVIRDVFIPPGNLNNHSDIIYSCGEDGNVNIWHAPRCSSILN
CAGL0G01628g       HVQA--KDTITISQAHGDEIVRDTYILP----SQSDMLYSCGEDGQVKAWR---NDIKLD
Ecym_3321          EVDT--TNSIIIPRAHGDEVVRDALIHK----TTSELFYSGGEDGNIVLWK--SNRGSLN
KLLA0E08449g       QVDV--SSALVIPDAHGNEVIRDVLIPK----NQTSLLYSCGEDGYVNVWK--DTTNSLN
KNAG0H02040        NVVI--DNTISIPSAHGDEVIRDVFIPE----QNSEVVYSCGEDGYLNIWR--NNSGPLN
SAKL0E07766g       KVDT--TNVLTIPQAHGDEIIRDVLIPD----QTTDMLYSCGEDGCLNIWK--SQTGPLN
KLTH0G10296g       KPEL--QSAITIPSAHDDEVVRDVLVPF----QHEDLLYSCGEDGSLKVWK--SSAGPLN
Kwal_27.11550      DLDL--DSAVTIPSAHGDEVVRDVLVPF----QHEDMLYTCGEDGCVNAWK--SNRGPLN
Kpol_1003.34       LLNI--NDSISIPNAHGDEVVRDVFISP----KSQNIMYSCGEDGSVKTWK--IENNSLQ
TBLA0B05920        KIDLAEDNNIIIPQAHGDEVIRDVFINP----NDPSNMYSCGEDGNVKLWKIDTTTKSLK
TDEL0G02140        QIET--EKSLVIPSAHGEEVVRDVLIPP----QNCNMLYSCGEDGTVKIWK--TKDTGFH
NCAS0G03870        TIDL--TNSIVIPGAHDDEVIRDVYIPS----HDSVMMYTCGEDGNVKLWK--NNNGPLN
NDAI0G00630        NISV--KDSVVIPSAHGDEVIRDVFIPP----SHSELVYSCGEDGFVNLWK--NNNGALN
Suva_14.311        KIDT--GNGIVIPHAHGDEVVRDVFVSE----QNTDVLYSCGEDGCVKIWK--NSLGCLN
Skud_14.298        KVDA--ENEIVIPRAHGDEVVRDVFISA----LQSDLLYSCGEDGFVKIWK--NNLGPLN
Smik_14.296        KIYT--EKCFVIPHAHGDEVVRDIFISA----HQSDMLYSCGEDGYVKIWK--STQGPLN
YNL035C            KVDT--ENGIVIPHAHGDEVVRDIFIPA----QHSNMLYSCGEDGCVKIWE--NKQGPLD
ZYRO0A01804g       QVDT--NNAIDINAAHGDEVVRDVFVPA----RNSKLLYSCGEDGSVKTWE--NKSGPLN
KAFR0H03340        TVES--SKAITIDRAHSDEVIRDVFIPR----NHHNVLYSCGEDGTVKSWK--SPHSQST
                          . . :  **.:*::**  :           .*: **** :  *          

ADL218C            VPVDFWDYSKK-ETVLEDLPSSGLD--------DTHSAQHNDQASSLSGQSQPEQQEYRQ
TPHA0C03370        VSKDFWNATEQ-LDVLSDD--------------YNMLVGRNNEQYGENSEIKKHIKPLMI
CAGL0G01628g       IPETFWDYSTK-MSLLSD-----------------EVPEVQLEKQPVEVIADKSEKRKNK
Ecym_3321          VPTEFWNYQEK-LNVLHDPNIEIDMTVEKDIAFESEHGIPTDFNKTPETEAEFGIQKESK
KLLA0E08449g       VPHNFWDYTLP-FTAFENSVREIEMDMGQETMQHESSSTSEQDSTSTGSDDEHKEKKDKK
KNAG0H02040        VPEKFWNYDIP-MNVLDESLDSFA---------GQPPISLQSEPSAMDTALKSETKKHKK
