MUSCLE (3.8) multiple sequence alignment

TBLA0A05440        ------------------------------------------------------------
KNAG0F00470        MLALRHTIYQCIPPLANHSPTRFGLASKTSLFFHSLSLCLIFPIFWAPSVKGILPVRKDR
TPHA0B04490        ------------------------------------------------------------
Kpol_2000.66       ------------------------------------------------------------
KAFR0D03950        ------------------------------------------------------------
CAGL0J08206g       ------------------------------------------------------------
Suva_14.71         ------------------------------------------------------------
Skud_14.69         ------------------------------------------------------------
Smik_14.66         ------------------------------------------------------------
YNL271C            ------------------------------------------------------------
NDAI0F04220        ------------------------------------------------------------
NCAS0A00590        ------------------------------------------------------------
ZYRO0F16676g       ------------------------------------------------------------
TDEL0C06190        ------------------------------------------------------------
KLLA0C02321g       ------------------------------------------------------------
AFR669W            ------------------------------------------------------------
Ecym_1086          ------------------------------------------------------------
SAKL0C02618g       ------------------------------------------------------------
KLTH0F02376g       ------------------------------------------------------------
Kwal_33.13392      ------------------------------------------------------------
                                                                               

TBLA0A05440        --------------------MSHRIDPNLQQQQQSDNVSRHSSSSSHINSLTPS------
KNAG0F00470        TLCILTTRTNSNQGKPSWKPVAKRRKAQRENMLRNNNS-NDKAGSSSSASGS--------
TPHA0B04490        -------------------------------MLRGSNS-KSSSSSSSVGKD---------
Kpol_2000.66       -------------------------------MLRSSNS-KDSGSGKP-------------
KAFR0D03950        -------------------------------MLKSSGS-KHSSTNSNG------------
CAGL0J08206g       -------------------------------MLKGSNS-KSSDGSG--------------
Suva_14.71         -------------------------------MLKNSGS-KNSNSKESN------------
Skud_14.69         -------------------------------MLKNSGS-KHSNSNSN-------------
Smik_14.66         -------------------------------MLKNSGS-KHSNSKESH------------
YNL271C            -------------------------------MLKNSGS-KHSNSKESH------------
NDAI0F04220        -------------------------------MLRNSSN-KHNANQEQG-TKNNA------
NCAS0A00590        ------------------------------MMVRNSSS-KSSTSNNNSS-----------
ZYRO0F16676g       -------------------------------MIRSSGS-KNNNNNNHG-SNSNT------
TDEL0C06190        -------------------------------MLKGSHS-KGSQGNG---SDSRD------
KLLA0C02321g       -------------------------------MQRSQSS-RGPTGNENSHSRSLS------
AFR669W            -------------------------------MKKSTHSNKHSKTQHAGQVAGATHANG--
Ecym_1086          -------------------------------MKRSTHSNKSSKGQHSHFSNGHGGTNTPI
SAKL0C02618g       -------------------------------MNRSSNS-GSRRTSHNHSSSN--------
KLTH0F02376g       -------------------------------MNRSSNS-KSSKAPHNRSASS--------
Kwal_33.13392      -------------------------------MHRSTSS-KPAKTPHNRSASN--------
                                                    ..                         

TBLA0A05440        TTSSSSRF-NLKRFTNSHLNHNLN--------------SNTSNDIFSIRSHSP---DRSI
KNAG0F00470        GSGGGGLFSNIKRLAKQSSSASSS-------------------KAALARAQQP---EAPG
TPHA0B04490        NSVGSGLLHNLKKLTNSSSTTSQN------------------NAINKSDISSP---KSQL
Kpol_2000.66       SGSGSSLLQNLKKITNSSSNSSTS--------------------INKADISSP---KKPI
KAFR0D03950        SNNPSSLFQNLKRLTSNNSNNTSK--------------YTESYSINKSSISSPLQKHDTN
CAGL0J08206g       SGSNSGLFQNLRRLTTKDRDNRNK--------------SPKRTSLDNDNISQR---STKN
Suva_14.71         SSSSSGLFQNLKRLANSSASNNNATSPNNAS-EHQHPPVGQETSTSSASSSSF---RRLN
Skud_14.69         STSSSGLLQNLKRLANSNGTSANAASPTNAT-QQQHSPMGQESSTSPSSSSSF---RNLN
Smik_14.66         SNSNSGLFQNLKRLANSNAANNNTGSPTNVSPQQQHSPVEHEAATSPASSSSF---RKLN
YNL271C            SNSSSGIFQNLKRLANSNATNSNTGSPTYAS-QQQHSPVGNEVSTSPASSSSF---RKLN
NDAI0F04220        TTSGSNLFQNLKRFATNSTGSSNN---------------TSPRTSNSSEPSQV---KRES
NCAS0A00590        ASTGSSIFQNLRRLTNPSSNHTNK----------------------SPSGSSP---RTSY
ZYRO0F16676g       SSSGSGLIQGLKRLANPQSSSSAAASPTP----------PSNQRIETGDISSP---KKVS
TDEL0C06190        SNTGSGLLSNLKRFAGSSGSQSGS------------------QRIETSDISSP---RKVS
KLLA0C02321g       NSQGSSLFSNLKKLATGGNHGSSQ-----------------PSQTRKELISSP---KRVF
AFR669W            GHSGGGLFSNLMKLTGSSGS----------------------QRIATSDISSP---KKVT
Ecym_1086          NGGGGGLFSNLMKLTGSSSALSQQ-------------------RIATSDISSP---KKVS
SAKL0C02618g       SSGSGGLFSNLKKLTGSGNNANTS------------------NKIEPSDISSP---KIVS
KLTH0F02376g       SSGNGGIFSNLKRLTTGSGNSSVS---------------HNTQKLDISDISSP---KKIN
Kwal_33.13392      GSGNGGIFSNLKRLTGNANNSSSQ----------------TLQKVDISDISSP---KKIN
                       .. : .: .::                                    .        

TBLA0A05440        SSASQQQQQQQQQQ---QQQQPLNMRNSLTNPNMNQYVTSPYTHEY--------------
KNAG0F00470        VP------------------KPLSKKATMNSQNLSHYTSGVSATSSDGDGGMASP-----
TPHA0B04490        LT-------NKLSM---DDLKPLNKRTSLNNQNLSQYINGKLPKSQSDSSHLGNVKSNHK
Kpol_2000.66       VP-------KQFTS---TELRPLNKKSTLNTQNLSQYVSGTKIDQDNPNPLPTN------
KAFR0D03950        LPPSSSSSPSSNASAITTTNKPLNKKSTLNTQNLSQYMD---------------------
CAGL0J08206g       INVSQAVSSRHGSI---DQSRPLNKKSTLNSQNLSQYVNNGKALS------PES------
Suva_14.71         GP-------SRSTS---TEARPLNKKATLNTQNLSQYMNGKISTDAPT------------
Skud_14.69         GP-------SRTTS---IEARPLNKKSTLNTQNLSQYMSGKMSADVPI------------
Smik_14.66         GP-------SRSIS---TEARPLNKKSTLNTQNLSQYMNGKISADVPV------------
YNL271C            AP-------SRSTS---TEARPLNKKSTLNTQNLSQYMNGKLSGDVPV------------
NDAI0F04220        IP--QGSTSSLHSS---NEIKPLIKNTTLNTQNLSQYINSK------------N------
NCAS0A00590        SPERDSTTTRESHT---NSLKPLNKKTSLNTQNLSQYINDKH------------------
ZYRO0F16676g       VP------SRVTNA---NDLRPLN-------HHYNHHHN---------------------
TDEL0C06190        VP------SRVSNA---NDLRPLNKKSTMNTQNLSHYMNGKSSAESL-------------
KLLA0C02321g       TT---ASLESATPI---GGSKPLNKISSLNTHNLSHYTMD--------------------
AFR669W            LP-------SNLDL---SGAKPLNKLNTINASNLPQVSG---------------------
Ecym_1086          IP-------SSLDL---STAKPLSKHSTLNTSSLSQYAD---------------------
SAKL0C02618g       TP--------AVPE---FSGKPLSKQTTLNTQNLSSYVDMN-------------------
KLTH0F02376g       LP--------DTGE---FSHKPLSKQSTLNMASLSAYTDA--------------------
Kwal_33.13392      LP--------DTGE---FSHKPLSKQSTLNIANLSAYTDV--------------------
                                       .**                                     

TBLA0A05440        -----------NNSHSRNTSINSVNSNPLSTK--YSY-SRRGSNQIL-----SPSPTGNS
KNAG0F00470        -----------EYTHSRTQSGQ-------TSRFSYTSPSRRSSSDA--------------
TPHA0B04490        YEINENIQDGSSPNHNRSASVQ--S----SAK--YSY-SRRSSNSTA-------------
Kpol_2000.66       -----------NTSHTRAHSSQ--S----ATK--YSY-SRRSSTATG-------------
KAFR0D03950        --------------HARSSSTNSAS----ASK--YSS-SRRSSTQVS-------------
CAGL0J08206g       -----------GSNHHRTDSTQ--S----GFK--YSY-SRRSSGQVS------------M
Suva_14.71         -----------SSQHARSHSVQ--------SK--YSY-SKRTSSQAS-------------
Skud_14.69         -----------SSQHARSHSVQ--------SK--YSY-SKRNSSQAS-------------
Smik_14.66         -----------SSQHARSHSMQ--------SK--YSY-SKRNSSQAS-------------
YNL271C            -----------SSQHARSHSMQ--------SK--YSY-SKRNSSQAS-------------
NDAI0F04220        -----------IPDHSRSQSIQ--S----SSK--YSYSSRRASSQTN-------------
NCAS0A00590        -----------SPQHTRSASVQ--S----SSK--YSY-SRRSSSQTL-------------
ZYRO0F16676g       ------------HHHSRTPSQQ-ST----GSK--YTY-PKRTSSSITGGNPSLPSSSATP
TDEL0C06190        -----------SSNHSRSPSVQ--S----STK--YTY-SRRSSSHLS-------------
KLLA0C02321g       -----------PEANSRSQSASLLTS---PTK--YSY-SRRSSQ----------------
AFR669W            -----------EVTQARSASGAALSS---PSK--YSY-SKRSSQWASSKQANHPEHDQQY
Ecym_1086          -----------EIAQSRTPSGP--VSLGSPSK--YSY-SKRSSQWSGGNSN---KQLLLL
SAKL0C02618g       -----------TPHHNRSPSGMSGS----PTK--YSY-SRRSSQWSN-------------
KLTH0F02376g       -----------VGAHNRSASNASVGS---PTK--YSY-SRRASQWSN-------------
Kwal_33.13392      -----------ASTHNRSSSAASNSS---PTK--YSY-SRRASQWSSNG-----------
                                 : *  *           .  *:  ..* *                 

TBLA0A05440        S--------NNNTSNINPQQRYSVHSN---NPNSSSILSQG-SLHNL-MKFMTP-DGKVN
KNAG0F00470        ----------------KLAKYHTAQS------SQNSIASQG-SLSTLYNRFISPEDGKLR
TPHA0B04490        --------------ATRLSRQSTNFSG-----STPSVFSQG-SYANL-SKYMDS-NGRLN
Kpol_2000.66       --------------PIKLSRQQTTQSL-----GSSSVLSQG-SYTNL-LKYIDS-DGKIN
KAFR0D03950        ----------TSESLRRLSRQHTGQS------SSASIHSQNSSYINF-SKFITP-DGKTN
CAGL0J08206g       A--------PSSMGNINLTRHNTNTSF-----SSASVLSHG-SITNL-SRFMTP-DGKIN
Suva_14.71         ---------------NKLTRQHTGQSH-----SATSLLSLG-SLTNL-SKFTTP-DGKIH
Skud_14.69         ---------------NKLTRQHTGQSH-----SASSLLSQG-SLTNL-SKFTTP-DGKIH
Smik_14.66         ---------------NKLTRQHTGQSH-----SVSSLLSQG-SLTNL-SKFTTP-DGKIH
YNL271C            ---------------NKLTRQHTGQSH-----SASSLLSQG-SLTNL-SKFTTP-DGKIY
NDAI0F04220        ----------PSVTGYKLDRQYTNQS------SAVSVLSQG-SYSNL-SKFMTH-DGKLN
NCAS0A00590        -----------GSTLNQIARQHTNQ-------SSASILSQG-SFTNL-SKFIAP-DGKIN
ZYRO0F16676g       I--------PAPVTPGQLSRQQTNHSHANSQSSAASVLSQG-SLTNL-GRFMRP-DGKVR
TDEL0C06190        ----------TPGVNSTLTREPTNQSL-----SSSSVLSQD-SFSNL-AIFMTP-DGKIK
KLLA0C02321g       -----------------LTRSSTNKSI---ISSSAVSVSSN-STSIL-NRFLTN-DGTLK
AFR669W            PQHLNHLFVQPHPHHSALTRQMTNQSN-----YSASSYT---SLSLL-HKATDI-DGTLT
Ecym_1086          P--------QPQHSQHTLSRQPTNQSN-----NSDNSFS---SVTLL-QKITDS-DGNLS
SAKL0C02618g       --------GNNIGNGGRLSRQQTNQSL-----SSASIFSQG-SMTNL-TKFMGA-DGKVK
KLTH0F02376g       N--------NSAVSGSKLSRQQTNQSM-----SSASIFSQG-SFSNL-SKFVGP-DGAVR
Kwal_33.13392      ----------GTAPSTKLSRQQTNQSI-----SSASIFSQG-SFSNL-SKFVGP-DGSIR
                                      .  :               :   *   :        :*   

TBLA0A05440        LEMPNNPAEVEALYEDIMYKRNILQNLPADKQRELMSYDVSKKWLIVKQDLQSELKKMRS
KNAG0F00470        LEMPDDPAEVELLYEDIMYKRNILQNLPTDKQLELMNYDVKKKWLIVKQDLQNERKKLKT
TPHA0B04490        LDMPTDTHEIESLFEELMYKRNILQALSPDKQRDIMNYDTKKKWMIVKQDLQNELKRIKL
Kpol_2000.66       LEMPRDPHEVEALFEDLMYKRNIFQALPQDKQKELMSYDVTKKWTLVKQDLQNEIKKLMS
KAFR0D03950        LEMPRDPKEIENLFEEIMYKRNILQNLSVEKQRELMNYDVRKKWLIVKQDIQNEFKRIRA
CAGL0J08206g       LTMPSDPYEVESLFEDIMYKRNILQSLPQEKQNELMSYSIEKKWLIVKQDLQNEFKRIKA
Suva_14.71         LEMPSDPYEVEVLFEDIMYKRNIFQSLSGDKQEELMSYSTEKKWLIVKQDLQNELKKIRA
Skud_14.69         LEMPSDPYEVEILFEDIMYKRNIFQSLSGDKQEALMGYSTEKKWLIVKQDLQNELKKMRA
Smik_14.66         LEMPSDPYEVEVLFEDIMYKRNIFQSLSGDKQEALMSYSTEKKWLIVKQDLQNELKKLRA
YNL271C            LEMPSDPYEVEVLFEDIMYKRNIFQSLSEDKQEALMGYSIEKKWLIVKQDLQNELKKMRA
NDAI0F04220        LEMPTDPSEIEYLYQEIMIKRNILQSLPGTKQDELMSYDIGKKWLIVKQDLQNEWKKFKS
NCAS0A00590        LEMPRDPNEVEVLFEDIMLKRNILQSLPTDKQNELMSYDLEKKWLIVKQDLQNEMKKMRL
ZYRO0F16676g       LDMPQDYHEVESLFEDIMYKRNIMQTLPPEKQQELRNYDIDKKWLIVRQDLSSDLKKMMA
TDEL0C06190        LDMPSS-HEVENLFEDMMYKRNILQNLSPDKQKELMDYDVDKKWLIVKQDLQNDFKKLLA
KLLA0C02321g       LDRPENPEEINGLFMDLLIKRNVFDSVSSQDQKDMLNYPIEKKWLMVKQDLQSEFKRLKS
AFR669W            LEKPEDPQEIEELYQELLQKRNIPQSVSVHGHRELMSYGIDKKWLMVKQDLQTEYKKMKN
Ecym_1086          LEKPKYPQEIEELYQELLQKRNILNSVSVHSHRELMGYDLDKKWLMVKQDLQAELKRMKN
SAKL0C02618g       LDRPSNPQEIEDLFAELMHKRNFFQSLPAAGQKELMNYDLDKKWLLVKQDLQSELKKLAN
KLTH0F02376g       LERPRDPKEIEELFEEVLYKRNVYQSLPASAQRELNNYDLEKKWLMVRQDLQSEVKKFMN
Kwal_33.13392      LEKPRDPREIEELFEEVLYKRNVYQSLPPSAQKELNNYDLEKKWLMVRQDLQSEVKKFMN
                   *  *    *:: *: ::: ***. : :.   :  : .*   *** :*.**:. : *.:  

TBLA0A05440        KNPLQNSNHNLPINNNNNNTNTNNISSNGQLNNSNILISNNNSGLSTGNQNLLNNNGDHP
KNAG0F00470        -----KTSSHQQTVQSAPFMNLQDTSSSASLPGQGFHDQQSVV-----------------
TPHA0B04490        ------------------KNNNINNSDTTIIPSSMPSSNISER-----------------
Kpol_2000.66       KSSSYHPTEGSYSSASNSNGNLNSYSSSLRSSATSQDSNSPQT-----------------
KAFR0D03950        -------------TKNGPKNSSLVNVEQLVYSPTTTTTNNNNN-----------------
CAGL0J08206g       ----------------SNKGDSRTGMSMPDLGSDPSNSVSPPG-----------------
Suva_14.71         ---NTTSSSAASRTSIASDQHPILTANSTLSSPKSALMTSASS-----------------
Skud_14.69         ---NTTSSSAASRTSVASDHLPILTANSSLSSPKSILMTSASS-----------------
Smik_14.66         ---NTTSSSTASRTSIASDHHPILTANSSLSSPKSVLMTSASS-----------------
YNL271C            ---NTTSSSTASRTSMASDHHPILTANSSLSSPKSVLMTSASS-----------------
NDAI0F04220        --KGAKASHSIGPDNNNNNNNNYNNHLILGSPSKSNNMISPKS-----------------
NCAS0A00590        -------------KTNSTNTNNNNNNNRSSMSPENSSTINLNS-----------------
ZYRO0F16676g       ----------------------KSSSSATQASANTTDLSLTNT-----------------
TDEL0C06190        -------------KGVPAAHAAISSSNSDSLPSSLKVSSPRSS-----------------
KLLA0C02321g       ------------------------------------------------------------
AFR669W            -----------------------------SMPPSSTVESIASS-----------------
Ecym_1086          --------------------------------------NVPQS-----------------
SAKL0C02618g       ------------------------KKNTHVAPAGAAGLAATIS-----------------
KLTH0F02376g       ----------------------SKNASKSSTVVGGSSSAVPDS-----------------
Kwal_33.13392      ---------------------NKSVSKSPAAASTGISLIAPES-----------------
                                                                               

TBLA0A05440        KKSSSPTRLSIIGSNFNSNNNNTIINNSHSYSTNNSNGHSLNTSNMLTPSNSISSRNLNQ
KNAG0F00470        -------------------------SETSSRVPTTNDAASILSSATPSLRH--PSRRKQQ
TPHA0B04490        -------------------------SSVNTMDNNLRTIDTNASNPRIHRKG------QKS
Kpol_2000.66       -------------------------AIFTSNSGTMQNNTINLNNGNIPVGG----KSRPV
KAFR0D03950        -------------------------NNNSNYNNTSPMASVASNEYYPMTSP---------
CAGL0J08206g       -------------------------PISSSGSSIFSSDVTSTAPSTYSRSG-----KKNI
Suva_14.71         -------------------------PTSTVYSNTLNHSTTLSSVGTSTPKG--HNNKKTI
Skud_14.69         -------------------------PTSTVYSNNLNHSTTLSSAGTSTSKS-----KKIV
Smik_14.66         -------------------------PTSTVYSNSLNHSTTLSSVGTSTSKS-----KKLM
YNL271C            -------------------------PTSTVYSNSLNHSTTLSSVGTSTSKG-----KKLV
NDAI0F04220        -------------------------NLNNFESPSSSLSASTQTTTNNYKQY-NNKPSKRS
NCAS0A00590        -------------------------PATMQMSPHHHIGSNSNSSINSHHTP--ITISKRP
ZYRO0F16676g       -------------------------ISSHDYSDATSIRHMKTNASSKSLNS---------
TDEL0C06190        -------------------------MTYESIQQAIKFNKTNNGSSSGPASN---------
KLLA0C02321g       --------------------------TKPRFSANDTQNMLKRKTSTSKLNT---------
AFR669W            -------------------------ALAKSPGGSISSGSITRSISQNSAKP---------
Ecym_1086          -------------------------TVADPLSNSVHLKSPRGSFSSSNMSA---------
SAKL0C02618g       -------------------------AATQGTSGAGGVGGVDGTQAGSKGHN---------
KLTH0F02376g       -------------------------PSASNFTSSTSPNGSFTGLSRPKIST---------
Kwal_33.13392      -------------------------PSTGHFASNSSINESLAGSSRSRAQN---------
                                                                               

