MUSCLE (3.8) multiple sequence alignment

TBLA0B01230        --------------------------MLRLIGLFAAPSHLPAPL---------------Q
CAGL0L04070g       ------------------------------MTLFNNAITACTSRLLSMKTMGVSSF---G
NDAI0F02820        MENHTNHLGSLIYLASNIRYFQGNPKSYNLTPDMFTVSSMSSLFKTGLLSMGLKGQSFNS
Smik_14.206        ----------LETGVDEKER--EQIQIMSMFSIFNPLLKGSNNFKARFHGFLFNNV---S
Suva_14.218        ----------IKTSANSQR---GDRTNMSLFNLFNPLLKGSNSFKPRLNQLLFNNV---S
YNL122C            ----------MKISLHNKRQRGDQNQNMSVFNVLKPLLKGSNSFKVKLNGFLFNNV---S
Skud_14.210        ----------------------GVQITMSLFNVLNPLLKGSNSLRPKFNGILFNNV---C
ABR133W            ----------------------------MFFNMLRPLTGLPVRF-GSGAFAATTQP---S
Ecym_8202          ---------------------------MLIQGLFRPLEKLTSRFGGGVGCGSVGVS---Y
NCAS0G02470        ---------------------------MLPFSFLPTFYRARC----------LNLT---T
KAFR0J02090        ---------------------------MLFKPFFSALFTMGSSV------VRRESP---T
KNAG0I02130        ---------------------------MSFLSALSPLFKNGFAA------WKIPSA---S
SAKL0E10978g       ----------------------------MLSSLLRPLSNISVKF--GTSLSQIQHP---S
KLTH0B05214g       ----------------------------MLSNLMRSIMSYGRQI------TQLQQP---F
Kwal_33.14762      ----------------------------MLSYLVRSVFSFGKSF------SQIQQP---F
TDEL0B05130        --------------------------MMFFSSIINPIFRTCLNT-----FSKVEAP---S
KLLA0F24068g       ----------------------------MLSSIFGSMMNFSART--GLLGSKTNVS---S
ZYRO0G06490g       -------------------------------MFFNSIVGLGSRS-AFASFGGFNSS---S
Kpol_505.21        -----------------------------MFGINTGLFNSKISI----------------
TPHA0F01880        --------------------------MSMIGSLANSITKINAKN-----INIFNNKNVFH
                                                                               

TBLA0B01230        LSLVRGLHKLKLKTHKGTLKRWR--RRVAPGGPAAEQFVRSKAGRNHGNIGWSHRALAAL
CAGL0L04070g       MVFCRTL----MKTHRGALKRWR--Q-------TSTGFKRGIAGRKHGNIGWSHRSLKSL
NDAI0F02820        LVITRNL----MKTHKGAAKRWR--K-------SAQGFKRGIAGRNHGNVGWSHRYLNKL
Smik_14.206        TVTIRTL----MKTHKGTAKRWR--R-------TGNTFKRGIAGRKHGNIGWSHRSLKAL
Suva_14.218        TITIRTL----MKTHKGTAKRWR--R-------TGNTFKRGIAGRKHGNIGWSHRSLKVL
YNL122C            TITIRTL----MKTHKGTAKRWR--R-------TGNTFKRGIAGRKHGNIGWSHRSLKAL
Skud_14.210        TITIRTL----MKTHKGTAKRWR--R-------TGNTFKRGIAGRKHGNIGWSHRSLKAL
ABR133W            LIMVRTL----MKTHKGAAKRWR--K-------TAGGYKRSKAGRSHGNTGWGQRALKQL
Ecym_8202          LIFSRSL----MKTHKGAAKRWR--K-------TANSFKRGKAGRSHGNSGWSKNSLKVL
NCAS0G02470        LTITRNL----MKTHKGTAKRWR--R-------TAQSFKRGIAGRNHGNAGWSRRSLKHL
KAFR0J02090        LIIARNL----MKTHKGTAKRWR--K-------TANGFKRGIAGRNHGNGGWSRRSLKCL
KNAG0I02130        MIVTRSL----MKTHKGAAKRWR--K-------NANGFKRGISGRKHGNCGWSQRGLKAL
SAKL0E10978g       LVLTRNL----MKTHKGAAKRWK--K-------TANSYKRGRAGRNHGNAGWNKSTLKSL
KLTH0B05214g       MMQTRNL----MKTHKGTAKRWR--K-------TSTSYKRGRAGRNHGNAGWGKSTLKSL
Kwal_33.14762      MQQTRNL----MKTHKGTAKRWR--K-------TSTSYKRGRAGRNHGNAGWGKSTLKAL
TDEL0B05130        LILTRSL----MKTHKGAAKRWR--K-------TATSFKRGKAGRSHGNAGWSRRSLKSL
KLLA0F24068g       LILTRNL----MKTHKGAAKRWR--K-------TANSFKRGKAGRNHGNAGWSRNSLKSL
ZYRO0G06490g       LVFTRNL----MKTHKGTAKRWK--K-------TADGFKRGKAGRNHGNVGWSRRSLKVL
Kpol_505.21        LQITRSL----MKTHKGTAKRWKFIK-------SLDTFKRGKSGRQHGNVGWSQRSLKHL
TPHA0F01880        LDFRRTL----MKTHKGTAKRWKYIS-------KLDTFKRGKSGRQHGNIGWSQRSLKTL
                       * *    :***.*: ***.              : *. :**.*** **..  *  *