SAKL0E07766g       ISRDFWDYSKR-FNVFEDTVVEVDM--------DDTPNQYFTTDTELSISSEEKQKEKKK
KLTH0G10296g       VPQEFWQYSEK-IDVFSGTVAEVEMM-------DSEVPDIELRQEPSDVDAVSKDQDEKR
Kwal_27.11550      VPQEFWSYADQ-IDVFSGSVAEVEMT-------DNSAPDPVAEPNEEEAETSTKERKKKK
Kpol_1003.34       VPPGFWDYSTQ-INVLDDNID------------EQNIEQSTRNISEPSIEKEKKKSKHKK
TBLA0B05920        IPEHFFDYSLR-LNVLDEINENDDDI-------EVDMGTENTEPGVSEGKHKKSHKKEKK
TDEL0G02140        IEPGFWDYSKK-MDVFSE---------------EATTPEAIPAALGNGVVYEQEVEPPKK
NCAS0G03870        VPEQLWDYSKR-VNMLEDTL-------------------LAPSEVVTAGEVKQSQEPDTK
NDAI0G00630        VPEQFWDYSKRTMHVLDG---------------DFSLESGNEVEKSKLGVEKREKSKKSK
Suva_14.311        TPASFWDYSER-ISVLE----------------DENKEAPTSLEEPLIIQKESVATKPRK
Skud_14.298        TPESFWDYSEK-LNVLD----------------EDHKQSSISLKEPIIIQKESAVTKPRK
Smik_14.296        TPETFWDYSEK-MNVLG----------------DDSKEAFTNLEEPLIIQKDLASTKPRK
YNL035C            IPENFWDYSKK-MNVLG----------------DDDREGSINLDEPLIIQKESVSTRPRK
ZYRO0A01804g       VTDEFWDYSQL-LNVLDE---------------------------QPVVVEEPKETKHSK
KAFR0H03340        ALEEFWDYSQR-FNVF-----------------------------------EQSQSPAPK
                       ::.        :                                            

ADL218C            VQSDGMR-----RNRSSKHSKKH------SARFTPY------
TPHA0C03370        TKKS--------RNIKAKNINRNVIKTNTPQRLVLNLIRICL
CAGL0G01628g       KKKK--------HSK--------------KNRFKPY------
Ecym_3321          RRNH--------THDRNNEKKRKL----KSHRFTPY------
KLLA0E08449g       EKKHSKKNKHGKKDRKSDKKSKSKSKKEKEHRYKPY------
KNAG0H02040        KKEK--------RSKEQKHPK--------SQRYKPY------
SAKL0E07766g       KKDK--------KQKKSKKKK--------SHRYKPY------
KLTH0G10296g       KRKH--------ERRSKDKSKSKTKSSSKDHRYQPY------
Kwal_27.11550      KRDS--------KKSAKDSSKKSSQKSSKSHRFQPY------
Kpol_1003.34       SKHS-------------------------KRRYKPY------
TBLA0B05920        SKKS--------KKKSSKHSK--------KARFKPY------
TDEL0G02140        KEKK--------KGKQKSHAK--------SRRYKPY------
NCAS0G03870        EKKH--------KKKKRDH----------KQRYKPY------
NDAI0G00630        SKKS--------KKKEKKHSK--------SQRFKPY------