TBLA0A05440        QDASPIISKPKTKLKNSNNINNKASALSPDRTNRLPNDYIKEILNDRLSVDEMNDLWVTL
KNAG0F00470        YTLTNKQHTVYPANGTAERHASSSSTLASDKTNRLPIHYVKKIIADQLSQDELNDLWVTL
TPHA0B04490        MSSLSNATTTAPSGVNAEYSKIRSISESSDKTNIAPIHYVRKILSDTLSKNELNDLWVTL
Kpol_2000.66       GSSSTASGTNSMIYQ-SSENNKSVSSIATDRINRPPIHYVKKIIADRLTSEEMNDLWVTL
KAFR0D03950        ---QTKKPTSHELYQ-LTESNASTSTLSSDKTNRPPNRYVEKIIADKLSPDEMRDLWVTL
CAGL0J08206g       PISKPIAATSTELYH-IAERNTSSSTIQSDKANRPPIHYVKKIVDDKLSKDEMKDLWVTL
Suva_14.71         AGGLKKQPSLNSIYRGGPEINTSASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTL
Skud_14.69         TGSLKKQPSLNNIYRGGSENNISASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTL
Smik_14.66         GGSLKKQPSLNNIYRGGSENNTSASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTL
YNL271C            SGSLKKQPSLNNIYRGGAENNTSASTLPGDRTNRPPIHYVQRILADKLTSDEMKDLWVTL
NDAI0F04220        ASNISQPKSTTEVYS-NSHSNSSNTTLT-DKTNRLPIEYVKKIISDTLTSEEMKDLWVTL
NCAS0A00590        TGPISNPIPNADMYK-LSMRNTSSSSMS-DKTNRPPIHYVKRIIADTITSEEMKDLWVTL
ZYRO0F16676g       -----------NLYS-NANANSSNTTVNTEKINRPPTYYVKKIIADDLTIDELNDLWVTL
TDEL0C06190        --------NKSKLQQ-LSDKNSSTSTLTTEKINRPPIHYVKRIIADKLTGNEMNDLWVTL
KLLA0C02321g       ------------QYEGMLHTNESQGSLL-SPSHFPPEYYVRQIISKKIKNKELNDLWVSL
AFR669W            ------------------------MAVAYEPAHLSPDHYVRKIISDRVTAQELNDLWISL
Ecym_1086          --------------RSISQNSAKQLAVSYDPSHLSPDHYVRKIISDRITAYELNDLWVSL
SAKL0C02618g       -STSSPILGGGGFYE-SGNQNSSTATLSQDPLHLSPDYYVRKIISDKISTKQLKDLWVSL
KLTH0F02376g       ----SSVNTSEQFYS-SNLGTSSTTTLSQDPSHLSPDYYVRKIICNDISAKRLNDLWVSL
Kwal_33.13392      ------PGTSDQFYG-SNNGTSSTTTLSQDPSHLSPDYYVRKIICNNISAKRLNDLWVSL
                                            :   .  :  *  *:  *: . :.   :.***::*

TBLA0A05440        RTEQLTWVNTFLEDQGHIAMANSLMKSIYRINTMQNS---LSTYLIDKEYNFFKCFRVLS
KNAG0F00470        RTEQLDWVDAFLDNQGHIAMANVLMKSLYK-TSPNVS---LSGPLLDKEQSYFKCFKVLS
TPHA0B04490        RTEQLDWVDAFLEHQGHIAIANNLIRCIYK-TAPGSN---LSDELIEKEYGFFKCFRVLA
Kpol_2000.66       RTEQLDWVDAFLEHQGHIAMANVLMNTIYK-CAPGSE---LTPELQEKEHSFFKCFRVLS
KAFR0D03950        RTEQLDWVDSFLENQGHIAMANILMKQIYK-TTPKDH---LSSKLLEKENSFFKCFKVLS
CAGL0J08206g       RTEQLDWVDAFLENQGHIAMANILMKSIYK-TTPKDK---VSEPLLDKENAFFKCFRVLA
Suva_14.71         RTEQLDWVDAFIDHQGHIAMANVLMNSIYK-TAPREH---LTKELLEKENSFFKCFRVLS
Skud_14.69         RTEQLDWVDAFIEHQGHIAMANVLMNSMYK-TAPRDN---LTKELLEKENSFFKCFRVLS
Smik_14.66         RTEQLDWVDAFIDHQGHIAMANVLMNSIYK-TAPRDS---LTKELLEKENSFFKCFRVLS
YNL271C            RTEQLDWVDAFIDHQGHIAMANVLMNSIYK-TAPREN---LTKELLEKENSFFKCFRVLS
NDAI0F04220        RTEQLDWVDAFIEHQGHIAMANVLMKSIYK-TTPNEK---LTSQLLEKENSFFKCFRVLS
NCAS0A00590        RTEQIDWVDAFIEHQGHIAMANILMKSLYK-TSSDGT---PNPQLLEKENAFFKCFRVLS
ZYRO0F16676g       RTEQLDWVDAFLEHQGHIAMANVLMKSLYK-TTQEVK---LTEKSLEREASYFKCFRVLV
TDEL0C06190        RTEQLDWVDGFLEHQGHIAMANVLTTSIYK-TDPETP---LSYDLLEKEHAFFRCFRVLS
KLLA0C02321g       RTEPLDWVISFLEAQGQVAIANLIITSMHQ-DTTDNQNAVTDPQFLERETALFKCLRVLL
AFR669W            RTESIDWVIGFIDAQGQVAIANRLLKFVQR-ESLDIL---HDYDALEKENAYYKCLRVLT
Ecym_1086          RTESIDWVIGFIDAQGQVAIANRLIKFAQR-ESLESL---LDSDLLEKETAYYKCLRVLT
SAKL0C02618g       RTEQLDWVVGFLDAQGQVAIANVLLRFFHK-ESPDAL---LNDEALDKEFAFFKCLKTLL
KLTH0F02376g       RTEQLDWVQGFLEAQGQVAIANVILKTCYR-ESPDNL---LGDEVLDKEFAYFKCLKTSL
Kwal_33.13392      RTEQLDWVVGFLEAQGQVAIANVILKTCYR-ESPDNL---LGDEVLDKEFAYFKCLKTSL
                   *** : **  *:: **::*:** :     .                :.*   :.*:..  

TBLA0A05440        MLSQGLTEFI---KHKLMTDTLVQGLFSTRLATRKIATEIFVLMLQKI----NDD-GLNI
KNAG0F00470        MLAQGLREFT---DHRLITDTIARGLFSSRLPTRKMATEIFVCMLETK----NQT-RFDA
TPHA0B04490        MLDQGLYEFT---KHKLMMDTLAFGLFSTRVSTRKMALEILVYIINKK----NTQ-RFES
Kpol_2000.66       MLSQGLYEFA---KHKLMSDTIANGLFSSRLATRKMATEVLVCMIEKR----NNM-RFEV
KAFR0D03950        MLSQGIYEFS---KHKLMTDTIARGLFSTRLGTRKMAIEIFVCMLEKR----NKS-RFEA
CAGL0J08206g       VLSQGLHEFT---IHSLMTDTIAQGLFSGRLATRKMATEIFVFLLEKK----NKK-RFES
Suva_14.71         MLSQGLYEFS---THRLMTDTVAEGLFSTKLVTRKMATEIFVCMLEKK----NKN-RFEA
Skud_14.69         MLSQGLYEFS---THRLMTDTVAEGLFSTKLATKKMATEIFVCMLEKK----NKS-RFEA
Smik_14.66         MLSQGLYEFS---THRLMTDTVAEGLFSTRLATRKMATEIFVCMLEKK----NKS-RFEA
YNL271C            MLSQGLYEFS---THRLMTDTVAEGLFSTKLATRKMATEIFVCMLEKK----NKS-RFEA
NDAI0F04220        MLSQGLREFT---KHELMAQTIARGLFSTTLSTRKMATEIFVCMLNKK----NPE-RFKV
NCAS0A00590        MLSQGLREFT---RHEIMSQTVARGLFSITLSTRRMATEIFVCMLEKK----NPE-RFKV
ZYRO0F16676g       MLAQGLYEFT---KHAIMAETVAYALFSIRLPTRKMATEIFVCMLEKK----NKS-RFDV
TDEL0C06190        VLTQGLYELS---RHNIMAETVANGLFSVRLATRKMATEIFVCMLEKK----NKV-RFEA
KLLA0C02321g       NIRECLEEAV---NSTLVTNALVEGLLSTKIPTRRLATETLIYLVTKDEDFKSRTAGLDC
AFR669W            NLREGMQEAL---KSKLVISSVVEGLLSSRLSTRRVATETLLYMLSDDELKTADT-GQDA
Ecym_1086          NLREGMQAAL---SSKLVISAVVEGLLSIRLTTRRIATETLLYMLTDDELKTADT-DFDA
SAKL0C02618g       NLKEGANEAV---RTKLVVSAITDGLLSLRISTRRIASEMLVFITQWD----IPY-GLNQ
KLTH0F02376g       NLREGADEAVMSNSARIIVSAIVEGLLSLRVATRRVASELLISLSQWS----LPH-GFNH
Kwal_33.13392      NLKEGADEAVLSNSAKIIISAIIEGLLSLRVATRRIASELLVSLSQWA----LPH-GFTH
                    : :            :: .::  .*:*  : *..:* * :: :                

TBLA0A05440        L---LTTFDKTFSINENLNMVYLLKNVPDKYHYLNSTNTTQI---------KVLVSWLYA
KNAG0F00470        V---ITSLDQNFQIGSNAHMVNNLQKMPDYFIHLNLQSTL-----------KVVQAWLFA
TPHA0B04490        V---IMSLDRFFRLSENLNMLKIITQFGGAFSRTSPDTQF-----------KIFQAFVIS
Kpol_2000.66       V---LASLDRYFRQEENLNMVHLSKTLPGEYPQSTPNTKY-----------KIIQAWLIA
KAFR0D03950        I---LNSLDQNFRIGSNFHMFQNLKKLPQYFIHLTPDSHL-----------KVLQAWLFS
CAGL0J08206g       V---LSSLDKNFIIGQNSHMNESYKKLPQYFTHLTSNSNL-----------KVIQAWLFA
Suva_14.71         V---LTALDKKFRIGQNLHMIQNFKKMPQYFSHLTLESHL-----------KIIQAWLFA
Skud_14.69         V---LTALDKKFRIGQNLHMIQNFKKMPQYFSHLTLESHL-----------KIIQAWLFA
Smik_14.66         V---LTALDKKFRIGQNLHMIQNFKKMPQYFSHLTLESHL-----------KIIQAWLFA
YNL271C            V---LTSLDKKFRIGQNLHMIQNFKKMPQYFSHLTLESHL-----------KIIQAWLFA
NDAI0F04220        I---LNVLDQKFKIGQNLHMAHNLKKFGEYFGPLTLDSNL-----------KVTRAWLFA
NCAS0A00590        I---LNALDQKFKIGYNAHMTQNIKMFPDYFTHLTLDSQL-----------KVTQAWLFA
ZYRO0F16676g       I---LTALDKKFMIGENLHMMQFVKNSPQQFIHLKRDSQF-----------KIVQAWLTG
TDEL0C06190        V---LNALDKKFKIGENLHMLHYMKNSPQHFSHFTRDSQF-----------KIVQSWLFA
KLLA0C02321g       FSLVMESLNHETSLVQNIHMKAKFSTNDSTDPESNPQLYQ---------VCKILQQWLYV
AFR669W            IFPLLVALDQESKFAANIHLRGRLHETNKRKSLPTGRADFHV-------VAKRLEQWLYV
Ecym_1086          IFPVLHALDQESKYSSSIHLRGRLHETNKRRSLPTGRADLHV-------IAKKIEQWLYV
SAKL0C02618g       V---IGELDQESHVSSNVHLQARLLSANKRDSLLAQDHEL---DLTRDHASKKFEQWLFV
KLTH0F02376g       V---MDALDQESRFCDNVHLQARLITQSASKDPKKGSSIAPTPDGDGDRVMRKFEQWMLV
Kwal_33.13392      V---MNALDQESRFCDNVHLQARLLSQTSNKEIKNSLRSSLLADNNGDRIMRKFEQWMLV
                   .   :  ::.      . ::                               .    ::  

TBLA0A05440        VESTLDGRGKMGSLVGASQDFKITGGENAILEYCQWTMVLINRLCNASTIINQRVLLRTK
KNAG0F00470        IDQTLDGRGKMGSLVGASDEFKRIDGENSVLEYCQWTLVFVNKFCQSSNNLNQRMLLRTK
TPHA0B04490        LESTLNGRGKMGSKVGASDDFKVSGGENAILEYCLWALIFINKLCNFSDELNQRVVLRTK
Kpol_2000.66       LDETLNGRGKMGSLVGASDDYR-SAGENAILEYCLWTMVFINHLCSNSSLLNQRILLRTK
KAFR0D03950        IENTIDGRGKMGSLVGASTDLKNSGGENAILEYCLWTMVFVNMLCNASTIIQQRMLLRTK
CAGL0J08206g       VEQTLDGRGKMGSLVGASEDYKNAGGENAILEYCQWTMVFINHLCSSSENINQRTLLRRK
Suva_14.71         VEQTLDGRGKMGSLVGASDEFKNGGGENAILEYCQWTMVFINHLCSCSDNVNQRMLLRTK
Skud_14.69         VEQTLDGRGKMGSLVGASDDFKNGGGENAILEYCQWTMVFINHLCSCSDNINQRMLLRTK
Smik_14.66         VEQTLDGRGKMGSLVGASDEFKNGGGENAILEYCQWTMVFINHLCSCSDNINQRMLLRTK
YNL271C            VEQTLDGRGKMGSLVGASDEFKNGGGENAILEYCQWTMVFINHLCSCSDNINQRMLLRTK
NDAI0F04220        VEHSLDGRGKMGSFVGASDDYKNSGGENATLEYCQWSMIFINHLCLCSDNINQRMLLRNK
NCAS0A00590        VEHTLDGRGKMGSLVGASDDFKNSGGENAILEYCQWSMIFINHLCSCSSNINQRMLLRTK
ZYRO0F16676g       LETALQGRGKMGSLVGASEEVRAAGGENSILEYSQWTMVFINHLCMGTDVVNQRVLLRTR
TDEL0C06190        VEQSLEGRGKMGSLVGASEDFKASGGENAILEYSQWTMVFINHFCNGTDVINQRILLRTR
KLLA0C02321g       VEQTLDGRGKMGSLVGASDEYRNNTGENSIYEYLVDSIVLIDQLCLNNEDVKKRHMMRTQ
AFR669W            IEYTLDGRGRMGSLVGASDDYK--GGENTVLEYLLYSMILLNLLCSNHPDVQQRNLLRSR
Ecym_1086          LEYTLDGRGRMGSLVGASEDYKN--GENTVLEYLLYSMILINLLCSSHPDLHQRNLLRSR
SAKL0C02618g       VEYTLDGRGKMGSLVGASEDFKSAGGENAILEYGYLTLLLVNQLCNTPADVNQRTLLRSR
KLTH0F02376g       VEYTLDGRGKMGSLVGASEDFRTSGGENAIMEYAYLTLLLINHLCQTPVDVKQRTVLRAR
Kwal_33.13392      VEYTLDGRGKMGSLVGASEDFRTSGGENAIMEYAYLTLLLVNHLCQTPVDVKQRTILRAR
                   :: :::***.*** **** : .   ***:  **   :::::: :*     :::* ::* .

TBLA0A05440        LENIGSIRIMNKLKKLDYEKITEQLEDYENKKLDDLNTLLEQDTKSS-VDLDNPISLLSH
KNAG0F00470        LENAGFLRIMNKMKLLDYEKIRDQIEFYEAGKLDDFNSLLESQNKHANIDMQNPLSLLQN
TPHA0B04490        FENLGGLRVMTKLKLMDYEKMTVQVENYEDHKLDDFNSLLEMKSSSAQINMQDPTSLIGS
Kpol_2000.66       LENLGALRIMTKLKRLDYEKLTEQIELYDNNKLDDFNTVLETESKNSKVNMQNPNSLIEN
KAFR0D03950        LENSGFLRIMNKIKLLNYEKVIDEIESYENNKLDDFNLMLESKNKNSNVNLQDPVSLLNN
CAGL0J08206g       LENCGILRIMNKIKLLDYEKVIDQIELYENNKLDDFNALLESNKKNINVDLQDPVSLMKN
Suva_14.71         LENCGILRIMNKIKLLDYDKVIDQIELYDNNKLDDFNVKLEASNKAFNVDLKDPLSLLKN
Skud_14.69         LENCGVLRIMNKIKLLDYDKVIDQIDLYDNNKLDDFNVKLEANNEAFNVDLQDPLSLLKN
Smik_14.66         LENCGVLRIMNKIKLLDYDKVMDQIELYDNNKLDDFNVRLEANNKAFNVDLQDPLSLLKN
YNL271C            LENCGILRIMNKIKLLDYDKVIDQIELYDNNKLDDFNVKLEANNKAFNVDLHDPLSLLKN
NDAI0F04220        LEYCGIVRIMNQIKSLHYEKVIEQIDVYENSKLDDINKLLELSNKNANINLHDPTSLVKN
NCAS0A00590        LENCGILRIMNKVKTLDYDKVIEQIDLYENNKLDDLNTLLESNNKNANINLQDPTSMLRN
ZYRO0F16676g       LENAGALRIMNRFKLLDYDKITAQIEYYENGKLDDINNLLESEGRNTQVNMQDPMMMLQT
TDEL0C06190        LENAGGLRIMNQFKLLDYDKVMELVEAYENLKLDDLNSVLETGAHASDIDMNDSASLLKK
KLLA0C02321g       LKSFGLNRILQKMQLLDYPPLSTMLLQFEDAAIDDYNSLIDSQKFTENVDMDDPVSILQK
AFR669W            LKSYGLARIIKKMELLKYPALENEVRKFEDATLDDYNLLMTSTTVDSAVDMKDPAALWQD
Ecym_1086          LKSYGLSRVIKKMELLKYPALENEVSKFEDRTLDDYNSLMASSTVDSSVDMKDPESLWNN
SAKL0C02618g       FKSCGLSRIMQKLELLNYDKIDEQLRIFEDRTADDYNTIMASKSINHNVDMENPLSLLQN
KLTH0F02376g       LKNAGLPRILNKMKLLNYEKVDEQLARFDDSTTDDFDALYSQESTGEGVDMKDPVSMTQN
Kwal_33.13392      LKNAGLPRILNKMKRLNYEKVDEQLAIFEDSTTDDFDTLYSQGPNGELINMQDPVSMTQN
                   ::  *  *:: ..: : *  :   :  ::    ** :           ::: :.  :   