TBLA0B01230        SRRVPAHSTHVKALRKLLPY-
CAGL0L04070g       TGRTDAHPTQMKRLRRLMPYK
NDAI0F02820        TGRKEADPTHVKHLKRMLPYH
Smik_14.206        TGRKTANSAYLKHLKRLLPYH
Suva_14.218        TGRKTANSSYLKHLKRLLPYH
YNL122C            TGRKIAHPAYSKHLKRLLPYH
Skud_14.210        TGRKTAHPAYLKHLKRLLPYH
ABR133W            SGRTMAASAHLKRLRRLLPYH
Ecym_8202          SGRALANGSQLNRLKRLLPYH
NCAS0G02470        SGRKDADPSYLRHLKRLMPYK
KAFR0J02090        TGRKTATPSQAKRLKRLLPFG
KNAG0I02130        TGRTEAHQSQIKRLKKLLPYH
SAKL0E10978g       DGKTLAHPTHIKHLKRLLPYH
KLTH0B05214g       DGKTLAHPTHIKHLKRLLPYN
Kwal_33.14762      DGKTLAHSTHIKHLKRLLPYH
TDEL0B05130        SGKTLAHETHIKHLKRLMPN-
KLLA0F24068g       SGRSLADSTHMHRLKRLLPYH
ZYRO0G06490g       SGKTPAHESHIQRLRRLLPY-
Kpol_505.21        SGRTYAHTTHVSRLRKLLPYN
TPHA0F01880        SGRTYADKTHVSKLRKLLPYN
                     .  *  :    *..::*  