Suva_14.311        EKHK--------KTKKHSK----------KSRFKPY------
Skud_14.298        EKHK--------KSNKLST----------KSRFKPY------
Smik_14.296        EKHK--------KSKKHST----------KSRFRPY------
YNL035C            EKHK--------KAKKHSM----------KSRFKPY------
ZYRO0A01804g       KKHS--------KSKKSN-----------KQRFKPY------
KAFR0H03340        KKHS--------KKKKH------------AIRYKPY------
                                                  *          

FASTA FORMAT for MUSCLE Version 3.6

>ADL218C
-------------------MSYILQQKVSFGADNWCLRLRPLYQ--AGVLAALSNGHVHL
VDWATGKSVLDVAAHESSINGLQVLDSAHDRGTVFATAADDGVKLFDIR--TRG-CVATL
TDANGAPALSLDSRHGMLAFGTELVGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFH
PTDSNLLLSGSTDGYVNVYDLKQSEEDEALHQVINFASIHSCGWLSPKRIWSLSHMETFA
IHELNDKSEHANEPQPQLFGDVREPWACDYVVDVYPGFIAAGST-RENAGELRLLPLRDE
CVDA--ANAIVLPQAHGDEVVRDVLVPA----SSPELLYSAGEDGNMAIWK--STLGPLN
VPVDFWDYSKK-ETVLEDLPSSGLD--------DTHSAQHNDQASSLSGQSQPEQQEYRQ
VQSDGMR-----RNRSSKHSKKH------SARFTPY------
>TPHA0C03370
-------------------MSAKLVNQITFGNDNWCLELKPLYS--RGLLCSSSNGSVNL
IDWNSPSIIKKFEVGETNINSLRVINNDFENGCIFAATSLASVKIYDVR--NGDSPVATI
KNDKNSVFLSLESRHDMLVCGTELTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFH
PSDKNILLSGSTDGYTNIYDLAQEDEDEALHQVINYASIHSCGWLSPKRIYTLSHMETFA
IHELNDKSDELTEPRPLDFGDIRGQWDCDYVVDLYPGYVAMGKS-AENAGELKICGFENE
IMNT--ENHIIIPNAHGDEVIRDVFIPPGNLNNHSDIIYSCGEDGNVNIWHAPRCSSILN
VSKDFWNATEQ-LDVLSDD--------------YNMLVGRNNEQYGENSEIKKHIKPLMI
TKKS--------RNIKAKNINRNVIKTNTPQRLVLNLIRICL
>CAGL0G01628g
--------------------MYSLAGSCNFGSNNWCLKLQPVHN---GILTSVSSGEVHL
LGLDLSKQ-DSFKVGETSINALSRVDGQ---ENLFAASNGNKVKVFDLR--ENK-EVATL
EQENGANVLSLGSGHGMLAYGSEQQGVDAHLHLFDIRNWSKPVRSFVDSHQDDITSIAFH
PADANVLLSGSTDGYTNVYDLLEPEEEDALHQVINYASIHSCGWLAPRRIFTLSHMETFA
IHELNDKSEELREPQPLDFGDIRQPWDCNYVVDIYPGYISAGVS-EEGKGALRIIPFRNE
HVQA--KDTITISQAHGDEIVRDTYILP----SQSDMLYSCGEDGQVKAWR---NDIKLD
IPETFWDYSTK-MSLLSD-----------------EVPEVQLEKQPVEVIADKSEKRKNK
KKKK--------HSK--------------KNRFKPY------
>Ecym_3321
-------------------MSYTKCDTISFGSDNWCLKLQPLYS--RGLLSALSNGHVHL
IDWNSLTSIQDIPVHGTSISALKVLDNDVDSGNTFVTASEDSVKIFDLR--LNQ-CVATV
QNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFH
ASDPSVLLSGSTDGYVNVYDLKQQEEEEALHQVINFASIHSCGWLSPKRIWALSHMETFS
IHELNDKSDELVEPKPLEFGDIRKPWNCDYVVDIFPGCIITGST-QE-QSMLQLLPFSNE
EVDT--TNSIIIPRAHGDEVVRDALIHK----TTSELFYSGGEDGNIVLWK--SNRGSLN
VPTEFWNYQEK-LNVLHDPNIEIDMTVEKDIAFESEHGIPTDFNKTPETEAEFGIQKESK
RRNH--------THDRNNEKKRKL----KSHRFTPY------
>KLLA0E08449g
-------------------MSFNKYKCRYFEENNWCLKLQPLYQ--HGLMTSISDGSVHL
LDWGNLKTISSIQCHTTSINDMKVINSDFDTGAVFATAAEDGVKVWDIR--ARN-NVASL
QNDKASPFFSLDSRHNMLACGTELKDYDAELHIYDIRNWTKPVRSFVDSHHDDITDIKFH
PCDSNLLMSGSTDGYVNIYDLTQDDEEDALHQVINFASIHSCGWLGPKRIWSLSHMETFG
IHELNDKSDEMIEPKPLEFGDVRDKWGCDYVIDIYPSFIATGKT-HESQGELKIIPFQNE
QVDV--SSALVIPDAHGNEVIRDVLIPK----NQTSLLYSCGEDGYVNVWK--DTTNSLN
VPHNFWDYTLP-FTAFENSVREIEMDMGQETMQHESSSTSEQDSTSTGSDDEHKEKKDKK
EKKHSKKNKHGKKDRKSDKKSKSKSKKEKEHRYKPY------
>KNAG0H02040
------------------MSQCSQIGSYFFGSENWCFQIQPLYK--AGILTSLSNGEVHL
MDWKSNKSINKFKSDETAINALQIVNTDWHNETRFITASMHAVKLFDVR--SNA-CIGTI
HNEVGAPFLSLDSRYDKIACGTELKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFH
PSDCNVLLSGSTDGYTNIYDLSQEEEDDSLHQVINFTSIHSCGWVNPKRIYTLSHMETFA
IHELNNKSDELTEPQPLDFGDIRAAWGCDYVVDIYPGYVATGKSHEEGKGELKLIPLKGE
NVVI--DNTISIPSAHGDEVIRDVFIPE----QNSEVVYSCGEDGYLNIWR--NNSGPLN
VPEKFWNYDIP-MNVLDESLDSFA---------GQPPISLQSEPSAMDTALKSETKKHKK
KKEK--------RSKEQKHPK--------SQRYKPY------
>SAKL0E07766g
-------------------MSYSKLHTASFGCENWCLQLQPLYN--RGLLTSLSNGHIHL
VDWCTGEIIHEFAAHSASISNLKVLNNEFTNSDLFASASKDSVKIFDVR--TSS-CVATL
HNDKSAPFLSLDSRHDMLACGTELSGVDAELHIYDIKKLSKPLRSFVDSHHDDITDTKFH
PGDPGVLMSGSTDGYVNIYDLTNSDEEDALHQVINFASVHSCGWLAPRRIYTLSHMETFA
IHELNDKSDDLREPKPVEFGDVRQPWGCDYIININPGFIAAGRS-QETQGELKLIAFNDE
KVDT--TNVLTIPQAHGDEIIRDVLIPD----QTTDMLYSCGEDGCLNIWK--SQTGPLN
ISRDFWDYSKR-FNVFEDTVVEVDM--------DDTPNQYFTTDTELSISSEEKQKEKKK
KKDK--------KQKKSKKKK--------SHRYKPY------
>KLTH0G10296g
MIINLLISQSSRTSRTTYSMSYSKLESIEFGPNNWCLKLQPIYN--SGLLTSLSNGRVEL
IDWATHKSILQIQTHATSVNDMVIINNDRMNGSLIATAAEDAVKIYDLK--SND-CVATL
KNGKSAPFLSLDSRHGLLGCGTELSGVDAELHVYDIRSWQQPLRSLVDSHHDDITSIKFH