TBLA0A05440        LLEVCKDTEGEQSLTSIIQHLYLSSSKLFDDKDD-PTKLSKQLKLMDSLMTDA--TLSTV
KNAG0F00470        LWDACRGTDSENLLVSLVQHLFLSSTRLIQNNKD-PTQLAKQLKLIDSLVTNVGSSVSAV
TPHA0B04490        LWEVCKGTENEKLLLSLMQHLFLSSSKLVDDKRE-PAKLSKQLKLMDSLMTNI--TASEV
Kpol_2000.66       LWESCKGSDNEKLLLSLIQHLYLSSSKLMGEKED-PTKLSKQLKLIDSLLTNV--NGSMF
KAFR0D03950        LWQSCKGTENEKLLISLIQHLFLSSSRLIEEVDD-PTKLSKQLKLMDSLVTNV--SSSST
CAGL0J08206g       LLDACKGTENEKTLVSLVQHIFLPTSKLLDEKQD-PNKVTKQLKLMDSLVTNV--SVTST
Suva_14.71         LWEICKGTDNEKLLVSLVQHLFLSSSKLIEENQN-PSKLSKQLKLMDSLVTNV--SVAST
Skud_14.69         LWGICKGTENEKLLVSLVQHLFLSSSKLIEENQN-SSKLTKQLKLMDSLVTNV--SIASA
Smik_14.66         LWDICKGTENEKLLVSLVQHLFLSSSKLIEENQN-PSKLTKQLKVMDSLVTSV--SIAST
YNL271C            LWDICKGTENEKLLVSLVQHLFLSSSKLIEENQN-SSKLTKQLKLMDSLVTNV--SVAST
NDAI0F04220        LWDACKGTENEKLLISLVQHLFLSSSQLIEDKQD-ATQLSKQLKLMDSLVTNV--SVAST
NCAS0A00590        LWDACKGTENEKLLISLMQHLFLSSSQFIEEKKD-PVKLSRQLKLLDSLVTNV--SVSST
ZYRO0F16676g       MWDYCKGTENEKTFISLIKHLFLSSSKVADDRGD-PSKLAKQLKLMDSLVANV--SVSAV
TDEL0C06190        LFDYCKGTESEKLLNSLVKHLFLSTSRLMEDNQD-PTKLSKQLRLMDSLVTNV--SVSAV
KLLA0C02321g       LTSSFKGTEAESYLLSMLQNLFLSSNKNAQESDD-PGKNVQQLKLIDSLISNV--AITTL
AFR669W            FWTQHRGTEAEGHLLSLLQHLFLWS-RAFAEYRD-PAESIKQLKLLDALVTNV--TFSSI
Ecym_1086          FWTRHKGTESEAHLLSLMQHLFLWSSKAFSESTD-PAEGSKQLKLLDALVSNV--TFSSI
SAKL0C02618g       LWESYKGTGAEKYLVSLVQHLFIASSKVQDEGDD-PTEASKQLKLIDSLVSNV--TMSSI
KLTH0F02376g       LWNLCKGTDAEQHLTSLLQNLLISTGELGSKNKDDPTQRTKQLKLIDALVSNV--SMASV
Kwal_33.13392      LWDLCKGTEAEEHLMSLLQNLLISTGELGGTSKEDPAQRTKQLKLIDALVSNV--SMASV
                   :    ..:  *  : *::::: : :        : . :  .**.::*:*::.     :  

TBLA0A05440        -DNESKMNMAIQHLYDSMVTDDVARRAILESRNLTKKLEEVQAERDFLSNRLSEAENGLV
KNAG0F00470        ADEETTMSMTIQRLFDSMQTDEVARRAIIESRTLTKKMEELQAEKDRLGDKLSKAEGGLV
TPHA0B04490        -DEQTHMNLAIQRLYDSMQTDDVARRAILETRTLSKKLEEVTAEKEYLKEKLSKAENGLV
Kpol_2000.66       -DEESHMNLAIQRLYDSMQTDEVARRAILESRTLTKKLEEAHAERDYLSNKLSNAENGLV
KAFR0D03950        ADEESTMNMAIQRLYDSMQTDEVARRAILESRTLTKKLEELQAEKDLLHEKLSKAENGLV
CAGL0J08206g       -EEGSNVNMAIQRLYDSMQTDEVARRAILESRTLTKKLEEMEAERDMLVEKLSKAEHGLV
Suva_14.71         ADEESNMNMAIQRLYDAMQTDEVARRAILESRTLTKKLEEIQAERDSLSEKLGKAEHGLV
Skud_14.69         ADEESNLNMAIQRLYDAMQTDEVARRAILESRALTKKLEEIQAERDSLSEKLSKAEHGLV
Smik_14.66         SDEESNMNMAIQRLYDAMQTDEVARRAILESRALTKKLEEIQAERDSLSEKLSKAEHGLV
YNL271C            SDEETNMNMAIQRLYDAMQTDEVARRAILESRALTKKLEEIQAERDSLSEKLSKAEHGLV
NDAI0F04220        -DQESTMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEESQAEIDLLSQKLKNAEHGLV
NCAS0A00590        -DQEASMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEEVQAERDLLSQKLKNAEHGLV
ZYRO0F16676g       -DEESSVNVAIQRLYDAMQTDEVARRAILESRQLTKELEEIQAERDFLRQKLNSTGDGIV
TDEL0C06190        -DESSSINMAIQRLYDSMQTDEVARRAILESRTLTKKLEEAQAERDFLSQKLSKTGNGLV
KLLA0C02321g       -DSESNFNVAIQRLYDSMQTDEIARRAILESRELTKKLEEVKAERDYLNDKISKAENGLV
AFR669W            -DTESGFNGAIQRLYDAMQTDEVARRAILESRELTKKYEEIKAERDNLASKLSQAQNGLV
Ecym_1086          -DTESGFNGAIQRLYDAMQTDEVARRAILESRELTKKCEEMKAERDHLQTKLAQAQDGLV
SAKL0C02618g       -DTESSFNGAIQRLYDSMQTDEVARRAIMEARELTRKFEEVKAERDYLGEKLSKAEGGLV
KLTH0F02376g       -DMQSSFNSAIQRLYDAMQTDEIARRAILENRDWVKRYEEIKADRDNLKEKLSNAEGGLV
Kwal_33.13392      -DLQSSFNSAIQRLYDAMQTDEIARRAILENRDWVKRYEEIKAERNNLKEKLSNAEGGLV
                    :  : .. :**.*:*:* **::***:*:* *   .  **  *: : *  .: .:  *:*

TBLA0A05440        GKLENELAQRDSILAKNQRVTQQLRTELDELKKKHLMEKHDHEVELRKMLTILNSRPETE
KNAG0F00470        GELQRDIRERDAILAKNQRVNKQLENELEELKRKTLMEKHEHEVELRKMLTIINSKASPN
TPHA0B04490        GQLELELEQRDNILTKSQRVTKQLQAELEDLKKKHLLEKHEHEVELRKILTIVNTNTD--
Kpol_2000.66       GQLESDLKQRDNILEKNQRVMKQLESELEDLKKKHLLEKHEHEVELRKMLTILNSR----
KAFR0D03950        GQLENDLNERDQILAKNQRVTQQLQSELEELKKKHLLEKHEHEVELRKMLTILNTRSSTN
CAGL0J08206g       GQLEMEVKERDRILAKNQRVMKQLESELEELKKKHLLEKHEQEVELRKMLTILNSRPA--
Suva_14.71         GQLENELHGRDRILAKNQRVMQQLESELEELKKKHLLEKHQQEVELRKMLTILNSRPE--
Skud_14.69         GQLEDELHERDHILAKNQRVMQQLESELEELKKKHLLEKHQQEVELRKMLTILNSRPE--
Smik_14.66         GQLEDELHGRDRILAKNQRVMQQLEAELEELKKKHLLEKHQQEVELRKMLTILNSRPE--
YNL271C            GQLEDELHERDRILAKNQRVMQQLEAELEELKKKHLLEKHQQEVELRKMLTILNSRPE--
NDAI0F04220        GQLQDELRQRDRMFAKNQRITEQLQAELEDLKKKHLLEKHEQEVELRKMLTILNARSDKG
NCAS0A00590        GQLQDELAQRDRILSKNQRVMEQLQGELEELKKKHLLEKHEQEVELRKMLTILNARPEIV
ZYRO0F16676g       GRLEEELKQRDDILAKNQRVNRHLQAELEELKKKHLLEKHEHEVELRKMLTILNARPDD-
TDEL0C06190        GQLEKEVQQRDDILEKNQRVTLQLQDELEELKKKHLLEKHEHEVELRKMLTILNSRPEGD
KLLA0C02321g       GQLQKELAERDLILDKTQRVTEQLQSELEELKKRHLLEKHEHEIELRKMLTIVNSKTS--
AFR669W            GQLQSEVEQLERILEKSNRVTDQLKGELHALKKKHLLEKHEHEVELRKMLTILNSKPHG-
Ecym_1086          GQLQGEVQQLQRILEKSNRVTDQLKADLHDLKKKHLLEKHEHEVELRKMLTILNSKPNDA
SAKL0C02618g       GQLQNELSQRDRILEKNQRVTEQLQADLEELKKKHLLEKHEHEVELRKLLTILNSRPQGS
KLTH0F02376g       GQLQDEVRQRDHILEKSQRVNAQLQHELDESKKKLILAKHEHEVELRKTLTAMNSNFEG-
Kwal_33.13392      GQLQEELKQRDHILEKSQRVTAQLQHELDESKKKLILAKHQHEVELRKTLTALNSK----
                   * *: ::   : :: *.:*:  :*  :*   *.. :: **::*:**** ** :*:.    

TBLA0A05440        LDNTMSSISRTKRNKHEIEKLELLKRKKVIEKALQDGLQKTKKDLSLDSKR----FGITV
KNAG0F00470        LAQNPSASVLKSHDPKNKESLL-SEQQSKIQKVLQDGLTRTKKDFTNDAKK----FGMTV
TPHA0B04490        --------------ADASLNNS-SDKKHNIQKALETELSRTKKDLNNDVKK----FGISV
Kpol_2000.66       ------NGTQNPDVDDVTITLD-PNKKLDIQKALELELNKTKKDLSNDSKR----FGITV
KAFR0D03950        -----DGAKTIDKDKDNISKLN-LQKHENIQKVLQDGLIRAKNDFTIDAKK----FGMTV
CAGL0J08206g       ---------KTKEQKKKIGSIE-ASEKEDLQRALQSGLQKAKKDFKDDSKK----FGMTI
Suva_14.71         -----ESSDLSKGTKDINPSLN-SSEKANIQKVLQDGLSRAKKDYKDDSKK----FGMTL
Skud_14.69         -----ESSDINEGTRNIDPSLN-FSEKANIQKVLQDGLSRAKKDYKDDSKK----FGMTL
Smik_14.66         -----ENSSINEGIRGKNSSLN-SSEKANIQKVLQDGLSRAKKDYKDDSKK----FGMTL
YNL271C            -----ESFNKNEGTRGMNSSLN-SSEKANIQKVLQDGLSRAKKDYKDDSKK----FGMTL
NDAI0F04220        E----IEKKSSKKHKRIPGSFE-SSKKQNIQKVLQEGLNRTKKDFTMDSKS----FGMTV
NCAS0A00590        E----GNGTSKKTKAKNPSALD-PSKKQSIQQALQDGLSRTKKDYSVDARN----FGMTI
ZYRO0F16676g       -----ENLAKSTKVTKSVNGLD-PDRQTSIQKALQDGLQRTRKDLSVDSKR----FGITV
TDEL0C06190        -----LSRKGSVHSKAQPGILD-PDKKSTIQQALQDGLLKTKKDLSVDSKR----FGITV
KLLA0C02321g       -----DDLESGSTVQNDPKPLN-PERKTAIQNVLQRSLQKTEQDLLNESRR----LGTAV
AFR669W            -----ENGGSPEVNTSTPSPLK-PEKKMAIQKALQDRLRQTEKDLTRDSKR----LNTVP
Ecym_1086          SN---DAVSPDGINNKTPSPLK-PEKKMAIQKALQDRLRQTEKDLTRDSRR----FGTVP
SAKL0C02618g       SAV--QEEEAGTASSSAPGVLH-ADRKLAIQKALQDRLQQTKKDLTKESKRLGTTLGTTL
KLTH0F02376g       -----SHNMRDEKGSENPRPLR-PERKLAIQKALQAKLEKTSKEINVESKR----LGLSL
Kwal_33.13392      -----GGDIQLTEDGGQPKPLK-PERMLAIQRALQIKLEKTSKEITVESSR----LGVSL
                                           .    ::..*:  * .: ::   :       :.   

TBLA0A05440        QPNKRLQALRLQMEDIENEARQLEMTNFTD----PVRTPKKGQEKRDSHNKHPSLKPGIP
KNAG0F00470        QPNKRLQLLRMKVEDIENEARQLEMTNFADIEKN--ATPVILTKGTKKKKSKKKLKTAQP
TPHA0B04490        QPNKRLRMLRLQMEDIEKEARELEMTNFSEHQKLSLESPAVLNKTKKETKKKSKKKSKSS
Kpol_2000.66       QPNKRLKMLRMQMEDIENEARQLEMTNFADHKRTNLKKPVIVKKEKKLRKKKKINTEEFD
KAFR0D03950        QPNKRLKMLRMQMEDIENEARQLEMTNFTEFERKKLEPPVEVTKPKHRHKKHKIEKINQQ
CAGL0J08206g       QPNQRLKVLRMQMESIENEARKLEMTNFAEYEKKGLKPPANVQKKSKPISELNKEQR---
Suva_14.71         QPNKRLKMLRMQMENIENEARQLEMTNFAEFEKERLEPPIEIKKPKIKHKKHKIKKSSVK
Skud_14.69         QPNKRLKMLRMQMENIENEARQLEMTNFAEFEKERLEPPIQIKKPKLKKNKHKDKNFLAR
Smik_14.66         QPNKRLKMLRMQMENIENEARQLEMTNFAEFEKDHLEPPIQIKKPKLKKIKHKDKKLISR
YNL271C            QPNKRLKMLRMQMENIENEARQLEMTNFAEFEKDRLEPPIHIKKPKVKKMKNKDRKPLVK
NDAI0F04220        QPNKRLKALRMQMEDIENEARELEMTNFAEFEKKKLEPAPKIKKLKQKKQNKNEKKEEDD
NCAS0A00590        QPNKRLKLLRMQMEDIENEARELEMTNFTEYEKRKLEAPSKIKKPKKVATKKEIDPS---
ZYRO0F16676g       QPNKRLRMLRMKMEGIEQEARELEMTNFAEHEEKQLEEPVGTGTKKKAG-----------
TDEL0C06190        QPNKRLKMLRLQMEDIEQEARELEMTNFADHNKAVLQAPVKVESSNYVRKENELRAKELK
KLLA0C02321g       GSKSRLKLLRSKMEDIENQARELEMTNFADVK------PKQNQKFKEQVKGQQ-------
AFR669W            APNRRLKMLRSKMDIIEKEARLLEMTNFADFKKE----PEEENEPKLLSPPKIQRSLRGE
Ecym_1086          APNRRLKMLRSKMDDIEKEALMLEMTNFAEFKKE----TKVEDLPRLQSPPKIERNVRSE
SAKL0C02618g       EPNRRLKLLRSRMEDIENEARELEMTNFADIQRQTVEEQTVVPALPPPAVPVLDRAPKAK
KLTH0F02376g       EPNKRLKLLRSRMEDIENQARELEMTNFSDYQKDDIKEPEVSNEDDHKAVSESEEKAQQI
Kwal_33.13392      EPNKRLRLLRSRMEEIENQARELEMTNFSEYREDADKEIEMAHEGTHMYPSDVDVGTTQD
                    .: **. ** .:: **::*  ******::                              

TBLA0A05440        IAKKNKDRSEEMAKKQQKLAELRKALADIQQETNDISRFNVEEHVNELFNAKKIQAMERL
KNAG0F00470        DKKQRANQRNENQK-IEALNKLRMALTAIQSESNDISKFNVEEHVNELFTERKFKALQRL
TPHA0B04490        KSKEENNRKRANAIKKQKLLELRRDLAMIQAETNDVSKFNVDKRVNELFKEKKHEALNRL
Kpol_2000.66       KENEMK---------TKKLMQLRKALAAIQSETNDISKFNVEGRVNEMFQDKKLKALQRL
KAFR0D03950        ESNDQKSR-------INKLNDLREALAEIQTESNNISKFNLEERVNELFNEKKLKALQRL
CAGL0J08206g       ---------------IQKLNELRDKLRRIQMESNDVSKFNVDERVNELFNDKKRTALQRL
Suva_14.71         TQGAD----------MNKLNDLRRALAEIQMESNDISKFNVEERVNELFNEKKSLALKRL
Skud_14.69         AQEAD----------MNKLNDLRRALADIQMESNNISKFNVEERVNELFNEKKSLALKRL
Smik_14.66         PQEVD----------MNKLNDLRRALAEIQMESNDISKFNVEERVNELFNEKKSLALKRL
YNL271C            PQEAD----------VNKLNDLRRALAEIQMESNDISKFNVEERVNELFNEKKSLALKRL
NDAI0F04220        K--------------IKKLNELRQTLANIQNESNDISKFNVEERVNELFNEKRSTALQRL
NCAS0A00590        ---------------INKLNDLRQTLAEIQMESNDISKFNVDERVNELFNQKRITALKRL
ZYRO0F16676g       ---------------VRKLSELRKQLSDIQKETNEVTKFNVEERVKELFNQKRLKALKRL
TDEL0C06190        ---------------ANKLSELRKALADIQKESNGVSKFNVEERVNELFKQKKLSALDRL
KLLA0C02321g       ---------------ATKLAELRKKLAIIQNESNDITKFNIEARVNELFQDKKLAALDRL
AFR669W            Q--------------VKELAALRKRLAIIQQESNEVSKFNVEERVNELFYEKKNKALDRL
Ecym_1086          K--------------VKELAALRQRLAVIQQESNEISKFNVEERVNELFYEKKTKALDRL
SAKL0C02618g       KQVKEDQ--------VRKLRELRQRLASVQKESNDVSKFNVEERINELFNDKKLSALDRL
KLTH0F02376g       S--------------ALKLEELRKKLASLQQESNDISKFNVEGRFHEMFSGQKSLALDRL
Kwal_33.13392      S--------------NLKLEQLRRKLASLQNESNDISKFNVEGRFHEMFSDQKIQALDRL
                                     *  **  *  :* *:* ::.**:: ..:*:*  ..  *:.**

TBLA0A05440        KELETMYQNFGVDFNMEEFLE----KNNTSTKELD-PDSPAYET----------LDPNLF
KNAG0F00470        RDLESKFNGLNTNFNIDDIIA--------STEKALTATDDGYS-----------LDPRRA
TPHA0B04490        QMLEKKYKSFEIDFDPNDFKQ------------AQLDSNASYES----------LDPNFV
Kpol_2000.66       KQLEAKYKDFEIPFDELQDLD-----------DRELDDEQQHST----------LDPTYL
KAFR0D03950        KELETKYKDFGINFEMKDFLE-----NKPNDGTKEGSTEEEYES----------LDPKIY
CAGL0J08206g       KELETKYKGFGIDFKVEDFTH-----------ESTDSSNEGYSS----------LDPKVY
Suva_14.71         KELETKYKGFGIDFNVEEFIE------TPKKFSVDEENDAAYPS----------LDPKAY
Skud_14.69         KELETKYKGFGIDFNVEKIME----SPKKLSVADEREGDARYSS----------LDPKAY
Smik_14.66         KELETKYKGFGIDFNVEEIME----SPKKNSANERKEDGANYSS----------LDPRTY
YNL271C            KELETKYKGFGIDFNVDEIMD----SPKKNTGDVETEEDANYAS----------LDPKTY
NDAI0F04220        KELETKYKDFGINFNIDDISE------KTTGIDNSGDKSTEYSS----------LDPNAY
NCAS0A00590        QDLETKYKDFGIDFNIDELVD----SASKDENGNN-QQSGDYSS----------LDPKAY
ZYRO0F16676g       KELETTYKGFGIDFNANALLE--------SKGGDIHWNDDEIDG----------QDLQGA
TDEL0C06190        NDLENMYKEYGIDLSTHFPIQ----DEPQESAESE-KNAEGPST----------LDPRAY
KLLA0C02321g       KDLENKYNGFHIDFADDPELK-----------ELLTQSSNGGPS----------LDPTIV
AFR669W            RDLENKYKGFGIDFNEDPELMSLRLANGSVDLDGPTIDLESSAP----------LDPAHL
Ecym_1086          RDLEEKYRSFGIDFNMESELL----IETDREGDGDASVGEASNSTAPNSLDSCVLDPARL
SAKL0C02618g       KELETKYKGFGIDFQADPELSAM--LSDAPPENHHAKDGQAHPS----------LDPKHL
KLTH0F02376g       KKLETDYKGFGINFDPDSPLG-------QALAGKSVSSDDKART----------LDPKEA
Kwal_33.13392      KKLENDYSGFGINYDP---------AESPSLKQEQGQDVNKSRT----------LDPKGP
                   . **  :                                                *    