FASTA FORMAT for MUSCLE Version 3.6

>TBLA0B01230
--------------------------MLRLIGLFAAPSHLPAPL---------------Q
LSLVRGLHKLKLKTHKGTLKRWR--RRVAPGGPAAEQFVRSKAGRNHGNIGWSHRALAAL
SRRVPAHSTHVKALRKLLPY-
>CAGL0L04070g
------------------------------MTLFNNAITACTSRLLSMKTMGVSSF---G
MVFCRTL----MKTHRGALKRWR--Q-------TSTGFKRGIAGRKHGNIGWSHRSLKSL
TGRTDAHPTQMKRLRRLMPYK
>NDAI0F02820
MENHTNHLGSLIYLASNIRYFQGNPKSYNLTPDMFTVSSMSSLFKTGLLSMGLKGQSFNS
LVITRNL----MKTHKGAAKRWR--K-------SAQGFKRGIAGRNHGNVGWSHRYLNKL
TGRKEADPTHVKHLKRMLPYH
>Smik_14.206
----------LETGVDEKER--EQIQIMSMFSIFNPLLKGSNNFKARFHGFLFNNV---S
TVTIRTL----MKTHKGTAKRWR--R-------TGNTFKRGIAGRKHGNIGWSHRSLKAL
TGRKTANSAYLKHLKRLLPYH
>Suva_14.218
----------IKTSANSQR---GDRTNMSLFNLFNPLLKGSNSFKPRLNQLLFNNV---S
TITIRTL----MKTHKGTAKRWR--R-------TGNTFKRGIAGRKHGNIGWSHRSLKVL
TGRKTANSSYLKHLKRLLPYH
>YNL122C
----------MKISLHNKRQRGDQNQNMSVFNVLKPLLKGSNSFKVKLNGFLFNNV---S
TITIRTL----MKTHKGTAKRWR--R-------TGNTFKRGIAGRKHGNIGWSHRSLKAL
TGRKIAHPAYSKHLKRLLPYH
>Skud_14.210
----------------------GVQITMSLFNVLNPLLKGSNSLRPKFNGILFNNV---C
TITIRTL----MKTHKGTAKRWR--R-------TGNTFKRGIAGRKHGNIGWSHRSLKAL
TGRKTAHPAYLKHLKRLLPYH
>ABR133W
----------------------------MFFNMLRPLTGLPVRF-GSGAFAATTQP---S
LIMVRTL----MKTHKGAAKRWR--K-------TAGGYKRSKAGRSHGNTGWGQRALKQL
SGRTMAASAHLKRLRRLLPYH
>Ecym_8202
---------------------------MLIQGLFRPLEKLTSRFGGGVGCGSVGVS---Y
LIFSRSL----MKTHKGAAKRWR--K-------TANSFKRGKAGRSHGNSGWSKNSLKVL
SGRALANGSQLNRLKRLLPYH
>NCAS0G02470
---------------------------MLPFSFLPTFYRARC----------LNLT---T
LTITRNL----MKTHKGTAKRWR--R-------TAQSFKRGIAGRNHGNAGWSRRSLKHL
SGRKDADPSYLRHLKRLMPYK
>KAFR0J02090
---------------------------MLFKPFFSALFTMGSSV------VRRESP---T
LIIARNL----MKTHKGTAKRWR--K-------TANGFKRGIAGRNHGNGGWSRRSLKCL
TGRKTATPSQAKRLKRLLPFG
>KNAG0I02130
---------------------------MSFLSALSPLFKNGFAA------WKIPSA---S
MIVTRSL----MKTHKGAAKRWR--K-------NANGFKRGISGRKHGNCGWSQRGLKAL
TGRTEAHQSQIKRLKKLLPYH
>SAKL0E10978g
----------------------------MLSSLLRPLSNISVKF--GTSLSQIQHP---S
LVLTRNL----MKTHKGAAKRWK--K-------TANSYKRGRAGRNHGNAGWNKSTLKSL
DGKTLAHPTHIKHLKRLLPYH
>KLTH0B05214g
----------------------------MLSNLMRSIMSYGRQI------TQLQQP---F
MMQTRNL----MKTHKGTAKRWR--K-------TSTSYKRGRAGRNHGNAGWGKSTLKSL
DGKTLAHPTHIKHLKRLLPYN
>Kwal_33.14762
----------------------------MLSYLVRSVFSFGKSF------SQIQQP---F
MQQTRNL----MKTHKGTAKRWR--K-------TSTSYKRGRAGRNHGNAGWGKSTLKAL
DGKTLAHSTHIKHLKRLLPYH
>TDEL0B05130
--------------------------MMFFSSIINPIFRTCLNT-----FSKVEAP---S
LILTRSL----MKTHKGAAKRWR--K-------TATSFKRGKAGRSHGNAGWSRRSLKSL
SGKTLAHETHIKHLKRLMPN-
>KLLA0F24068g
----------------------------MLSSIFGSMMNFSART--GLLGSKTNVS---S
LILTRNL----MKTHKGAAKRWR--K-------TANSFKRGKAGRNHGNAGWSRNSLKSL
SGRSLADSTHMHRLKRLLPYH
>ZYRO0G06490g
-------------------------------MFFNSIVGLGSRS-AFASFGGFNSS---S
LVFTRNL----MKTHKGTAKRWK--K-------TADGFKRGKAGRNHGNVGWSRRSLKVL
SGKTPAHESHIQRLRRLLPY-
>Kpol_505.21
-----------------------------MFGINTGLFNSKISI----------------
LQITRSL----MKTHKGTAKRWKFIK-------SLDTFKRGKSGRQHGNVGWSQRSLKHL
SGRTYAHTTHVSRLRKLLPYN
>TPHA0F01880
--------------------------MSMIGSLANSITKINAKN-----INIFNNKNVFH
LDFRRTL----MKTHKGTAKRWKYIS-------KLDTFKRGKSGRQHGNIGWSQRSLKTL
SGRTYADKTHVSKLRKLLPYN