PSDPNVLLSGSTDGYVNIYDLTQQEEDDALHQVINFASIHSCGWLSPKRIYTLSHMETYG
IHELNDKRDEPTEPKPVDFGDVRKPWDCNYVIDVYPGFIATGKS-EEGRGELKLIPLDHE
KPEL--QSAITIPSAHDDEVVRDVLVPF----QHEDLLYSCGEDGSLKVWK--SSAGPLN
VPQEFWQYSEK-IDVFSGTVAEVEMM-------DSEVPDIELRQEPSDVDAVSKDQDEKR
KRKH--------ERRSKDKSKSKTKSSSKDHRYQPY------
>Kwal_27.11550
-------------------MSYSKVDSINFGADNWCLKLQPLYN--RGLLASLSNGSVQL
IDWVKNKQISQIQAHGTTISDMVVLNNDRNNGFLIATAAEDSVKIFDLR--SSD-TVATL
KNEKSAPFLSLDSRHGMLACGTELSGVDAELHIYDMKAWHQPLRSLVDSHHDDITNIKFH
PTDPNVLLSGSTDGYVNIYDLTQPEEDDALHQVINFASIHSSGWCAPKRIYTLSHMETFG
IHELNDKLEEPTEPHPKDFGDIRQSWGCDYVVDVYPGFIATGKS-QEGQGEVKLIPFTGE
DLDL--DSAVTIPSAHGDEVVRDVLVPF----QHEDMLYTCGEDGCVNAWK--SNRGPLN
VPQEFWSYADQ-IDVFSGSVAEVEMT-------DNSAPDPVAEPNEEEAETSTKERKKKK
KRDS--------KKSAKDSSKKSSQKSSKSHRFQPY------
>Kpol_1003.34
------------------MSSYSLLHSNSLGRTDWCLELQPLYR--HGLLSSLSNGDVNL
LDWNTGNCIRTVKAGNTSINRMRVLDSDYDNGSVFSVAMNDAVKVLDLRVQGNS-IVAEL
NNEKKTPFLSLDSRHGMLACGTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFH
PSDPNVLLSGSTDGYTNVYDLTQVEEEDALHQVINYESVHSCGWLSPKRIYTLSHMETFA
IHELNNKSDELTEPKPLDFGDIRGTWDCDYVVDVYPGYIAVGKS-EENNGNLKIIPFHNE
LLNI--NDSISIPNAHGDEVVRDVFISP----KSQNIMYSCGEDGSVKTWK--IENNSLQ
VPPGFWDYSTQ-INVLDDNID------------EQNIEQSTRNISEPSIEKEKKKSKHKK
SKHS-------------------------KRRYKPY------
>TBLA0B05920
-------------------MSVIPINLTSFGSNNWCLKFKPLYN--YGLLTSLSNGEISI
LDWKTNQIKDKIKIGETSINDFEIVNNNYNGGSLMVTATNESVKIYDLK--SND-CIKTI
TNEKNSPFLSLDSLHNMMACGTELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFH
PNDSKVLMSGSTDGYTNIYDLTETEEEDSLHQVINYSSIHSCGWLSSRRIFTLSHMETFA
IHQLNDKSEVLKEPKPIEFGDIRNDWGCNYVIDVYPGYIATGKT-EESKGQLKISPFNNE
KIDLAEDNNIIIPQAHGDEVIRDVFINP----NDPSNMYSCGEDGNVKLWKIDTTTKSLK
IPEHFFDYSLR-LNVLDEINENDDDI-------EVDMGTENTEPGVSEGKHKKSHKKEKK
SKKS--------KKKSSKHSK--------KARFKPY------
>TDEL0G02140
------------------MASYSNLHTQDFGSDNWCLGLQPFYN--HHLLTSLSNGEVHH
IDWVTGKSVRVDQAGNSSINKLKIIDSNFNEGSSYAVASNDSVNILDVR--SRD-KLASL
KNDKNAPFLSLDSRHGMLACGTELSGVDAELHIYDVRNWSTPIRSFVDSHHDDVTDIRFH
PSDRNVLLSGSTDGYTNVYDLKQQEEDDALHQVINYASIHSCGWLSPKRIFTLSHMETLA
MHELNDKSDELREPQPLDFGDIREKWGCSYVVDLYPGYVAVGSS-QERSSFLKLMALENE