TBLA0A05440        IDKMDELDKFSMKLDQLTSDLN--------------------------NTMSAKQNSLST
KNAG0F00470        DNKLDEIERLTNDLSKLHDSMK--------------------------------------
TPHA0B04490        TKKITDIDRIADELDAF-------------------------------------------
Kpol_2000.66       QKKINELDEISDELYLMNYDSD--------------------------------------
KAFR0D03950        EKKLDDIDRLTEQLLNLQKTQE--------------------------------------
CAGL0J08206g       QDKLDEITKISEELLQQKNELE--------------------------------------
Suva_14.71         QSKLDEINRITDELLDLQTQVK--------------------------------------
Skud_14.69         QKKLDEINRITDELLDLQTQTK--------------------------------------
Smik_14.66         QNKLDEINRITDQLLDLQAQTK--------------------------------------
YNL271C            QKKLDEINRITDQLLDIQTQTE--------------------------------------
NDAI0F04220        QIKLDELNRITEQLLDAQAKLN---------------------------EKNLKDSSNKS
NCAS0A00590        QRKLDELNRLTDELLRVKNKVN-----------------------------------ASD
ZYRO0F16676g       QEKMDEMDRIANELTAMKMKVE--------------------------------------
TDEL0C06190        QAKLDEIDRISKELIEMKSELK--------------------------------------
KLLA0C02321g       QRKVEEMNSIIDELNALKEEMK--------------------------------------
AFR669W            DAKIEEMTKILDRLNKLKKDID------MSSVGTSTSNESASISTEELAGNNSSHSEISC
Ecym_1086          DAKIEEMTKILEELNRLKCQVDPTTANSGADISTSISTDDFNIDNTSLPSTVVEGSPSSY
SAKL0C02618g       SRKIEEMSKIVDELTAFKKEIE--------------------------------------
KLTH0F02376g       LNIVEEVSNILSGLDSSKAAEK--------------------------------------
Kwal_33.13392      NNSVDE------------SQLE--------------------------------------
                      : :                                                      

TBLA0A05440        TNSNQISTPSSTSSSDFESDEENENTALSNNVNDNSS---------------TFSHQSTT
KNAG0F00470        --EQEQATLQSDNSSESSDSESVESDNEGSTVQSDVS--------------------EPT
TPHA0B04490        ----SGDGTSSYSSSSLSDSEKNYYESNAVPTIGPQK---------------------GL
Kpol_2000.66       ----ANNGNTSDSSSSSEADGDGTDSMRSVSNAPSKG----------------------I
KAFR0D03950        ----LREESSSSYSSSESDEENDDDEIFVASSSSKPA----------------------G
CAGL0J08206g       ---TTQTSSSESNSDSESSSDSDDSMEDALTNNKDIN---------------GTSSNVSD
Suva_14.71         QETEEDEDEETKSSSSSSDADDDEIYQDASPSQERRG---------------EYSELSAG
Skud_14.69         QETKEEENGKSSFSSSSSDADDDEVYQDASPTHEIRS---------------ENSELSAG
Smik_14.66         ----QDDGGVSSLSSSSSSAEGEDVYQDAFPAQEVRS---------------ENSELSVE
YNL271C            HEIQVEEDGESDLSSSSSDDESEEIYQDASPTQELRS---------------EHSELSSG
NDAI0F04220        TFSESSSSSSSSSSSSSSSSSSDEEEIDDIKSRDRQS---------------EISAQSTS
NCAS0A00590        NNLSSRRPSASSSSESASSSSDSDDGESLIERQDTQS-----------------NFSGTS
ZYRO0F16676g       ----IQNQQQHTDSSSTESSSEDDDGATGSRT-DTAS---------------EFSQKSFG
TDEL0C06190        ----NDKALRRHESPSKQDTDDDEIQDTGSMVNEDLQ----------------------S
KLLA0C02321g       ----NRPKTGSSSSSSSSLSSASSSSEDGSSQSQASH------------------GSDIV
AFR669W            TSPHSLSKPSISSTTGGSDAETAADAADDISDNDDET-----------SSSMIVTGAEAI
Ecym_1086          FKKASLSTFASSSFSTDAEDELSAETAEDSNKNNEDSVVGEHGVSPSGSVAMERSDSILT
SAKL0C02618g       --------NGPPSSSSSSSDEELEQDDRASIHSGNAS-----------------------
KLTH0F02376g       ----SNETPLRTATSSDSSEDEMDDKNGDKIAADSTL-----------------------
Kwal_33.13392      ----TDRANASIDSSPASESLEEEDVHLTKSTTEEIG-----------------------
                                                                               

TBLA0A05440        SGGSSFLESLSQKYGTGQ-------NAS-GPMSSNTPNV----------------SHYNP
KNAG0F00470        VGSGSFLASLSQKYETGQ----------------KQPNS----------------PVTVN
TPHA0B04490        IDGSSFLESLSEKYGTAQ-------NTEGTSLSPLSPQN--------R-------IASLG
Kpol_2000.66       SEAGSFLESLSQKYGTGQ-------NAISSPTSITSPNE--------R-------IASQG
KAFR0D03950        SGTRSFLETLSEKYGTGQ-------KNVAMTATPNSR------------------IVTQS
CAGL0J08206g       LASGSFLDTLTQKYGTGQ-------AEPIQSPVGHYSNR--------------------N
Suva_14.71         SGPGSFLDALSQKYGTGQ-------NVTASAGLRDNRGS-------GH-------MPSNV
Skud_14.69         SGPGSFLDALSQKYGTGQ-------NVT---ASAGLRDSGYVSGLGHT-------PSKV-
Smik_14.66         SGSGSFLDALSQKYGTGQ-------NNTVSVGLRDSDYV----SVIGH-------MPSKV
YNL271C            SGPGSFLDALSQKYGTGQ-------NVTASAAFGENNNG----SGIGP-------LHSKV
NDAI0F04220        SAAGSFLEALSQKYAMGQ-------NNP----SSPQRDR----------------PVKAS
NCAS0A00590        AGPGSFLEALTQKYATGQ-------------KSASPRDQ----------------STRMK
ZYRO0F16676g       SGAGSFLEALSQKYGAGQ-------NTT--ISNSPFPGV-------DR-------KSSNH
TDEL0C06190        SGTSSFLESLSQKYGTGK-------NATNMLTNDILNSS------E---------RKGHS
KLLA0C02321g       SNGSSFLESLSQKYSTGQ--------QTATSTNGGRVGR----ETRYP-------GSGYH
AFR669W            ISNASFLETLSQKYGTGS-----QSGAASVSSSEHMRGV----VNVKRRTSQNSINSGNH
Ecym_1086          TSNTSFLESLSQKYGTGTNLQPAEDGAKRLSSSSAFRAG----DSSQR-------NSGYH
SAKL0C02618g       --TGSFLETLSQKYGTGQ-------NAGPTASSRAMVGR----ESNYP-------GRGYH
KLTH0F02376g       -PTSSFLESLSQKYGGAQ-------NS--LSNRHSFAGG----EINYP-------GSGYH
Kwal_33.13392      ---GSFLERLSQKYGKGQ-------AN--LSNRNSVVGR----ENSYP-------GSGYH
                       ***  *::**  .                                           

TBLA0A05440        ERKFMSRMKKQHATP--------NYIRELNQKVS---VTHSLSEEETDYEDAAANTKCPS
KNAG0F00470        QKAFMTRLKRSSGAP--------LYLQELSKKIP---QRPAFDESVDKVTLRKSTGDSNA
TPHA0B04490        EKSFMNRFKRKPSSM--------QFLEELSQKVG----------GEALGKDNNETSDINN
Kpol_2000.66       EKSFMNRLKRQTMAA--------PFLEELTQKVN---DTSSIDDNISDLDDVEVDENDND
KAFR0D03950        EKQFLDRMRRSSTAA--------PFLQELTEKVA---PALSVNEEQEEGEENNREDKIVT
CAGL0J08206g       EKSFVDRMKRNSRVP--------SYVEELSKKMR---GNKDHEFEEDDHKNGNQSSDDFD
Suva_14.71         EKSFINRLRKSTASSA-------PYLEELTQKVN---KVEPFKQNKDEDLVKDLSTENDI
Skud_14.69         EKTFMNRLKRSTVNSA-------PYLEELTQKVN---KVEPCEQNEHVNIPRELSPKKSL
Smik_14.66         EKTFMNKLRKSTASSA-------PYLEELTQKVN---KVESYEQDEDEVRSKESSSKNAP
YNL271C            EKTFMNRLRKSTVSSA-------PYLEELTQKVN---KVEPYEQNEDEGLDKKSLPENST
NDAI0F04220        QYDFINRVRKNNITP--------QFLEELSGKVV-----PPSSGLSTTTKVVDVTSGGKS
NCAS0A00590        DNIFINRIKQTNVAP--------PFLDELTDKVA---EAPPVEASLAEPDNNNTINESSK
ZYRO0F16676g       RTSFANRMKKSNAT---------PYFDELTRKVA---KAPSLNDPSSPGSNEPGDDDTLP
TDEL0C06190        RQSFMERMKKPSGVP--------AYLEELPLKVP---KAPPLGVAETEDSSDNIAEDVEK
KLLA0C02321g       RKSFLNRLKNTTVNPTATSEHLPPFLTELKSKVK----MTDDIDDVPVGIGISVSPGASL
AFR669W            RKSFVNRMKRTITPTSS------NFLEELTQKVS-----PARSQSARSSRGSATTPQSIK
Ecym_1086          RKSFVNRMKKNSTPKSS------SFVDEVSQKMT-----PVHVAQSPDSLQNTATSSSTP
SAKL0C02618g       RRSFMERVKKSDAA---------PFLSELTQKVA---PKTPIDGAYEIEVGARSEEEHIG
KLTH0F02376g       RKSFMNRVKRTGAV---------PYLGELSGKIGSSSYIKPSEAEENVGIGIMVDEKPLS
Kwal_33.13392      RKSFMNRVKKSDNV---------PYLEELSGKFG--TATHENESEENFGIGIRVNNEQLT
                      *  ....              :. *:  *.                           

TBLA0A05440        RKARKSSKISNENPTDE------------------DDEEEEEYTDTEDMKNEK-------
KNAG0F00470        NSDGTTAKS--------------------------LDKDGDDNTEQSTPEGAESIISSNG
TPHA0B04490        ISSEEDNS---------------------------SNSESELNNEPEVEAIDA-------
Kpol_2000.66       DDVED------------------------------TDIADILLKDRSKDGLKS-------
KAFR0D03950        GSSKVPSE---------------------------VVKTTLENADKNAGKIDS-------
CAGL0J08206g       SESKTN-----------------------------MDQDQLLATSAVSPTTSA-------
Suva_14.71         ADGTFVSDKVGGDVQKHIKNKVRKRLDD-------KEEEEEGVTTDTSHVSDS-----DS
Skud_14.69         TSSTSDEIEKYDQEHV-------------------ENKIQGSTTSTSTGGQPN----SVL
Smik_14.66         RNAVPVIDKVKESFRGHVESREEGRLD--------TKEEEIVKNDEETITTNLSAVCGSD
YNL271C            ASAASAFDKAEKDMRQHVENGKQGRVV--------NHEEDKTADFSAVSKLNN------T
NDAI0F04220        ETATENVLENTTEPVTEH-----------------SFRNAVLSNDKIDREENDTVISTTE
NCAS0A00590        EETGEANLTSSDNE---------------------VVAQASLSNPEVSPKHDNNSVKDVN
ZYRO0F16676g       ATSPTVPQSINDTV---------------------SKDKNSTSSPEAPPTLDP-------
TDEL0C06190        ESAEHD-----------------------------EQEENSGKPDVASQKVPQ-------
KLLA0C02321g       KSTEKPVSQFTEKPIL-------------------TDAQQGSDKISNVILNDKYSPTTMQ
AFR669W            SDAADIFTAGQDKTAVVSGNSANGSDATEP-----SEIFDESRNEPLKEGTPSAPIIGTS
Ecym_1086          QSAKSEDAVGIGIFSKGTNTGMA------------VDTANDGQTPWIENGEDS-----IS
SAKL0C02618g       IGIPSKRNGTVVEGMK-------------------DADNSGVSNAEVAPGESF----AAS
KLTH0F02376g       RRVQEDAAGVSQLESNEEKPALSHDLDKNTTHSKPITIGENLAAAKTAGKQQAHEDEGTT
Kwal_33.13392      SLPSKDKENHGHTILQSQDPTRQYKAT--------TEESSHGHPKAKDVQQDSASLLTTT
                                                                               

TBLA0A05440        ---TKKVTATKSKESTPVKTSPAAPPMPEFLSG---DTVSTEPESEKTST----------
KNAG0F00470        ETSTPEGSADVAGSVPAPPPPPPPPPMPSLL---------TENKSNSSS-----------
TPHA0B04490        ----DLTVSESKGAGAPPPPPPPPPEFPASL----------LPNATGGST----------
Kpol_2000.66       ---SDEQDDSEAVQAPPPPPPPPPPPLPEML---------GATKNAPGAV----------
KAFR0D03950        VSSADADIVKDKSTGALPTPPPPPPPLPVQIFATNNDVGTNSDVLDNTSV----------
CAGL0J08206g       -------------------PPPPPPPMPAGLFGANNDNNTGDSDAISVSG----------
Suva_14.71         EVEAENPSTTSSTLHPPPPPPPPPPPIPLRLFGTVNQSPDKEKETEDDTAGE--------
Skud_14.69         EAENSLTSSSVLPPPPPPPPPPPPPPVPIELFG---KSLVREKEIEDNAAKQNTTAGEAV
Smik_14.66         NVANAKSITTVSSTLPPPPPPPPPPPVPVELFG---NSLEKEEESKDDSVKQDT------
YNL271C            DGAEDLSTQSSVLSSQPPPPPPPPPPVPAKLFG---ESLEKEKKSEDDTVKQETTGDS--
NDAI0F04220        PTEKIGFNAEEKSAVAAPPPAPPLPAIL--------EGRSEEEDRSTANTNISKTSVS--
NCAS0A00590        ESDDKAEVSAKDTSADSQPPPPPPPPLPDFF--------TNEQKNSSSET----------
ZYRO0F16676g       -----------GSVHSDERAPPPPPPLPSMLFG------EKAPQHGTGA-----------
TDEL0C06190        ------------ESGKAGTPHPVPPPMPDML--------KKGPETST-------------
KLLA0C02321g       SEIGDSESIEANPTTTIVSAASPPPP----------------------------------
AFR669W            AIGTDAKDVQAAPPPPPPPPPPPPPPIPPMF-----ANTTSSTEQVTASIQVGGAAPPPP
Ecym_1086          PMSPSKRNSKSKNVSKGVSKAPLPPPLPPMF-----VNNNNNNNNNNNNNNDNNNNNREG
SAKL0C02618g       AAAPASAAAPATAAAPATAAAPAAPPMPSML--------KKDPSAEPSATG---------
KLTH0F02376g       EGSSTDKDSHEIASATSAPPPPPPPPMDLFAKNGAPVKTDNPDPAVSDTKS---------
Kwal_33.13392      ENISDDEDEGEIIESVSAAGAVQSSSKPRLAKANVHDSKDSASDDLSPSDEHQDTVSPT-
                                           .                                   

TBLA0A05440        -AAPPPPPPPPPPPPIPPI------------LL---TSGGPPPPPLPAMLQ--SEST---
KNAG0F00470        -------PAPPPPPP--------------------------PPPMTEGIVS--RSSS---
TPHA0B04490        ----IPVPPPPPPPP--------------------------PPPALPASLS--PNVT---
Kpol_2000.66       -------PPPPPPPPPDLFG-----------------GAPPPPPLPPVLGA--GGKN---
KAFR0D03950        ---ALPPPPPPPPLPSALFESGSAPLS----RG---TSPTPTPPPPP-------------
CAGL0J08206g       ---TPAPPPPPPPPPFLK------------------DSSPIPPPPMPTMLT--PSES---
Suva_14.71         -AAAAPPPPPPXXXXMGLFG-----------QN---NGGTPPPPPLPFVLS---------
Skud_14.69         PPPPPPPPPPPPPPPMALFG-----------KP---TGGTPPPPPLPSVLS---------
Smik_14.66         -GNGAAPPPPPPPPPMALFG-----------KN---MGGTPPPPPLPSVLR---------
YNL271C            -PAPPPPPPPPPPPPMALFG-----------KP---KGETPPPPPLPSVLS---------
NDAI0F04220        -PVPPPPPPPPPPPPLGLFGFNSNIPKLADTEP---LKQSASSPALSSPAP---------
NCAS0A00590        -----SIPLPSPPLPEKLFENAGAHPL----KH---LRQSASSPALNSALP---------
ZYRO0F16676g       ----PAPPPPPPPPPLPIFNQASV-------KG---STAIPPPPLPPALGG--SN-----
TDEL0C06190        -----APPPPPPPPPPPMFAQARN-------SG---PIPPPPPPPPPSLTP--STSE---
KLLA0C02321g       -----PPPPPPPPLPVSLGG----------------TLTAVPSPLPTALSP--GI-----
AFR669W            PPPPPPPPPPPPPLPSSLTG----------------KRTVDTSVGTEDMTE--NTESS--
Ecym_1086          ISLSTAPLPPAPALPANLFGNTSLPPTPTVQDDDHENESIPLAPPQPPVFRNISAETKPG
SAKL0C02618g       -ATAAPPPPPPPPL--DLFAKNGLAAVS---PT---SAPPPPPPPPPAFLS--KGPPANG
KLTH0F02376g       -AAAPPPPPPPPPIP-PMLASSSSGSTSKAGAP---PPPPPPPPPPPALLS--QSSN---
Kwal_33.13392      -VSPVPPPPPPPPIP-PLFAKASPPISSSKQAGLAPPPPPPPPPPPPALLS--KTQASSS
                            *.                               .                 

TBLA0A05440        ---TPPNPNSPMPPP------------PPPPLM-SEKSMYRTDS-APDFSTSPNFFEKYP
KNAG0F00470        ---SGAIP----PPP------------PPP----QATSAKNSPIPSPLFSQS-SIFEKYP
TPHA0B04490        ---EGSSI----PPP------------PPPQFM-GLNKMYRSGDGSQILNESPSLYSKYP
Kpol_2000.66       ---SGGTP----PPP------------PPPPMM-GKKEPYKSVVDQPSLLQLTN-SDRLP
KAFR0D03950        ---PPPPP----PPPFSAETSANSTSSVPPPAL-PLMGG-KSVSSSPLLPQSPSLFERYP
CAGL0J08206g       ---TTSLS----SIP------------PAPPMM-TKDSK-KKVVSSPLLPQSPSLFENYP
Suva_14.71         ---STGPG----AIP------------PAPPMM-PASQM-KSAVTSPLLPQSPSLFEKYP
Skud_14.69         ---SSATG----AIP------------PAPPMM-PASQM-KSAVTSPLLPQSPSLFEKYP
Smik_14.66         ---SSAAG----AIP------------PAPPMM-PASQV-KSAVTSPLLPQSPSLFEKYP
YNL271C            ---SSTDG----VIP------------PAPPMM-PASQI-KSAVTSPLLPQSPSLFEKYP
NDAI0F04220        ---PPPPP----PPP------------PAPPML-PTNGP-KKVLSSPLLPQSPSLFENYP
NCAS0A00590        ---PPPPP----PPP------------PP---L-PTDGPRKKVIASPLLPQSASLFENYP
ZYRO0F16676g       ---SPTPS----PTP------------PPPPLFAGQKKMYRSDM-SNYLEETPTFRDNYP
TDEL0C06190        ---AAKLS----PPP------------PPPPLL-GQKMAYRTAVPSPLLPQSPSLFSSYP
KLLA0C02321g       ---APPPP----PPP------------PPPPPF-PSANTPKATVTSPLLPQSPSLFERYP
AFR669W            ---SGTFP----PPP------------PPLPQL-GRSKTY-GGSPSPLLPQSPSLFERYP
Ecym_1086          AAPGGPPP----PPP------------PPPPQL-GRTKKYKGSSPSPLLPQSPSLFEKYP
SAKL0C02618g       TTPLAPPP----PPP------------PPPPLG-GPKAMYRAATPSPLLPQSPSLFERYP
KLTH0F02376g       ---NGPPP----PPP------------PPPPFG-ASVSRNKSATPSPMLPQSPSLFDRYP
Kwal_33.13392      ---SGPPP----PPP------------PPPPFG-SSLPRSRTTTPSPMLPQSPSLFERYP
                                 *             .                   :    .  .  *

TBLA0A05440        RSQKKLKQLHWEKLDDTDNSIWVNGKAEEFADDLFEKGVLKRLESAFAAREIKSLASKKK
KNAG0F00470        RPQKKLKQLHWEKLDSTNNSIWSASKAEKFADDLYEKGVLSNLEKAFAAREVKSLSSKKG
TPHA0B04490        RPQKKLKQLHWDKLDDSEGSIWSSAMAEQFADDLYEKGVLHNLEKAFAAREIKSLANKKK
Kpol_2000.66       RPQKKLKQLHWDKLDSTDSSIWSKGMAERFADDLYEKGVLRNLEKAFAAREIKSIGTRKK
KAFR0D03950        RSQKKMKQLHWEKIETTDNSIWTTGKAERFADDLFEKGVFSNLEKAFAAREVKSLASKRK
CAGL0J08206g       RPQKKLKQLHWEKVESTDNSIWGSQKAEKFADDLYEKGVLSELEKAFAAREIKSLATRKK
Suva_14.71         RPHKKLKQLHWEKIDSTDNSIWGSGKAEKFADDLYEKGVLADLEKAFAAREIKSLATKRK
Skud_14.69         RPHKKLKQLHWEKLDSTDNSIWGSGKAEKFADDLYEKGVLADLEKAFAAREIKSLATKRK
Smik_14.66         RPHKKLKQLHWEKLDSTDNSIWGTGKAEKFADDLYEKGVLADLEKAFAAREIKSLATKRK
YNL271C            RPHKKLKQLHWEKLDCTDNSIWGTGKAEKFADDLYEKGVLADLEKAFAAREIKSLASKRK
NDAI0F04220        RPHKKLKQLHWEKVEATDNSIWRANKAEQFADDLYEKGVLSELENAFAAREIKSLASKQK
NCAS0A00590        RPQKKLKQLHWEKLDATDNSIWKTNKAEKFADDLYEKGVLTDLEKAFAAREIKSLASKKK
ZYRO0F16676g       QPHKKLKQLHWEKLDATEDSIWSSGVAEKFAGDLYEKGVLAGLEKAFAAREIKNLATKKK
TDEL0C06190        RARKKLKQLHWEKLDATDNSIWSSGKAEKFAGDLYEKGVLEDLEKAFAAREIKSLATKKR
KLLA0C02321g       RPKKKLKQLHWEKIDNAGDSIWKNAQAEKVADDLFERGVLSQLEKAFAARETKSLKGKSK
AFR669W            RPKKKLKQLHWEKIDDPDNSIWENARAEKFADDLYEKGVLSELEKAFAAREIKSFKGRKK
Ecym_1086          RPKKRLKQLHWEKIDDLDNSIWENARAEKFADDLYERGVLTELEKAFAAREIKSLISRKK
SAKL0C02618g       RPKKKLKQLHWEKIEDTGNSIWKDAKAEKYADDLYERGVLAQLEKAFAAREIKLLANRRK
KLTH0F02376g       RPSKKLKQLHWEKIDDAEDSIWRDAKAEKFADDLYEKGVLSRLEKAFAAREIKSLASRKK
Kwal_33.13392      RPTKKLKQLHWEKIDDAEDSIWKNAKAEQFADDLYEKGILSRLEKAFAAREIKSLTSRKK
                   .. *.:*****:*::   .***    **  *.**:*.*::  **.****** * :  .  