QIET--EKSLVIPSAHGEEVVRDVLIPP----QNCNMLYSCGEDGTVKIWK--TKDTGFH
IEPGFWDYSKK-MDVFSE---------------EATTPEAIPAALGNGVVYEQEVEPPKK
KEKK--------KGKQKSHAK--------SRRYKPY------
>NCAS0G03870
-----------------MSSSYSLVNSRSFGSNNWALKLQPLQHGNNGLLTSLSNGEVHY
LDPSTLTTIQKYNISETSINDLQLINHNPTSSPLFTTATSNSVKIFDIH--STK-EVATI
HSQGNVPFPSLDSRHGLLACGTELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWH
PNDPNILLSGSTDGYTNVYDLSEAEEEDSLHQVINFASIHSCGWLSPRRIFTLSHMETFA
IHELNDKSDTLKEPQPIDMGDVREKWGCDYVVDVYPGFIATGKS-QERQGELKLIPLQDE
TIDL--TNSIVIPGAHDDEVIRDVYIPS----HDSVMMYTCGEDGNVKLWK--NNNGPLN
VPEQLWDYSKR-VNMLEDTL-------------------LAPSEVVTAGEVKQSQEPDTK
EKKH--------KKKKRDH----------KQRYKPY------
>NDAI0G00630
----------------MSISPYSLLNSHSFGSNNWCFKFQPLDKA-NGLLLSLSNGEIHC
LDFGTCQSKQSIRVSNLSINDLKILNSDFHCGSLFSTATAESVKIFDIN--SNNGPIATL
HNDKNVPFLSLDSRHGLLAMGTELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFH
PSDPTVLLSGSTDGYTNVYDLTQQDEDDALHQVMNYASIHSCGWLSPNRIFTLSHMETFA
IHELNDKSEELKEPQPLDFGDVREKWGCDYVIDVYPGYIAAGKS-QEGNGQLKLIPTNGE
NISV--KDSVVIPSAHGDEVIRDVFIPP----SHSELVYSCGEDGFVNLWK--NNNGALN
VPEQFWDYSKRTMHVLDG---------------DFSLESGNEVEKSKLGVEKREKSKKSK
SKKS--------KKKEKKHSK--------SQRFKPY------
>Suva_14.311
------------------MNSYSLVDLNSFGSENWCLKLQPAYK--HGLLTGLSNGEICL
LDWNTGKPLQKIRASETAINDMKIIDSDFVAGNLISSASIDSVKVFDIR--SND-CVAKI
NNETNSPFLSLDSRHGLLACGTELQGIDAAIHIYDVRKWDAPLRSLVDSHHDDVTCIKFH
PSDVNVLLSGSTDGYTNIYDLKQDDEEDALHQVINYASIHSCGWLSPKRIYTLSHMETFS
IHELNDKSDELKEPQPLDFGDIRKAWNCDYVVDVYPGFIATGKT-QEGAGELRLLPFKDE
KIDT--GNGIVIPHAHGDEVVRDVFVSE----QNTDVLYSCGEDGCVKIWK--NSLGCLN
TPASFWDYSER-ISVLE----------------DENKEAPTSLEEPLIIQKESVATKPRK
EKHK--------KTKKHSK----------KSRFKPY------
>Skud_14.298
------------------MSSYSLVESNSFGSENWCLKLQPSYK--YGLLTGLSNGEIRL
LDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSSASIDAVKVFDIR--TNA-CVAKI
HNEANSPFISLDSRHGLLACGTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFH
PSDVNVLLSGSTDGYTNIYDLKQDEEEDALHQVINYASIHSCGWLSQKRIYTLSHMETFA
IHELNDKSDEFKEPRPADFGDIREAWNCDYVVDVYPGLIATGKT-QEGAGELRLLPFRDE
KVDA--ENEIVIPRAHGDEVVRDVFISA----LQSDLLYSCGEDGFVKIWK--NNLGPLN