TBLA0A05440        EDSTKITYLSRDISQQFGINLHMFSNLTVDQLIEKIIRCDRSILNTPSVIDFLSKQEIVE
KNAG0F00470        DD-SKITFLTRDVSQQFGINLHMFGNLSVEELVTKILKCDREVLNSPSVIEFLSKQEVVE
TPHA0B04490        EDLDKISFLSRDISQQFGINLHMFGSLTVDELVIKILKCNRDVMNTPSVIEFLSKPEITD
Kpol_2000.66       EDLSKISFLSHDISQQFGINLHMYGSLAVPELIEKVLKCDRNLINTPSVIEFLAKSEIVE
KAFR0D03950        DDLDKITFLSRDISQQFGINLHMYSSLSVEDLVTKILKCDRDFLHTPSVIEFLSKPEITE
CAGL0J08206g       EDLQKISFLSHDISQQFGINLHMYSNLTVNQFVEKVLKCERDFMNTPSVIEFLSKQEIVE
Suva_14.71         EDLQKVTFLSRDISQQFGINLHMYSSLSVADLVKKILKCDRDFLQTPSVVEFLSKPEITE
Skud_14.69         EDLQKITFLSRDISQQFGINLHMYSSLSVPDLVKKVLNCDRDFLQTPSVVEFLSKTEIIE
Smik_14.66         EDLKKITFLSRDISQQFGINLHMYSSLSVTDLVKKILNCDRDFLQTPSVVEFLSKPEIIE
YNL271C            EDLQKITFLSRDISQQFGINLHMYSSLSVADLVKKILNCDRDFLQTPSVVEFLSKSEIIE
NDAI0F04220        KDLQKITFLSHDVSQQFGINLHMYASLDVPDLITKILKCDRDFLQTPSVIEFLSRPEIVD
NCAS0A00590        EDLDKISFLSRDISQQFGINLHMYANLPVDDVVKKILKCDRDFLHTPSVIEFLSKPEIVE
ZYRO0F16676g       EDLKKITFLSHDFSQQFGINLHMYSHMSVNDLVIKILKCDRDFMQTPSVIEFLSKSEITE
TDEL0C06190        EDLDKITFLSRDVSQQFGINLHMYSQLSVEELVTKILKCERDFMDTPSVLEFLSKPEIIE
KLLA0C02321g       EANEKITFLSRDVSQQFGINLHMFSNLDVKDVVGKVMKCDREFLSTPSVIEFLSKPTIIE
AFR669W            DENNKITFLSRDISQQFGINLHMYSSLPVSAVVSKILKCDKDFLSTQSAIEFLSKPEIVE
Ecym_1086          DE-NKVTFLSRDISQQFGINLHMYSSLTVDQIVTKILKCDKDFLNTQSAIEFLSKHEIVE
SAKL0C02618g       EDLNKVTFLSRDVSQQFGINLHMYAALSVKEVVHKILRCDKDFLGSASVIDFLLKPEIVE
KLTH0F02376g       KDSDKLSFLSRDVSQQFGINLHMYSSLSVEEVVSKILRCDRDFLSTPSVIDFLSKQEIVE
Kwal_33.13392      KDSDKLTFLSRDVSQQFGINLHMYSSLSVEEVVTKILKCDKDFLTTPSVIEFLSKQEIVE
                   .   *:::*:.*.**********:. : *  .: *::.*:...: : *.::** .  : :

TBLA0A05440        VSVNLARSYAPYSTDWEGVKDVKDAKPPEKDPNELQRADQI-YLQLMVNLQSYWGSRMIA
KNAG0F00470        VSVNLARNYSPYSTDWEGVKRIEDAKAPEKDPNELQRADQL-YMSLMVNLQPYWSSRMRA
TPHA0B04490        VSINLARNYAPYITDWEGVKHVEDAKAPEKSVDGLQRADQI-YVQLMVNLQSYWPSRMRA
Kpol_2000.66       VSVNLARNYAPYTTDWEGVKSLKMQKFQRR--IQMTYRELIKFIYNMVNLQSYWASRMRA
KAFR0D03950        VSVNLARNYSPYTTDWEGLKSIEDAKPPEKDPNDLQRADQI-YLQLMVNLQPYWASRMRA
CAGL0J08206g       VSTNLARNYAPYSTDWEGIKKIEDAKAPEKDPNELQRADQI-YLQLMVNLQSYWASRMRA
Suva_14.71         VSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQRADQI-YLQLMVNLEQYWGSRMRA
Skud_14.69         VSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQRADQV-YLQLMINLESYWGSRMRA
Smik_14.66         VSVNLARNYAPYSTDWEGVKNLKDAKPPEKDPNDLQRADQI-YLQLMVNLESYWGSRMRA
YNL271C            VSVNLARNYAPYSTDWEGVRNLEDAKPPEKDPNDLQRADQI-YLQLMVNLESYWGSRMRA
NDAI0F04220        VSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPNELQRADQI-YLQLMVNLQSYWGSRMRA
NCAS0A00590        VSVNLARNYAPYSTDWEGVKSVEDAKAPEKDPNELQRADQL-YLQLIINLQSYWGSRMRA
ZYRO0F16676g       VSVNLARNFSPYSTDWDGIKSLEDAKPPEKDPNDLQRADQI-YLQLIFNLQAYWGSRMRA
TDEL0C06190        VSTNLARNYSPYSTDWDGVSKVEDAKSPEKDPAELQRADQL-YLQLIYNLQPYWGSRMRA
KLLA0C02321g       VTNNLARYFNPYSTDWEGVTSVDDAKPPEKDPNELQRADQL-YVEFMINLQPYWGSRMRA
AFR669W            VSTNMARSFAPYTTDWEGVSSVEDAKSPEKDPSELQRSDQL-FLNLIVNLQSYWSSRMRG
Ecym_1086          VSINMARCFAPYTTDWEGVSSVEEAKQPEKDPNELQRADQL-YLDLIVNLQSYWNSRMRA
SAKL0C02618g       VSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQRADQL-YLEMMVNLQGYWASRMRA
KLTH0F02376g       VSNNLARNFAPYTIDWEGVSSVENAKPPEKDPTELQRADRL-YLELFVNLQTYWSSRMRA
Kwal_33.13392      VSNNLARNFAPYTTDWEGITNVKDAKPPEKDPSELQRADRL-YLELFVNLQGYWSSRMRA
                   *: *:** : **  :*:*:  :.  *   .    :   : : ::  : **: ** *** .

TBLA0A05440        LKVVTSYEKDFDELIRKLRRVDLAVGSIQKSENLKNVFNVILAVGNFMNDASKQAQGFKL
KNAG0F00470        LKVITTYEREYAELLEKLRKVDKAVGSLQQSENLKNVLNVILAVGNYMNDTSKQAQGFKL
TPHA0B04490        IKVITSYEKEYTELVTKLRRIDSAVSAIQKSDNLTNLFNVILAVGNYMNDSSKQAQGFKL
Kpol_2000.66       LKVITSYEREYNELVTKLRKVDKAVGAVQRSENLKNVFNVILAVGNYMNDTSKQAQGFKL
KAFR0D03950        LKIITTYEKEYNELLLKLRKVDKAVGSLQESENLRNVFNVILAVGNYMNDTSKQAQGFKL
CAGL0J08206g       IRMITSYEREYNELLAKLHRVDKAVGSLQGSDNLKNIFNVILAVGNFMNDSAKQAKGFKL
Suva_14.71         LTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVFNVILAVGNFMNDTSKQAQGFKL
Skud_14.69         LTVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNVFNVILAVGNFMNDTSKQAQGFKL
Smik_14.66         LIVVTSYEKEYNELLTKLRKVDKAVGALQESDNLRNVFNVILAVGNFMNDTSKQAQGFKL
YNL271C            LTVVTSYEREYNELLAKLRKVDKAVSALQESDNLRNVFNVILAVGNFMNDTSKQAQGFKL
NDAI0F04220        LKVITTFEKEYNELLTKLRKVDRAVSSLQESENLKNVFGVILAVGNYMNDTSKQAQGFKL
NCAS0A00590        LTVITTFDKEYNELLTKLRKVDKAVSSLQESENLKNVFNVILAVGNYMNDTSKQAQGFKL
ZYRO0F16676g       IKVITSYDKEYLELVTKLRKVDKAVGAILKSENLSNIFNVILAVGNFMNDTAKRAQGFKL
TDEL0C06190        LRVITSYEREYSELVTKLRKVDKAVAVIQKSTNLRNVFNVILAVGNYMNDSAKQAQGFKL
KLLA0C02321g       ITMITTYEKDYSDLVTKLRKIDRAVQCIEQSESLRHVFDVILAVGNYMNDSSKQAQGFKL
AFR669W            LKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDTSKQAQGFKL
Ecym_1086          LKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDSSKQAQGFKL
SAKL0C02618g       LKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRSVFEVILAVGNYMNDSSKQAHGFKL
KLTH0F02376g       LKVITTYEKDYSDLVHKLSMIDKATCSIQQSENLRNVLDVILAVGNFMNDSSKQAQGFRL
Kwal_33.13392      LKVITSYEKEYSDLIHKLRMIDKATCAIQQSENLRNVLDVILAVGNFMNDSSKQAQGFRL
                   : ::*:::.:: :*: **  :* *.  :  * .*  :: *******:***::*.*:**.*

TBLA0A05440        ATLQRLTFIKDSTNNMTFLNYVESIIRQNYPEFNDFLNELQPVLDVVKVSIEQLVRDCKE
KNAG0F00470        ATLQRLTFIKDTTNSMTFLNYVEKIVRKNYPTFNDFLNELQPVLDVVKISIDQLVSDCQE
TPHA0B04490        NTLQRLTFIKDSTNSMTFLNYVEKIIRENYPEFNGFIEELEPVLDVVKISVEQLVNDCNE
Kpol_2000.66       STLQRLTFIKDATNSMTFLNYVEKIVRDNYPSFNDFIDDLEPVLDVVKLSVEQLISDCNE
KAFR0D03950        STLQRLTFIKDSTNSMTFLNYVEKIIRMNYPSFNSFLQELEPVLEVVKISIEQLANDCKE
CAGL0J08206g       STLQRLTFIKDADNSMTFLNYVEKIVRSNYPEFNNFLIELEPVLEVVKVSIEQLVNDCND
Suva_14.71         STLQRLTFIKDTNNSMTFLNYVEKIIRLNYPSFNDFLKELEPVLDVVKVSIEQLVNDCKD
Skud_14.69         STLQRLTFIKDTTNSMTFLNYVEKIIRLNYPNFNDFLKELEPVLDVVKVSIEQLVNDCKD
Smik_14.66         STLQRLTFIKDTNNSMTFLNYVEKIIRLNYPSFNDFLKELEPVLDVVKVSIEQLVNDCRD
YNL271C            STLQRLTFIKDTTNSMTFLNYVEKIVRLNYPSFNDFLSELEPVLDVVKVSIEQLVNDCKD
NDAI0F04220        ATLQRLTFIKDSTNTMTFLNYVEKIVRTNYPAFNKFLVELEPVLDVVKISIEQLVDDCKE
NCAS0A00590        ATLQRLTFIKDSTNSMTFLNYVEKIVRSNYPSFNDFLTELEPVLDVVKISIEQLVSDCKE
ZYRO0F16676g       STLQRLTFIKDTNNSMTFLNYVEKIIRGNYPSFNDFLKELEPVLNVTKISIDQLVNDCNE
TDEL0C06190        STLQRLTFIKDANNSMTFLNYVEKIVRDNYPSFNDFLEDLQPVLDVVKISIEQLISDCKE
KLLA0C02321g       STLQRLTFIKDEKNSMTFLNYVEKIIRENYPEYSHFVEELEPIFSVTKISIEQLVTDCKE
AFR669W            STLQRLTFIKDEKNSMTFLNYVERIVSQNYPSFNSFLQELEPVLQVVKISIEQLANDCNE
Ecym_1086          STLQRLTFIKDEKNSMTFLNYVEKIVRTNYPGFDVFLQELEPVLQVVKISIEQLANDCGE
SAKL0C02618g       ATLQRLTFIKDEKNSMTFLNYVEKIIRENYAEFNSFLQELEPVLDVVKISVEQLAADCRE
KLTH0F02376g       ATLQRLTFIKDDKNSMTFLNYVEKIIRETYPEFNDFLKELEPVVAAVKISIEQVAQDCRE
Kwal_33.13392      ATLQRLTFIKDDKNSMTFLNYVEKIVRETYPEFNVFLKELEPVVAAVKISIEQVSQDCKE
                    **********  *.******** *:  .*. :. *: :*:*:. ..*:*::*:  ** :

TBLA0A05440        FSQGIINVGRSVEIGKLSDSSKFHPQDKVLIKVLPVLPEATKKADLLSDEVKLSIMEFEN
KNAG0F00470        FSGSVVNVERSIEIGNLSDSSKFHPSDRVLVKVLPVLPEARKKADLLTDEVKLTMLEFNN
TPHA0B04490        FTQSIMNVERSLEIGNLSDSSKFHPLDKVITKVLPVLPEATKKSDLLTDEVKLTFMEFEA
Kpol_2000.66       FSQSIVNVERSLEIGNLSDSSKFHPSDKVLTKVLPVLPEAAKKSSLLTDEVKLTIMEFEA
KAFR0D03950        FFQSVTNVERSIEIGNLSDSSKFHPLDRVLAKVLPTLPDVRKKGDLLNDEVNLTLMEFDG
CAGL0J08206g       FVQGINNVERSIEIGNLSDSSKFHPLDKVLLKVLPNLSEARKKGELLADEMKLTIMEFEQ
Suva_14.71         FSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLEDEVKLTIMEFES
Skud_14.69         FSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLKDEVKLTIMEFES
Smik_14.66         FSQSIVNVERSVEIGNLSDSSKFHPLDKILIKTLPVLPEARKKGDLLEDEVKLTIMEFES
YNL271C            FSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARKKGDLLEDEVKLTIMEFES
NDAI0F04220        FSQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVLPSLPDARKKGELLGDEVKLTIMEFLR
NCAS0A00590        FSQSIVNVERSVEFGNLSDSSKFHPQDRVLAKVLPILPDARKKGELLGDEVKLTIMEFLR
ZYRO0F16676g       YCQAVTNVERSIEIGNLSDSSKFHPLDRVLIKVLPVLPEARKKCDLLDDEVRLSIMEFEN
TDEL0C06190        FSQSITNVERSIDIGNLNDSSKFHPLDKVLVKVLPVLPEASKRVELLDEEVKLSIMEFES
KLLA0C02321g       FSQSVINVERSIEIGNLSDPSKFHPLDRVLNKVVPVLPEARKKADLLSDEIKLSLLEFEN
AFR669W            FCSTVTNVERSLEIGNLSDSSKFHPDDRVLAKVLPILPEARKKANLLADEVQLSLMEFEN
Ecym_1086          FCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKVLPVLPEARKRANLLADEVQLSLMEFES
SAKL0C02618g       FSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPVLPEARKRSDLLSDEVKLTLMEFDG
KLTH0F02376g       FSQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTLPEARKKGDLLMDEMKLTLLEFDN
Kwal_33.13392      FSQSVINVERSVDIGNLSDSSKFHPLDRTLLKVLPVLPEARKKGDLLMDEMKLTLLEFDN
                   :   : ** **::.*:*.*.:**** *. : *.:* *.:. .. .** :*:.*:::**  

TBLA0A05440        LMQVFGEDSKDKFAKNSFFKKFADFINEYKRAQEQNLKVEEEERIYENHKKRIEEQQKRL
KNAG0F00470        LMQTYGEDSADKFAKNSFFKKFADFIQEYKKAQVQNVAAEEEEQQYERHKKIVEEQQRQG
TPHA0B04490        LMQKFGEDSGDKFAQNSFFKKFADFINEYKKARAQNLKAEEEVRKYERHKQMVEEQQRKA
Kpol_2000.66       LMKKYGEDAGDKFAKNSFFKKFADFITEYKKAQSQNLKQEEEERAYEKHKRMIEEQQHKQ
KAFR0D03950        LMQVYGEDTSDKFARNSFFKKFADFINEYRKAQEQNIKVEEEEEAYERHKRMVEEQQRKA
CAGL0J08206g       IMQTYGEDYGDKFAKISFFQKFADFIAEYKKAQAQNIKVEEEEAAYERHKKMVEEQQRKA
Suva_14.71         LMQTYGEDSGDKFAKISFFKKFADFVNEYKRAQSQNLAAEEEERLYEKHKKMVEEQQKRA
Skud_14.69         LMQTYGEDSGDKFAKISFFKKFADFINEYKKAQAQNLAGEEEERLYEKHKKLVEEQQKKA
Smik_14.66         LMHTYGEDSGDKFAKISFFKKFADFINEYKKAQSQNLAAEEEERIYEKHKKIVEEQQKRA
YNL271C            LMHTYGEDSGDKFAKISFFKKFADFINEYKKAQAQNLAAEEEERLYIKHKKIVEEQQKRA
NDAI0F04220        LMQIYGEDSGDKFAKNSFFKKFADFITEYKKAQTQNLRLEEEEKVYERHKKMVEEQQRKA
NCAS0A00590        LMQIYGEDSEDKFAKNSFFKKFADFITEYKKAQNQNIKAEEEEQVYERHKKMVEDQQKKL
ZYRO0F16676g       LMQKYGEDTGDKFAKNSFFKKFADFVQEYKKAQNQNLKVEEEERVYERHKKMVEEQQRRE
TDEL0C06190        LMQRYGEDSADKFAKNSFFKKFADFINEYKRAQAQNLKAEEEERLYQTHKKMVEEQQKRA
KLLA0C02321g       LMKKFGEDANDKFSKNSFFQKFADFITEFKKAKTHNVKLEEEERAYERRKKMIEDQQRKQ
AFR669W            LMRMFGEDADDKFAKNSFFKKFADFILEYKRAQEFNRKIDEEERAYERRKLMIQEQQRRA
Ecym_1086          LMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQEFNKKMEEEERAYERRKIMIEEQQKRA
SAKL0C02618g       LMQMFGEDASDKFAKNSFFKKFADFIQEYKKAQAHNIKMEEEERAYERRKKMVEEQHKRA
KLTH0F02376g       LMRLFGEDAMDKFARNSFFKKFADFLLEYKKAQVYNLKLEEEERAYERRKKLVEDQLKRT
Kwal_33.13392      LMKMFGEDAMDKFSRNSFFKKFADFLQEYKKAQTYNMKLEEEEKAYERRKKMVEEQQRRA
                   :*. :***  ***:. ***:*****: *:..*.  *   :**   *  .*  :::* .. 

TBLA0A05440        EDSKKKSHSDDTSNT---DGTEEEEDED---RRDVMDKLLEQLKNVGPV-KTDPTSARKR
KNAG0F00470        EEARKRLESASPDATN--GEDTTAVDDETKDRRAIMDKLLEQLKNAGTV-KADPSSARKR
TPHA0B04490        KEQEKNYMETGVS-----DSESAEAKGD---NRGHMDKLLAQLKNAGPA-RSDPSSARKR
Kpol_2000.66       DLEEERSREV--------EGEPGEEQSD---RRAMMDKLLEKLKNAGPG-KADPSSARKR
KAFR0D03950        ERKEAKNQNNIDE-----NEDDDQERTD---RRGTMDKLLEQLKNVGPS-RADPSSARKR
CAGL0J08206g       QEDASKLNENSSQTG---NSDEEEESED---RRAVMDKLLEQLKNAGQV-KTDPTSARKR
Suva_14.71         QDKEKHREHSALP-----EGNEEEETED---RRAVMDKLLEQLKNAGPA-KSDPSSARKR
Skud_14.69         QEKEKQKERSASPSP---EGNEEDEAED---RRDVMDKLLEQLKNAGPA-KTDPSSARKR
Smik_14.66         QEREKQKENSNSSSS---EGNEEDEAED---RRAVMDKLLEQLKNAGPG-KSDPSSARKR
YNL271C            QEKEKQKENSNSPSS---EGNEEDEAED---RRAVMDKLLEQLKNAGPA-KSDPSSARKR
NDAI0F04220        QEAEISRVNSGTDGT---KDDEDGPGDG----RAIMDTLLEQLKNVTPTNKTDPSSARKR
NCAS0A00590        QEQENGSNGS--------ENGEEGSGDDSGDRRAMMDKLLDQLKNAGPS-KTDPSSARKR
ZYRO0F16676g       QTPSKNRDYVV-------NEDEDIADDDDQDRRAMMDKLLDQLKNAGPT-TSDPSSARKR
TDEL0C06190        E-EKERSENAT-------EEDASEENED---RRAMMDKLLEQLKNAGPV-KADPLSARKR
KLLA0C02321g       QEADSKATAKN-------LSTSQEPSDD----RDDIEKLLDKLKNAAPS-KGDPSSTRKR
AFR669W            KLVQEGDETTCAR-----LSAISASGDD----RDVMDKLLEKLKNAGPS-KGDPSSARKR
Ecym_1086          RKNIQIDTSFSRRGSSLSTSSISASGDD----RDVMDRLLEKLKNAGPS-KADPSSARKR
SAKL0C02618g       RLEAEKGGVDDGSEA---EGVTAVSRGE----RDVMDKLLEKLKNAGPG-KSDPSSARKR
KLTH0F02376g       RESESKNKGTTDAGG---DSVRNEVNED----RDVMDRLLEKLKNAGPA-KSDPSSARKR
Kwal_33.13392      RESNEQENSVDGN-----ADDNTAASGD----RDVMDRLLEKLKNAGPG-KSDPSSARKR
                                                   *  :: ** :***.      ** *:***

TBLA0A05440        AMVRKKLQNEKETASQILKEFETGED----------------SIVYSPTD--SKITPKKV
KNAG0F00470        ALARRKLLGDKDAASALLHDIDTDDD----------------SLVYSPDT-----KRQSV
TPHA0B04490        AVMRKKLLSEKDSTSVILDDLNAGDG----------------SIIYSPTTDKVVDTSLGE
Kpol_2000.66       ALVRKKLLTDKEVTAHILQDIDTGDD----------------SIVYSPNT----PTQEGP
KAFR0D03950        ALARKKMLTDKEGTVNMMHDLETESD----------------SIIYSPDN-----KAIGS
CAGL0J08206g       ALLRKKIHSSEESESSPLAEMQVGGD----------------SLIYSPDA-----KEQIE
Suva_14.71         ALVRKKYISDKDNSAQVLNDLNDEEG----------------SILYSPEA----TTPDTD
Skud_14.69         ALVRKKYLSDKDSAPQLLNDLDNEEG----------------SILYSPEA----TTPDTY
Smik_14.66         ALVRKRYLSDKDNSQQLLNDLDNEEG----------------SILYSPEA----LDPDAD
YNL271C            ALVRKKYLSEKDNAPQLLNDLDTEEG----------------SILYSPEA----MDPTAD
NDAI0F04220        ALVRKKLMGE--STSNILKDIDTEDD----------------SIIYSPDA-----KKPMA
NCAS0A00590        ALVRKKLMTE---STALLKDIETEDD----------------SIIYSPEG-----KNPFV
ZYRO0F16676g       ALMRRKLQADKDAAAHLISDLDSNED----------------SIVYSPNA-----SQDQS
TDEL0C06190        AMIRKKMLNDSEAVSDVLDSIQQEDD----------------SMIYSPEK----------
KLLA0C02321g       ALARKKLLDGK-SGASIFDNITADST----------------IEAFVEQN----------
AFR669W            ALARKKLMGGRE-GSIILEGLDVDD-----------------LQSAAPDV-----QPDTP
Ecym_1086          ALARKKLMDGKKSGSIILDGLDVEELANIQSDGLDDQSDSNPAILGSPTS-----TVGAT
SAKL0C02618g       ALARKKLLDGKRSSANILDNFEVDEAAPVNQ-----------SLVYSPET-----TLKAA
KLTH0F02376g       AVARKRLLQGSSSNSTILDNFDIEDSDGK-------------SLVYSPDN----NSSEVQ
Kwal_33.13392      AIARRKLLQGSSSNSTILDNFEIEKPEGK-------------SLVYSPEQ-------VTL
                   *: *..           :  :                                       

TBLA0A05440        SNEYLQSPTPGEKSSLADMTSTPNPT-------------TITTTTDGKVTNDSSNDDLDQ
KNAG0F00470        GHLIGGSPTPGDKLLGSTPTK------------------ELSSPTAG---------QDDE
TPHA0B04490        DEMILKSPTPKSKDNLETDNNSDKSRNDTLTVDDVEQNTDTNAETDITDDGNSNGDGEDE
Kpol_2000.66       NDIHLASPTPSGKSDLVL---------------------ASVSPTKESTADGI---AEDE
KAFR0D03950        TPFGANGASSHKQNS------------------------NELSPSKGFRDD-----LSEE
CAGL0J08206g       LEIHMASPTPKTKEDGKLGTGE-----------------NSNGESPLKKI------NEDE
Suva_14.71         TVIHAESPTPLATRGFMNTPE------------------DLPSPSKASAL------EDQE
Skud_14.69         TAVHAESPTPLATRGLMNTPE------------------DLPSPSKAPAL------EDQE
Smik_14.66         AVIHAESPTPLTTRGTLNIPE------------------DLPSPSKASTL------EDQE
YNL271C            TVIHAESPTPLATRGVMNTSE------------------DLPSPSKTSAL------EDQE
NDAI0F04220        TTVDMANTTLESELDVSSPTR------------------HNSSPIKNEISMNVD--EEEE
NCAS0A00590        NPVDLDTPHDESEMDVSSSPIQ-----------------RSLSPSRNSTLLS----DDQD
ZYRO0F16676g       ANAEEASPTVHKGSNKNNKPVLS----------------DLESPIKASRNADRNNENEEE
TDEL0C06190        -QEGITNPTGD----------------------------SSQSPSKGAANNQ----QDEE
KLLA0C02321g       -RTLTESPTAKK---------------------------SASLPETESLS------SSKQ
AFR669W            LRAASASPPP-------------------------------------------------D
Ecym_1086          ADVEGLNPDHDLPSAPISAEKG-----------------SVSSALSHSSESPSKKILDED
SAKL0C02618g       NAAHAESPTPKASRQGSVAGSG-----------------ATATPLLESPSKQAS--AGPE
KLTH0F02376g       LNEADTSPTPERRVR------------------------DSNATSPASHD------TGSS
Kwal_33.13392      SNSVDHSPTPDVRKR------------------------EGQSTASEVQT------SESS
                          .                                                   .

TBLA0A05440        EIVDRAKSLLFELRGS-QTPTRKNSVLEERKEKLRARRRNT----SDL----TSNKLKFV
KNAG0F00470        DVTDRAKALLMELRGGQSSPMKKNAFLDEQRERIRSRRRRNELAGTEP--LRGGNKLSFF
TPHA0B04490        VITDRAKALLMELRGS-QTPSKKNSHLDDQREKLRSRRNRRRQTFGEESNSTPSNRLTFV
Kpol_2000.66       FISDRAKALLLELRGS--ENMKRNSQLEEQKEKLKARRSRR----RTQTESISSNKLFFT
KAFR0D03950        EISERAKTLLMGLRGT-ASPSKRNSMLDEHKEKLRARRRRT----NND-LPSGSNKLKFY
CAGL0J08206g       EIGDRAKTLLMELRGS-DALMDRNTALDEHKERLRARRKRTD---SNK--IPSSNRLKFV
Suva_14.71         EITDRARMLLKELRGS-DAPVKQNSILDEHLEKLRARKERA----NGE--TNTGNKLSFK
Skud_14.69         EISDRARMLLKELRGS-EISVKQNSTLDEHLEKLRARKERA----SSE--TNTGNKLSFN
Smik_14.66         EISDRAKMLLKELRGS-DTPVKQNSILDEHLEKLRARKERT----IGE--GSAGNKLSFK
YNL271C            EISDRARMLLKELRGS-DTPVKQNSILDEHLEKLRARKERS----IGE--ASTGNRLSFK
NDAI0F04220        EIGNRAQALLIQLTGS-HSPTKRHSLLNEHKERLRARRRRT----TNE---FVSGKLQFV
NCAS0A00590        EVTDRAKALLMELRGS-NTPSKRNSLLDEHKEKLRARRRKT----NSD--LHSGTRLQFV
ZYRO0F16676g       EISDKAKNLLMELSGN-GAPTRREELLNGHKERLRARRRRT----QGHGELISSNKLAFL
TDEL0C06190        EITDRAKALLMGLRGG-ESPSKRNNVLNGHKEKLRARRRKT----NTD--MSPEGSFLFN
KLLA0C02321g       DPADRARNLLLELRGP-DERKDASPSPIKAKDKLRDLKKKD----SSVKVDQP-NKLQFV
AFR669W            PAADRARHLLLELRNG-EHPESRKSMLDEHK-----------------------------
Ecym_1086          AVTHRARNLLQELRSSDDHTEDRKSLLDEHKEKVRQRRNKKLIEESGGNNTSNEVMEAVR
SAKL0C02618g       DVADRARNLLKELRGP--ESEKRKPLLEDHREKMRARRRRV----NEG--ASSENKLVFV
KLTH0F02376g       DLTDRARNLLIELRGP-ESPGVKMSAQHQRLSKLRARRKND----SSS--SGSENRLNFV
Kwal_33.13392      DLTDRARNLLIELRGP-ESPSRRASSKDQRISKLRARRKND----GSG-NSGSDNHLNFV
                       .*. **  * .                                             

TBLA0A05440        SSDKTVDGEPDSPDLLTQESNPNDKIEEENPSIDISTESNMILSSFDNNLQTIDSDTLVS
KNAG0F00470        EAETETSETA----------------------------------------------HDAD
TPHA0B04490        SDENSPTATEF---------------------------------------------VDAD
Kpol_2000.66       DEESHSTSPSESKGTEYEM-------------------------------------TTAN
KAFR0D03950        DTNEKDISNEPTEKSEQDE-------------------------------------YRTE
CAGL0J08206g       DEKS----------------------------------------------------PDEE
Suva_14.71         ------------------------------------------------------------
Skud_14.69         ------------------------------------------------------------
Smik_14.66         ------------------------------------------------------------
YNL271C            ------------------------------------------------------------
NDAI0F04220        GEDETIVNTNENMNNNETDSENTPTETTIIPP------------------------GSAD
NCAS0A00590        GETVPEKEVEPIT-------------------------------------------GEPD
ZYRO0F16676g       DDETPPVTPTDSEFNRDALSSSHSSHRETPDSGGRSATVTPNRHFEEQQQQYHHQQHQSD
TDEL0C06190        EEVRGTISSADTDYSNE---------------------------------------QQSN
KLLA0C02321g       GS------------------------------------------------------LEVG
AFR669W            ------------------------------------------------------------
Ecym_1086          STENHESTPNFKSVSPNNDI------------------------------------PITT
SAKL0C02618g       GGASEAPTDSHKGLPNDTTADIPATPVSADDEPGS---------------------GRAG
KLTH0F02376g       GAGQAENSD-----------------------------------------------EQNE
Kwal_33.13392      GQEGAALPDSDQN-------------------------------------------HRVE
                                                                               

TBLA0A05440        QGTGKLGPNDEEYEHKIQKSIDSIEIFDDTEAAHPENTSTNAATTTISDSDEDQFHEL--
KNAG0F00470        NDTTKGQTADASDNLDSNDQLENPSIIEDADK----------------------------
TPHA0B04490        EDTLQENVPNTDTSSTLSKDDSEDTESQ--------------------------------
Kpol_2000.66       EEPEEILNARITEEGPHEEAPNQEEPNQEESIPSKDESL---------------------
KAFR0D03950        QSSQIVDEQTSDAKVDSTDEHVIENGIKEENIDDDN------------------------
CAGL0J08206g       QEEVSSSSISTTGIVTAQESPVQIDENED-------------------------------
Suva_14.71         ------------------------------------------------------------
Skud_14.69         ------------------------------------------------------------
Smik_14.66         ------------------------------------------------------------
YNL271C            ------------------------------------------------------------
NDAI0F04220        TETTSLEQPATTTDVSLNKDDVKGVDDHNSNDNDE-------------------------
NCAS0A00590        GTSTELEETSNLSSENQQKVDVESIEDEKADEPHTADST---------------------
ZYRO0F16676g       GSLNNLKFETRTQDASYTSPPIYEDTMRDDARDDSRDDSASFKDVLESVAPEDAGSTEEE
TDEL0C06190        SEANTLTKSIRSTLTEENDDPE--------------------------------------
KLLA0C02321g       PHPKPLSPTQDLMDTSNSSEDEFIDA----------------------------------
AFR669W            ------------------------------------------------------------
Ecym_1086          PSAIHTLRTGSTPSTDETSEDDLNDKYVDADT----------------------------
SAKL0C02618g       DHDQALNAQEKGGSARDSDGDSDGSEFVDA------------------------------
KLTH0F02376g       PEVLKSKPESANDDDNGEQSDSSDGEFLDA------------------------------
Kwal_33.13392      EEEESILAESSRAEETGTDKPNYNDPDYSDSSDAEFLDA---------------------
                                                                               

TBLA0A05440        -----
KNAG0F00470        -----
TPHA0B04490        -----
Kpol_2000.66       -----
KAFR0D03950        -----
CAGL0J08206g       -----
Suva_14.71         -----
Skud_14.69         -----
Smik_14.66         -----
YNL271C            -----
NDAI0F04220        -----
NCAS0A00590        -----
ZYRO0F16676g       AREQR
TDEL0C06190        -----
KLLA0C02321g       -----
AFR669W            -----
Ecym_1086          -----
SAKL0C02618g       -----
KLTH0F02376g       -----
Kwal_33.13392      -----
                        