TPESFWDYSEK-LNVLD----------------EDHKQSSISLKEPIIIQKESAVTKPRK
EKHK--------KSNKLST----------KSRFKPY------
>Smik_14.296
------------------MASYSLVESNFFGSENWCLKLQPSYK--HGLLTGLSNGEIRL
LDWATCKSLQNIKASETAINDLKVIDSDFSAGHLVSSASIDAVKVFDIR--TNS-CIATI
QNESNSPFLSLDSRHGLLACGTELQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFH
PSDVNILLSGSTDGYTNIYDLKQDEEEDALHQVINYASIHSCGWLSPKRIYTLSHMETFA
IHELNDKSDELREPQPLDFGDVRKAWDCDYVVDIYPGLIATGKT-QENAGELRLIPFKNE
KIYT--EKCFVIPHAHGDEVVRDIFISA----HQSDMLYSCGEDGYVKIWK--STQGPLN
TPETFWDYSEK-MNVLG----------------DDSKEAFTNLEEPLIIQKDLASTKPRK
EKHK--------KSKKHST----------KSRFRPY------
>YNL035C
------------------MASYSLVESNSFGSENWCLKLQPSYK--HGLLTGLSNGEIRL
LDWSTGKSVQKIKASETAINDMKVIGSDFSAGHLVSSASIDAVKVFDIR--TND-RIAQI
QNEANSPFISLDSRHGLLACGTELQGIDAAVYIYDIRKWDTPLRSLIDSHHDDVTCIKFH
PSDVNILLSGSTDGYTNIYDLKQDEEEDALHQVINYASIHSCGWLSPKRIFTLSHMETFA
IHELNDKSDELKEPQPLDFGDVREIWNCDYVVDIYPGLIATGKT-QENCGELCLLPFKDE
KVDT--ENGIVIPHAHGDEVVRDIFIPA----QHSNMLYSCGEDGCVKIWE--NKQGPLD
IPENFWDYSKK-MNVLG----------------DDDREGSINLDEPLIIQKESVSTRPRK
EKHK--------KAKKHSM----------KSRFKPY------
>ZYRO0A01804g
-------------------MSYSLVNSESFGNNNWCLNLQPAYQ--HSLLASLSNGQVHQ
LDWQTGKSIAHIKTGEVAVNKLKLINNDHENESTYATATMGAVKIWDIR--SNN-CLATI
SNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFH
PSDPNVLMSGSTDGYTNIYDLRQAEEEDALHQVINFASIHSCGWLAPRRIFTLSHMETFS
IHELNDKSDEAKEPRPVEFNDVRESWGCDYVVDIHPGYVACGNS-QEGIGKLRILPFQGE
QVDT--NNAIDINAAHGDEVVRDVFVPA----RNSKLLYSCGEDGSVKTWE--NKSGPLN
VTDEFWDYSQL-LNVLDE---------------------------QPVVVEEPKETKHSK
KKHS--------KSKKSN-----------KQRFKPY------
>KAFR0H03340
-------------------MSYSLVQEQSFGSDNWCLKFQPLYN--HGLLTSLSNGEVKL
LDWETLNPVRNFKIDQVSINSMKLINNDYNNASLFATATLNSVKIYDIK--SND-CIATI
TNDKKSPFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFH
PSDSNFLLSGSTDGYTNVYDLTQQEEDDALYQVINYASIHSCGWLSPRRIYTLSHMETFS
ISELNDRTDELREPQPLDFGDIRDQWNCDYVIDIYPGYIATGRS-QEGNGNLQIIPMDGE
TVES--SKAITIDRAHSDEVIRDVFIPR----NHHNVLYSCGEDGTVKSWK--SPHSQST
ALEEFWDYSQR-FNVF-----------------------------------EQSQSPAPK
KKHS--------KKKKH------------AIRYKPY------