FASTA FORMAT for MUSCLE Version 3.6

>TBLA0A05440
------------------------------------------------------------
--------------------MSHRIDPNLQQQQQSDNVSRHSSSSSHINSLTPS------
TTSSSSRF-NLKRFTNSHLNHNLN--------------SNTSNDIFSIRSHSP---DRSI
SSASQQQQQQQQQQ---QQQQPLNMRNSLTNPNMNQYVTSPYTHEY--------------
-----------NNSHSRNTSINSVNSNPLSTK--YSY-SRRGSNQIL-----SPSPTGNS
S--------NNNTSNINPQQRYSVHSN---NPNSSSILSQG-SLHNL-MKFMTP-DGKVN
LEMPNNPAEVEALYEDIMYKRNILQNLPADKQRELMSYDVSKKWLIVKQDLQSELKKMRS
KNPLQNSNHNLPINNNNNNTNTNNISSNGQLNNSNILISNNNSGLSTGNQNLLNNNGDHP
KKSSSPTRLSIIGSNFNSNNNNTIINNSHSYSTNNSNGHSLNTSNMLTPSNSISSRNLNQ
QDASPIISKPKTKLKNSNNINNKASALSPDRTNRLPNDYIKEILNDRLSVDEMNDLWVTL
RTEQLTWVNTFLEDQGHIAMANSLMKSIYRINTMQNS---LSTYLIDKEYNFFKCFRVLS
MLSQGLTEFI---KHKLMTDTLVQGLFSTRLATRKIATEIFVLMLQKI----NDD-GLNI
L---LTTFDKTFSINENLNMVYLLKNVPDKYHYLNSTNTTQI---------KVLVSWLYA
VESTLDGRGKMGSLVGASQDFKITGGENAILEYCQWTMVLINRLCNASTIINQRVLLRTK
LENIGSIRIMNKLKKLDYEKITEQLEDYENKKLDDLNTLLEQDTKSS-VDLDNPISLLSH
LLEVCKDTEGEQSLTSIIQHLYLSSSKLFDDKDD-PTKLSKQLKLMDSLMTDA--TLSTV
-DNESKMNMAIQHLYDSMVTDDVARRAILESRNLTKKLEEVQAERDFLSNRLSEAENGLV
GKLENELAQRDSILAKNQRVTQQLRTELDELKKKHLMEKHDHEVELRKMLTILNSRPETE
LDNTMSSISRTKRNKHEIEKLELLKRKKVIEKALQDGLQKTKKDLSLDSKR----FGITV
QPNKRLQALRLQMEDIENEARQLEMTNFTD----PVRTPKKGQEKRDSHNKHPSLKPGIP
IAKKNKDRSEEMAKKQQKLAELRKALADIQQETNDISRFNVEEHVNELFNAKKIQAMERL
KELETMYQNFGVDFNMEEFLE----KNNTSTKELD-PDSPAYET----------LDPNLF
IDKMDELDKFSMKLDQLTSDLN--------------------------NTMSAKQNSLST
TNSNQISTPSSTSSSDFESDEENENTALSNNVNDNSS---------------TFSHQSTT
SGGSSFLESLSQKYGTGQ-------NAS-GPMSSNTPNV----------------SHYNP
ERKFMSRMKKQHATP--------NYIRELNQKVS---VTHSLSEEETDYEDAAANTKCPS
RKARKSSKISNENPTDE------------------DDEEEEEYTDTEDMKNEK-------
---TKKVTATKSKESTPVKTSPAAPPMPEFLSG---DTVSTEPESEKTST----------
-AAPPPPPPPPPPPPIPPI------------LL---TSGGPPPPPLPAMLQ--SEST---
---TPPNPNSPMPPP------------PPPPLM-SEKSMYRTDS-APDFSTSPNFFEKYP
RSQKKLKQLHWEKLDDTDNSIWVNGKAEEFADDLFEKGVLKRLESAFAAREIKSLASKKK
EDSTKITYLSRDISQQFGINLHMFSNLTVDQLIEKIIRCDRSILNTPSVIDFLSKQEIVE
VSVNLARSYAPYSTDWEGVKDVKDAKPPEKDPNELQRADQI-YLQLMVNLQSYWGSRMIA
LKVVTSYEKDFDELIRKLRRVDLAVGSIQKSENLKNVFNVILAVGNFMNDASKQAQGFKL
ATLQRLTFIKDSTNNMTFLNYVESIIRQNYPEFNDFLNELQPVLDVVKVSIEQLVRDCKE
FSQGIINVGRSVEIGKLSDSSKFHPQDKVLIKVLPVLPEATKKADLLSDEVKLSIMEFEN
LMQVFGEDSKDKFAKNSFFKKFADFINEYKRAQEQNLKVEEEERIYENHKKRIEEQQKRL
EDSKKKSHSDDTSNT---DGTEEEEDED---RRDVMDKLLEQLKNVGPV-KTDPTSARKR
AMVRKKLQNEKETASQILKEFETGED----------------SIVYSPTD--SKITPKKV
SNEYLQSPTPGEKSSLADMTSTPNPT-------------TITTTTDGKVTNDSSNDDLDQ
EIVDRAKSLLFELRGS-QTPTRKNSVLEERKEKLRARRRNT----SDL----TSNKLKFV
SSDKTVDGEPDSPDLLTQESNPNDKIEEENPSIDISTESNMILSSFDNNLQTIDSDTLVS
QGTGKLGPNDEEYEHKIQKSIDSIEIFDDTEAAHPENTSTNAATTTISDSDEDQFHEL--
-----
>KNAG0F00470
MLALRHTIYQCIPPLANHSPTRFGLASKTSLFFHSLSLCLIFPIFWAPSVKGILPVRKDR
TLCILTTRTNSNQGKPSWKPVAKRRKAQRENMLRNNNS-NDKAGSSSSASGS--------
GSGGGGLFSNIKRLAKQSSSASSS-------------------KAALARAQQP---EAPG
VP------------------KPLSKKATMNSQNLSHYTSGVSATSSDGDGGMASP-----
-----------EYTHSRTQSGQ-------TSRFSYTSPSRRSSSDA--------------
----------------KLAKYHTAQS------SQNSIASQG-SLSTLYNRFISPEDGKLR
LEMPDDPAEVELLYEDIMYKRNILQNLPTDKQLELMNYDVKKKWLIVKQDLQNERKKLKT
-----KTSSHQQTVQSAPFMNLQDTSSSASLPGQGFHDQQSVV-----------------
-------------------------SETSSRVPTTNDAASILSSATPSLRH--PSRRKQQ
YTLTNKQHTVYPANGTAERHASSSSTLASDKTNRLPIHYVKKIIADQLSQDELNDLWVTL
RTEQLDWVDAFLDNQGHIAMANVLMKSLYK-TSPNVS---LSGPLLDKEQSYFKCFKVLS
MLAQGLREFT---DHRLITDTIARGLFSSRLPTRKMATEIFVCMLETK----NQT-RFDA
V---ITSLDQNFQIGSNAHMVNNLQKMPDYFIHLNLQSTL-----------KVVQAWLFA
IDQTLDGRGKMGSLVGASDEFKRIDGENSVLEYCQWTLVFVNKFCQSSNNLNQRMLLRTK
LENAGFLRIMNKMKLLDYEKIRDQIEFYEAGKLDDFNSLLESQNKHANIDMQNPLSLLQN
LWDACRGTDSENLLVSLVQHLFLSSTRLIQNNKD-PTQLAKQLKLIDSLVTNVGSSVSAV
ADEETTMSMTIQRLFDSMQTDEVARRAIIESRTLTKKMEELQAEKDRLGDKLSKAEGGLV
GELQRDIRERDAILAKNQRVNKQLENELEELKRKTLMEKHEHEVELRKMLTIINSKASPN
LAQNPSASVLKSHDPKNKESLL-SEQQSKIQKVLQDGLTRTKKDFTNDAKK----FGMTV
QPNKRLQLLRMKVEDIENEARQLEMTNFADIEKN--ATPVILTKGTKKKKSKKKLKTAQP
DKKQRANQRNENQK-IEALNKLRMALTAIQSESNDISKFNVEEHVNELFTERKFKALQRL
RDLESKFNGLNTNFNIDDIIA--------STEKALTATDDGYS-----------LDPRRA
DNKLDEIERLTNDLSKLHDSMK--------------------------------------
--EQEQATLQSDNSSESSDSESVESDNEGSTVQSDVS--------------------EPT
VGSGSFLASLSQKYETGQ----------------KQPNS----------------PVTVN
QKAFMTRLKRSSGAP--------LYLQELSKKIP---QRPAFDESVDKVTLRKSTGDSNA
NSDGTTAKS--------------------------LDKDGDDNTEQSTPEGAESIISSNG
ETSTPEGSADVAGSVPAPPPPPPPPPMPSLL---------TENKSNSSS-----------
-------PAPPPPPP--------------------------PPPMTEGIVS--RSSS---
---SGAIP----PPP------------PPP----QATSAKNSPIPSPLFSQS-SIFEKYP
RPQKKLKQLHWEKLDSTNNSIWSASKAEKFADDLYEKGVLSNLEKAFAAREVKSLSSKKG
DD-SKITFLTRDVSQQFGINLHMFGNLSVEELVTKILKCDREVLNSPSVIEFLSKQEVVE
VSVNLARNYSPYSTDWEGVKRIEDAKAPEKDPNELQRADQL-YMSLMVNLQPYWSSRMRA
LKVITTYEREYAELLEKLRKVDKAVGSLQQSENLKNVLNVILAVGNYMNDTSKQAQGFKL
ATLQRLTFIKDTTNSMTFLNYVEKIVRKNYPTFNDFLNELQPVLDVVKISIDQLVSDCQE
FSGSVVNVERSIEIGNLSDSSKFHPSDRVLVKVLPVLPEARKKADLLTDEVKLTMLEFNN
LMQTYGEDSADKFAKNSFFKKFADFIQEYKKAQVQNVAAEEEEQQYERHKKIVEEQQRQG
EEARKRLESASPDATN--GEDTTAVDDETKDRRAIMDKLLEQLKNAGTV-KADPSSARKR
ALARRKLLGDKDAASALLHDIDTDDD----------------SLVYSPDT-----KRQSV
GHLIGGSPTPGDKLLGSTPTK------------------ELSSPTAG---------QDDE
DVTDRAKALLMELRGGQSSPMKKNAFLDEQRERIRSRRRRNELAGTEP--LRGGNKLSFF
EAETETSETA----------------------------------------------HDAD
NDTTKGQTADASDNLDSNDQLENPSIIEDADK----------------------------
-----
>TPHA0B04490
------------------------------------------------------------
-------------------------------MLRGSNS-KSSSSSSSVGKD---------
NSVGSGLLHNLKKLTNSSSTTSQN------------------NAINKSDISSP---KSQL
LT-------NKLSM---DDLKPLNKRTSLNNQNLSQYINGKLPKSQSDSSHLGNVKSNHK
YEINENIQDGSSPNHNRSASVQ--S----SAK--YSY-SRRSSNSTA-------------
--------------ATRLSRQSTNFSG-----STPSVFSQG-SYANL-SKYMDS-NGRLN
LDMPTDTHEIESLFEELMYKRNILQALSPDKQRDIMNYDTKKKWMIVKQDLQNELKRIKL
------------------KNNNINNSDTTIIPSSMPSSNISER-----------------
-------------------------SSVNTMDNNLRTIDTNASNPRIHRKG------QKS
MSSLSNATTTAPSGVNAEYSKIRSISESSDKTNIAPIHYVRKILSDTLSKNELNDLWVTL
RTEQLDWVDAFLEHQGHIAIANNLIRCIYK-TAPGSN---LSDELIEKEYGFFKCFRVLA
MLDQGLYEFT---KHKLMMDTLAFGLFSTRVSTRKMALEILVYIINKK----NTQ-RFES
V---IMSLDRFFRLSENLNMLKIITQFGGAFSRTSPDTQF-----------KIFQAFVIS
LESTLNGRGKMGSKVGASDDFKVSGGENAILEYCLWALIFINKLCNFSDELNQRVVLRTK
FENLGGLRVMTKLKLMDYEKMTVQVENYEDHKLDDFNSLLEMKSSSAQINMQDPTSLIGS
LWEVCKGTENEKLLLSLMQHLFLSSSKLVDDKRE-PAKLSKQLKLMDSLMTNI--TASEV
-DEQTHMNLAIQRLYDSMQTDDVARRAILETRTLSKKLEEVTAEKEYLKEKLSKAENGLV
GQLELELEQRDNILTKSQRVTKQLQAELEDLKKKHLLEKHEHEVELRKILTIVNTNTD--
--------------ADASLNNS-SDKKHNIQKALETELSRTKKDLNNDVKK----FGISV
QPNKRLRMLRLQMEDIEKEARELEMTNFSEHQKLSLESPAVLNKTKKETKKKSKKKSKSS
KSKEENNRKRANAIKKQKLLELRRDLAMIQAETNDVSKFNVDKRVNELFKEKKHEALNRL
QMLEKKYKSFEIDFDPNDFKQ------------AQLDSNASYES----------LDPNFV
TKKITDIDRIADELDAF-------------------------------------------
----SGDGTSSYSSSSLSDSEKNYYESNAVPTIGPQK---------------------GL
IDGSSFLESLSEKYGTAQ-------NTEGTSLSPLSPQN--------R-------IASLG
EKSFMNRFKRKPSSM--------QFLEELSQKVG----------GEALGKDNNETSDINN
ISSEEDNS---------------------------SNSESELNNEPEVEAIDA-------
----DLTVSESKGAGAPPPPPPPPPEFPASL----------LPNATGGST----------
----IPVPPPPPPPP--------------------------PPPALPASLS--PNVT---
---EGSSI----PPP------------PPPQFM-GLNKMYRSGDGSQILNESPSLYSKYP
RPQKKLKQLHWDKLDDSEGSIWSSAMAEQFADDLYEKGVLHNLEKAFAAREIKSLANKKK
EDLDKISFLSRDISQQFGINLHMFGSLTVDELVIKILKCNRDVMNTPSVIEFLSKPEITD
VSINLARNYAPYITDWEGVKHVEDAKAPEKSVDGLQRADQI-YVQLMVNLQSYWPSRMRA
IKVITSYEKEYTELVTKLRRIDSAVSAIQKSDNLTNLFNVILAVGNYMNDSSKQAQGFKL
NTLQRLTFIKDSTNSMTFLNYVEKIIRENYPEFNGFIEELEPVLDVVKISVEQLVNDCNE
FTQSIMNVERSLEIGNLSDSSKFHPLDKVITKVLPVLPEATKKSDLLTDEVKLTFMEFEA
LMQKFGEDSGDKFAQNSFFKKFADFINEYKKARAQNLKAEEEVRKYERHKQMVEEQQRKA
KEQEKNYMETGVS-----DSESAEAKGD---NRGHMDKLLAQLKNAGPA-RSDPSSARKR
AVMRKKLLSEKDSTSVILDDLNAGDG----------------SIIYSPTTDKVVDTSLGE
DEMILKSPTPKSKDNLETDNNSDKSRNDTLTVDDVEQNTDTNAETDITDDGNSNGDGEDE
VITDRAKALLMELRGS-QTPSKKNSHLDDQREKLRSRRNRRRQTFGEESNSTPSNRLTFV
SDENSPTATEF---------------------------------------------VDAD
EDTLQENVPNTDTSSTLSKDDSEDTESQ--------------------------------
-----
>Kpol_2000.66
------------------------------------------------------------
-------------------------------MLRSSNS-KDSGSGKP-------------
SGSGSSLLQNLKKITNSSSNSSTS--------------------INKADISSP---KKPI
VP-------KQFTS---TELRPLNKKSTLNTQNLSQYVSGTKIDQDNPNPLPTN------
-----------NTSHTRAHSSQ--S----ATK--YSY-SRRSSTATG-------------
--------------PIKLSRQQTTQSL-----GSSSVLSQG-SYTNL-LKYIDS-DGKIN
LEMPRDPHEVEALFEDLMYKRNIFQALPQDKQKELMSYDVTKKWTLVKQDLQNEIKKLMS
KSSSYHPTEGSYSSASNSNGNLNSYSSSLRSSATSQDSNSPQT-----------------
-------------------------AIFTSNSGTMQNNTINLNNGNIPVGG----KSRPV
GSSSTASGTNSMIYQ-SSENNKSVSSIATDRINRPPIHYVKKIIADRLTSEEMNDLWVTL
RTEQLDWVDAFLEHQGHIAMANVLMNTIYK-CAPGSE---LTPELQEKEHSFFKCFRVLS
MLSQGLYEFA---KHKLMSDTIANGLFSSRLATRKMATEVLVCMIEKR----NNM-RFEV
V---LASLDRYFRQEENLNMVHLSKTLPGEYPQSTPNTKY-----------KIIQAWLIA
LDETLNGRGKMGSLVGASDDYR-SAGENAILEYCLWTMVFINHLCSNSSLLNQRILLRTK
LENLGALRIMTKLKRLDYEKLTEQIELYDNNKLDDFNTVLETESKNSKVNMQNPNSLIEN
LWESCKGSDNEKLLLSLIQHLYLSSSKLMGEKED-PTKLSKQLKLIDSLLTNV--NGSMF
-DEESHMNLAIQRLYDSMQTDEVARRAILESRTLTKKLEEAHAERDYLSNKLSNAENGLV
GQLESDLKQRDNILEKNQRVMKQLESELEDLKKKHLLEKHEHEVELRKMLTILNSR----
------NGTQNPDVDDVTITLD-PNKKLDIQKALELELNKTKKDLSNDSKR----FGITV
QPNKRLKMLRMQMEDIENEARQLEMTNFADHKRTNLKKPVIVKKEKKLRKKKKINTEEFD
KENEMK---------TKKLMQLRKALAAIQSETNDISKFNVEGRVNEMFQDKKLKALQRL
KQLEAKYKDFEIPFDELQDLD-----------DRELDDEQQHST----------LDPTYL
QKKINELDEISDELYLMNYDSD--------------------------------------
----ANNGNTSDSSSSSEADGDGTDSMRSVSNAPSKG----------------------I
SEAGSFLESLSQKYGTGQ-------NAISSPTSITSPNE--------R-------IASQG
EKSFMNRLKRQTMAA--------PFLEELTQKVN---DTSSIDDNISDLDDVEVDENDND
DDVED------------------------------TDIADILLKDRSKDGLKS-------
---SDEQDDSEAVQAPPPPPPPPPPPLPEML---------GATKNAPGAV----------
-------PPPPPPPPPDLFG-----------------GAPPPPPLPPVLGA--GGKN---
---SGGTP----PPP------------PPPPMM-GKKEPYKSVVDQPSLLQLTN-SDRLP
RPQKKLKQLHWDKLDSTDSSIWSKGMAERFADDLYEKGVLRNLEKAFAAREIKSIGTRKK
EDLSKISFLSHDISQQFGINLHMYGSLAVPELIEKVLKCDRNLINTPSVIEFLAKSEIVE
VSVNLARNYAPYTTDWEGVKSLKMQKFQRR--IQMTYRELIKFIYNMVNLQSYWASRMRA
LKVITSYEREYNELVTKLRKVDKAVGAVQRSENLKNVFNVILAVGNYMNDTSKQAQGFKL
STLQRLTFIKDATNSMTFLNYVEKIVRDNYPSFNDFIDDLEPVLDVVKLSVEQLISDCNE
FSQSIVNVERSLEIGNLSDSSKFHPSDKVLTKVLPVLPEAAKKSSLLTDEVKLTIMEFEA
LMKKYGEDAGDKFAKNSFFKKFADFITEYKKAQSQNLKQEEEERAYEKHKRMIEEQQHKQ
DLEEERSREV--------EGEPGEEQSD---RRAMMDKLLEKLKNAGPG-KADPSSARKR
ALVRKKLLTDKEVTAHILQDIDTGDD----------------SIVYSPNT----PTQEGP
NDIHLASPTPSGKSDLVL---------------------ASVSPTKESTADGI---AEDE
FISDRAKALLLELRGS--ENMKRNSQLEEQKEKLKARRSRR----RTQTESISSNKLFFT
DEESHSTSPSESKGTEYEM-------------------------------------TTAN
EEPEEILNARITEEGPHEEAPNQEEPNQEESIPSKDESL---------------------
-----
>KAFR0D03950
------------------------------------------------------------
-------------------------------MLKSSGS-KHSSTNSNG------------
SNNPSSLFQNLKRLTSNNSNNTSK--------------YTESYSINKSSISSPLQKHDTN
LPPSSSSSPSSNASAITTTNKPLNKKSTLNTQNLSQYMD---------------------
--------------HARSSSTNSAS----ASK--YSS-SRRSSTQVS-------------
----------TSESLRRLSRQHTGQS------SSASIHSQNSSYINF-SKFITP-DGKTN
LEMPRDPKEIENLFEEIMYKRNILQNLSVEKQRELMNYDVRKKWLIVKQDIQNEFKRIRA
-------------TKNGPKNSSLVNVEQLVYSPTTTTTNNNNN-----------------
-------------------------NNNSNYNNTSPMASVASNEYYPMTSP---------
---QTKKPTSHELYQ-LTESNASTSTLSSDKTNRPPNRYVEKIIADKLSPDEMRDLWVTL
RTEQLDWVDSFLENQGHIAMANILMKQIYK-TTPKDH---LSSKLLEKENSFFKCFKVLS
MLSQGIYEFS---KHKLMTDTIARGLFSTRLGTRKMAIEIFVCMLEKR----NKS-RFEA
I---LNSLDQNFRIGSNFHMFQNLKKLPQYFIHLTPDSHL-----------KVLQAWLFS
IENTIDGRGKMGSLVGASTDLKNSGGENAILEYCLWTMVFVNMLCNASTIIQQRMLLRTK
LENSGFLRIMNKIKLLNYEKVIDEIESYENNKLDDFNLMLESKNKNSNVNLQDPVSLLNN
LWQSCKGTENEKLLISLIQHLFLSSSRLIEEVDD-PTKLSKQLKLMDSLVTNV--SSSST
ADEESTMNMAIQRLYDSMQTDEVARRAILESRTLTKKLEELQAEKDLLHEKLSKAENGLV
GQLENDLNERDQILAKNQRVTQQLQSELEELKKKHLLEKHEHEVELRKMLTILNTRSSTN
-----DGAKTIDKDKDNISKLN-LQKHENIQKVLQDGLIRAKNDFTIDAKK----FGMTV
QPNKRLKMLRMQMEDIENEARQLEMTNFTEFERKKLEPPVEVTKPKHRHKKHKIEKINQQ
ESNDQKSR-------INKLNDLREALAEIQTESNNISKFNLEERVNELFNEKKLKALQRL
KELETKYKDFGINFEMKDFLE-----NKPNDGTKEGSTEEEYES----------LDPKIY
EKKLDDIDRLTEQLLNLQKTQE--------------------------------------
----LREESSSSYSSSESDEENDDDEIFVASSSSKPA----------------------G
SGTRSFLETLSEKYGTGQ-------KNVAMTATPNSR------------------IVTQS
EKQFLDRMRRSSTAA--------PFLQELTEKVA---PALSVNEEQEEGEENNREDKIVT
GSSKVPSE---------------------------VVKTTLENADKNAGKIDS-------
VSSADADIVKDKSTGALPTPPPPPPPLPVQIFATNNDVGTNSDVLDNTSV----------
---ALPPPPPPPPLPSALFESGSAPLS----RG---TSPTPTPPPPP-------------
---PPPPP----PPPFSAETSANSTSSVPPPAL-PLMGG-KSVSSSPLLPQSPSLFERYP
RSQKKMKQLHWEKIETTDNSIWTTGKAERFADDLFEKGVFSNLEKAFAAREVKSLASKRK
DDLDKITFLSRDISQQFGINLHMYSSLSVEDLVTKILKCDRDFLHTPSVIEFLSKPEITE
VSVNLARNYSPYTTDWEGLKSIEDAKPPEKDPNDLQRADQI-YLQLMVNLQPYWASRMRA
LKIITTYEKEYNELLLKLRKVDKAVGSLQESENLRNVFNVILAVGNYMNDTSKQAQGFKL
STLQRLTFIKDSTNSMTFLNYVEKIIRMNYPSFNSFLQELEPVLEVVKISIEQLANDCKE
FFQSVTNVERSIEIGNLSDSSKFHPLDRVLAKVLPTLPDVRKKGDLLNDEVNLTLMEFDG
LMQVYGEDTSDKFARNSFFKKFADFINEYRKAQEQNIKVEEEEEAYERHKRMVEEQQRKA
ERKEAKNQNNIDE-----NEDDDQERTD---RRGTMDKLLEQLKNVGPS-RADPSSARKR
ALARKKMLTDKEGTVNMMHDLETESD----------------SIIYSPDN-----KAIGS
TPFGANGASSHKQNS------------------------NELSPSKGFRDD-----LSEE
EISERAKTLLMGLRGT-ASPSKRNSMLDEHKEKLRARRRRT----NND-LPSGSNKLKFY
DTNEKDISNEPTEKSEQDE-------------------------------------YRTE
QSSQIVDEQTSDAKVDSTDEHVIENGIKEENIDDDN------------------------
-----
>CAGL0J08206g
------------------------------------------------------------
-------------------------------MLKGSNS-KSSDGSG--------------
SGSNSGLFQNLRRLTTKDRDNRNK--------------SPKRTSLDNDNISQR---STKN
INVSQAVSSRHGSI---DQSRPLNKKSTLNSQNLSQYVNNGKALS------PES------
-----------GSNHHRTDSTQ--S----GFK--YSY-SRRSSGQVS------------M
A--------PSSMGNINLTRHNTNTSF-----SSASVLSHG-SITNL-SRFMTP-DGKIN
LTMPSDPYEVESLFEDIMYKRNILQSLPQEKQNELMSYSIEKKWLIVKQDLQNEFKRIKA
----------------SNKGDSRTGMSMPDLGSDPSNSVSPPG-----------------
-------------------------PISSSGSSIFSSDVTSTAPSTYSRSG-----KKNI
PISKPIAATSTELYH-IAERNTSSSTIQSDKANRPPIHYVKKIVDDKLSKDEMKDLWVTL
RTEQLDWVDAFLENQGHIAMANILMKSIYK-TTPKDK---VSEPLLDKENAFFKCFRVLA
VLSQGLHEFT---IHSLMTDTIAQGLFSGRLATRKMATEIFVFLLEKK----NKK-RFES
V---LSSLDKNFIIGQNSHMNESYKKLPQYFTHLTSNSNL-----------KVIQAWLFA
VEQTLDGRGKMGSLVGASEDYKNAGGENAILEYCQWTMVFINHLCSSSENINQRTLLRRK
LENCGILRIMNKIKLLDYEKVIDQIELYENNKLDDFNALLESNKKNINVDLQDPVSLMKN
LLDACKGTENEKTLVSLVQHIFLPTSKLLDEKQD-PNKVTKQLKLMDSLVTNV--SVTST
-EEGSNVNMAIQRLYDSMQTDEVARRAILESRTLTKKLEEMEAERDMLVEKLSKAEHGLV
GQLEMEVKERDRILAKNQRVMKQLESELEELKKKHLLEKHEQEVELRKMLTILNSRPA--
---------KTKEQKKKIGSIE-ASEKEDLQRALQSGLQKAKKDFKDDSKK----FGMTI
QPNQRLKVLRMQMESIENEARKLEMTNFAEYEKKGLKPPANVQKKSKPISELNKEQR---
---------------IQKLNELRDKLRRIQMESNDVSKFNVDERVNELFNDKKRTALQRL
KELETKYKGFGIDFKVEDFTH-----------ESTDSSNEGYSS----------LDPKVY
QDKLDEITKISEELLQQKNELE--------------------------------------
---TTQTSSSESNSDSESSSDSDDSMEDALTNNKDIN---------------GTSSNVSD
LASGSFLDTLTQKYGTGQ-------AEPIQSPVGHYSNR--------------------N
EKSFVDRMKRNSRVP--------SYVEELSKKMR---GNKDHEFEEDDHKNGNQSSDDFD
SESKTN-----------------------------MDQDQLLATSAVSPTTSA-------
-------------------PPPPPPPMPAGLFGANNDNNTGDSDAISVSG----------
---TPAPPPPPPPPPFLK------------------DSSPIPPPPMPTMLT--PSES---
---TTSLS----SIP------------PAPPMM-TKDSK-KKVVSSPLLPQSPSLFENYP
RPQKKLKQLHWEKVESTDNSIWGSQKAEKFADDLYEKGVLSELEKAFAAREIKSLATRKK
EDLQKISFLSHDISQQFGINLHMYSNLTVNQFVEKVLKCERDFMNTPSVIEFLSKQEIVE
VSTNLARNYAPYSTDWEGIKKIEDAKAPEKDPNELQRADQI-YLQLMVNLQSYWASRMRA
IRMITSYEREYNELLAKLHRVDKAVGSLQGSDNLKNIFNVILAVGNFMNDSAKQAKGFKL
STLQRLTFIKDADNSMTFLNYVEKIVRSNYPEFNNFLIELEPVLEVVKVSIEQLVNDCND
FVQGINNVERSIEIGNLSDSSKFHPLDKVLLKVLPNLSEARKKGELLADEMKLTIMEFEQ
IMQTYGEDYGDKFAKISFFQKFADFIAEYKKAQAQNIKVEEEEAAYERHKKMVEEQQRKA
QEDASKLNENSSQTG---NSDEEEESED---RRAVMDKLLEQLKNAGQV-KTDPTSARKR
ALLRKKIHSSEESESSPLAEMQVGGD----------------SLIYSPDA-----KEQIE
LEIHMASPTPKTKEDGKLGTGE-----------------NSNGESPLKKI------NEDE
EIGDRAKTLLMELRGS-DALMDRNTALDEHKERLRARRKRTD---SNK--IPSSNRLKFV
DEKS----------------------------------------------------PDEE
QEEVSSSSISTTGIVTAQESPVQIDENED-------------------------------
-----
>Suva_14.71
------------------------------------------------------------
-------------------------------MLKNSGS-KNSNSKESN------------
SSSSSGLFQNLKRLANSSASNNNATSPNNAS-EHQHPPVGQETSTSSASSSSF---RRLN
GP-------SRSTS---TEARPLNKKATLNTQNLSQYMNGKISTDAPT------------
-----------SSQHARSHSVQ--------SK--YSY-SKRTSSQAS-------------
---------------NKLTRQHTGQSH-----SATSLLSLG-SLTNL-SKFTTP-DGKIH
LEMPSDPYEVEVLFEDIMYKRNIFQSLSGDKQEELMSYSTEKKWLIVKQDLQNELKKIRA
---NTTSSSAASRTSIASDQHPILTANSTLSSPKSALMTSASS-----------------
-------------------------PTSTVYSNTLNHSTTLSSVGTSTPKG--HNNKKTI
AGGLKKQPSLNSIYRGGPEINTSASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTL
RTEQLDWVDAFIDHQGHIAMANVLMNSIYK-TAPREH---LTKELLEKENSFFKCFRVLS
MLSQGLYEFS---THRLMTDTVAEGLFSTKLVTRKMATEIFVCMLEKK----NKN-RFEA
V---LTALDKKFRIGQNLHMIQNFKKMPQYFSHLTLESHL-----------KIIQAWLFA
VEQTLDGRGKMGSLVGASDEFKNGGGENAILEYCQWTMVFINHLCSCSDNVNQRMLLRTK
LENCGILRIMNKIKLLDYDKVIDQIELYDNNKLDDFNVKLEASNKAFNVDLKDPLSLLKN
LWEICKGTDNEKLLVSLVQHLFLSSSKLIEENQN-PSKLSKQLKLMDSLVTNV--SVAST
ADEESNMNMAIQRLYDAMQTDEVARRAILESRTLTKKLEEIQAERDSLSEKLGKAEHGLV
GQLENELHGRDRILAKNQRVMQQLESELEELKKKHLLEKHQQEVELRKMLTILNSRPE--
-----ESSDLSKGTKDINPSLN-SSEKANIQKVLQDGLSRAKKDYKDDSKK----FGMTL
QPNKRLKMLRMQMENIENEARQLEMTNFAEFEKERLEPPIEIKKPKIKHKKHKIKKSSVK
TQGAD----------MNKLNDLRRALAEIQMESNDISKFNVEERVNELFNEKKSLALKRL
KELETKYKGFGIDFNVEEFIE------TPKKFSVDEENDAAYPS----------LDPKAY
QSKLDEINRITDELLDLQTQVK--------------------------------------
QETEEDEDEETKSSSSSSDADDDEIYQDASPSQERRG---------------EYSELSAG
SGPGSFLDALSQKYGTGQ-------NVTASAGLRDNRGS-------GH-------MPSNV
EKSFINRLRKSTASSA-------PYLEELTQKVN---KVEPFKQNKDEDLVKDLSTENDI
ADGTFVSDKVGGDVQKHIKNKVRKRLDD-------KEEEEEGVTTDTSHVSDS-----DS
EVEAENPSTTSSTLHPPPPPPPPPPPIPLRLFGTVNQSPDKEKETEDDTAGE--------
-AAAAPPPPPPXXXXMGLFG-----------QN---NGGTPPPPPLPFVLS---------
---STGPG----AIP------------PAPPMM-PASQM-KSAVTSPLLPQSPSLFEKYP
RPHKKLKQLHWEKIDSTDNSIWGSGKAEKFADDLYEKGVLADLEKAFAAREIKSLATKRK
EDLQKVTFLSRDISQQFGINLHMYSSLSVADLVKKILKCDRDFLQTPSVVEFLSKPEITE
VSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQRADQI-YLQLMVNLEQYWGSRMRA
LTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVFNVILAVGNFMNDTSKQAQGFKL
STLQRLTFIKDTNNSMTFLNYVEKIIRLNYPSFNDFLKELEPVLDVVKVSIEQLVNDCKD
FSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLEDEVKLTIMEFES
LMQTYGEDSGDKFAKISFFKKFADFVNEYKRAQSQNLAAEEEERLYEKHKKMVEEQQKRA
QDKEKHREHSALP-----EGNEEEETED---RRAVMDKLLEQLKNAGPA-KSDPSSARKR
ALVRKKYISDKDNSAQVLNDLNDEEG----------------SILYSPEA----TTPDTD
TVIHAESPTPLATRGFMNTPE------------------DLPSPSKASAL------EDQE
EITDRARMLLKELRGS-DAPVKQNSILDEHLEKLRARKERA----NGE--TNTGNKLSFK
------------------------------------------------------------
------------------------------------------------------------
-----
>Skud_14.69
------------------------------------------------------------
-------------------------------MLKNSGS-KHSNSNSN-------------
STSSSGLLQNLKRLANSNGTSANAASPTNAT-QQQHSPMGQESSTSPSSSSSF---RNLN
GP-------SRTTS---IEARPLNKKSTLNTQNLSQYMSGKMSADVPI------------
-----------SSQHARSHSVQ--------SK--YSY-SKRNSSQAS-------------
---------------NKLTRQHTGQSH-----SASSLLSQG-SLTNL-SKFTTP-DGKIH
LEMPSDPYEVEILFEDIMYKRNIFQSLSGDKQEALMGYSTEKKWLIVKQDLQNELKKMRA
---NTTSSSAASRTSVASDHLPILTANSSLSSPKSILMTSASS-----------------
-------------------------PTSTVYSNNLNHSTTLSSAGTSTSKS-----KKIV
TGSLKKQPSLNNIYRGGSENNISASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTL
RTEQLDWVDAFIEHQGHIAMANVLMNSMYK-TAPRDN---LTKELLEKENSFFKCFRVLS
MLSQGLYEFS---THRLMTDTVAEGLFSTKLATKKMATEIFVCMLEKK----NKS-RFEA
V---LTALDKKFRIGQNLHMIQNFKKMPQYFSHLTLESHL-----------KIIQAWLFA
VEQTLDGRGKMGSLVGASDDFKNGGGENAILEYCQWTMVFINHLCSCSDNINQRMLLRTK
LENCGVLRIMNKIKLLDYDKVIDQIDLYDNNKLDDFNVKLEANNEAFNVDLQDPLSLLKN
LWGICKGTENEKLLVSLVQHLFLSSSKLIEENQN-SSKLTKQLKLMDSLVTNV--SIASA
ADEESNLNMAIQRLYDAMQTDEVARRAILESRALTKKLEEIQAERDSLSEKLSKAEHGLV
GQLEDELHERDHILAKNQRVMQQLESELEELKKKHLLEKHQQEVELRKMLTILNSRPE--
-----ESSDINEGTRNIDPSLN-FSEKANIQKVLQDGLSRAKKDYKDDSKK----FGMTL
QPNKRLKMLRMQMENIENEARQLEMTNFAEFEKERLEPPIQIKKPKLKKNKHKDKNFLAR
AQEAD----------MNKLNDLRRALADIQMESNNISKFNVEERVNELFNEKKSLALKRL
KELETKYKGFGIDFNVEKIME----SPKKLSVADEREGDARYSS----------LDPKAY
QKKLDEINRITDELLDLQTQTK--------------------------------------
QETKEEENGKSSFSSSSSDADDDEVYQDASPTHEIRS---------------ENSELSAG
SGPGSFLDALSQKYGTGQ-------NVT---ASAGLRDSGYVSGLGHT-------PSKV-
EKTFMNRLKRSTVNSA-------PYLEELTQKVN---KVEPCEQNEHVNIPRELSPKKSL
TSSTSDEIEKYDQEHV-------------------ENKIQGSTTSTSTGGQPN----SVL
EAENSLTSSSVLPPPPPPPPPPPPPPVPIELFG---KSLVREKEIEDNAAKQNTTAGEAV
PPPPPPPPPPPPPPPMALFG-----------KP---TGGTPPPPPLPSVLS---------
---SSATG----AIP------------PAPPMM-PASQM-KSAVTSPLLPQSPSLFEKYP
RPHKKLKQLHWEKLDSTDNSIWGSGKAEKFADDLYEKGVLADLEKAFAAREIKSLATKRK
EDLQKITFLSRDISQQFGINLHMYSSLSVPDLVKKVLNCDRDFLQTPSVVEFLSKTEIIE
VSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQRADQV-YLQLMINLESYWGSRMRA
LTVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNVFNVILAVGNFMNDTSKQAQGFKL
STLQRLTFIKDTTNSMTFLNYVEKIIRLNYPNFNDFLKELEPVLDVVKVSIEQLVNDCKD
FSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLKDEVKLTIMEFES
LMQTYGEDSGDKFAKISFFKKFADFINEYKKAQAQNLAGEEEERLYEKHKKLVEEQQKKA
QEKEKQKERSASPSP---EGNEEDEAED---RRDVMDKLLEQLKNAGPA-KTDPSSARKR
ALVRKKYLSDKDSAPQLLNDLDNEEG----------------SILYSPEA----TTPDTY
TAVHAESPTPLATRGLMNTPE------------------DLPSPSKAPAL------EDQE
EISDRARMLLKELRGS-EISVKQNSTLDEHLEKLRARKERA----SSE--TNTGNKLSFN
------------------------------------------------------------
------------------------------------------------------------
-----
>Smik_14.66
------------------------------------------------------------
-------------------------------MLKNSGS-KHSNSKESH------------
SNSNSGLFQNLKRLANSNAANNNTGSPTNVSPQQQHSPVEHEAATSPASSSSF---RKLN
GP-------SRSIS---TEARPLNKKSTLNTQNLSQYMNGKISADVPV------------
-----------SSQHARSHSMQ--------SK--YSY-SKRNSSQAS-------------
---------------NKLTRQHTGQSH-----SVSSLLSQG-SLTNL-SKFTTP-DGKIH
LEMPSDPYEVEVLFEDIMYKRNIFQSLSGDKQEALMSYSTEKKWLIVKQDLQNELKKLRA
---NTTSSSTASRTSIASDHHPILTANSSLSSPKSVLMTSASS-----------------
-------------------------PTSTVYSNSLNHSTTLSSVGTSTSKS-----KKLM
GGSLKKQPSLNNIYRGGSENNTSASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTL
RTEQLDWVDAFIDHQGHIAMANVLMNSIYK-TAPRDS---LTKELLEKENSFFKCFRVLS
MLSQGLYEFS---THRLMTDTVAEGLFSTRLATRKMATEIFVCMLEKK----NKS-RFEA
V---LTALDKKFRIGQNLHMIQNFKKMPQYFSHLTLESHL-----------KIIQAWLFA
VEQTLDGRGKMGSLVGASDEFKNGGGENAILEYCQWTMVFINHLCSCSDNINQRMLLRTK
LENCGVLRIMNKIKLLDYDKVMDQIELYDNNKLDDFNVRLEANNKAFNVDLQDPLSLLKN
LWDICKGTENEKLLVSLVQHLFLSSSKLIEENQN-PSKLTKQLKVMDSLVTSV--SIAST
SDEESNMNMAIQRLYDAMQTDEVARRAILESRALTKKLEEIQAERDSLSEKLSKAEHGLV
GQLEDELHGRDRILAKNQRVMQQLEAELEELKKKHLLEKHQQEVELRKMLTILNSRPE--
-----ENSSINEGIRGKNSSLN-SSEKANIQKVLQDGLSRAKKDYKDDSKK----FGMTL
QPNKRLKMLRMQMENIENEARQLEMTNFAEFEKDHLEPPIQIKKPKLKKIKHKDKKLISR
PQEVD----------MNKLNDLRRALAEIQMESNDISKFNVEERVNELFNEKKSLALKRL
KELETKYKGFGIDFNVEEIME----SPKKNSANERKEDGANYSS----------LDPRTY
QNKLDEINRITDQLLDLQAQTK--------------------------------------
----QDDGGVSSLSSSSSSAEGEDVYQDAFPAQEVRS---------------ENSELSVE
SGSGSFLDALSQKYGTGQ-------NNTVSVGLRDSDYV----SVIGH-------MPSKV
EKTFMNKLRKSTASSA-------PYLEELTQKVN---KVESYEQDEDEVRSKESSSKNAP
RNAVPVIDKVKESFRGHVESREEGRLD--------TKEEEIVKNDEETITTNLSAVCGSD
NVANAKSITTVSSTLPPPPPPPPPPPVPVELFG---NSLEKEEESKDDSVKQDT------
-GNGAAPPPPPPPPPMALFG-----------KN---MGGTPPPPPLPSVLR---------
---SSAAG----AIP------------PAPPMM-PASQV-KSAVTSPLLPQSPSLFEKYP
RPHKKLKQLHWEKLDSTDNSIWGTGKAEKFADDLYEKGVLADLEKAFAAREIKSLATKRK
EDLKKITFLSRDISQQFGINLHMYSSLSVTDLVKKILNCDRDFLQTPSVVEFLSKPEIIE
VSVNLARNYAPYSTDWEGVKNLKDAKPPEKDPNDLQRADQI-YLQLMVNLESYWGSRMRA
LIVVTSYEKEYNELLTKLRKVDKAVGALQESDNLRNVFNVILAVGNFMNDTSKQAQGFKL
STLQRLTFIKDTNNSMTFLNYVEKIIRLNYPSFNDFLKELEPVLDVVKVSIEQLVNDCRD
FSQSIVNVERSVEIGNLSDSSKFHPLDKILIKTLPVLPEARKKGDLLEDEVKLTIMEFES
LMHTYGEDSGDKFAKISFFKKFADFINEYKKAQSQNLAAEEEERIYEKHKKIVEEQQKRA
QEREKQKENSNSSSS---EGNEEDEAED---RRAVMDKLLEQLKNAGPG-KSDPSSARKR
ALVRKRYLSDKDNSQQLLNDLDNEEG----------------SILYSPEA----LDPDAD
AVIHAESPTPLTTRGTLNIPE------------------DLPSPSKASTL------EDQE
EISDRAKMLLKELRGS-DTPVKQNSILDEHLEKLRARKERT----IGE--GSAGNKLSFK
------------------------------------------------------------
------------------------------------------------------------
-----
>YNL271C
------------------------------------------------------------
-------------------------------MLKNSGS-KHSNSKESH------------
SNSSSGIFQNLKRLANSNATNSNTGSPTYAS-QQQHSPVGNEVSTSPASSSSF---RKLN
AP-------SRSTS---TEARPLNKKSTLNTQNLSQYMNGKLSGDVPV------------
-----------SSQHARSHSMQ--------SK--YSY-SKRNSSQAS-------------
---------------NKLTRQHTGQSH-----SASSLLSQG-SLTNL-SKFTTP-DGKIY
LEMPSDPYEVEVLFEDIMYKRNIFQSLSEDKQEALMGYSIEKKWLIVKQDLQNELKKMRA
---NTTSSSTASRTSMASDHHPILTANSSLSSPKSVLMTSASS-----------------
-------------------------PTSTVYSNSLNHSTTLSSVGTSTSKG-----KKLV
SGSLKKQPSLNNIYRGGAENNTSASTLPGDRTNRPPIHYVQRILADKLTSDEMKDLWVTL
RTEQLDWVDAFIDHQGHIAMANVLMNSIYK-TAPREN---LTKELLEKENSFFKCFRVLS
MLSQGLYEFS---THRLMTDTVAEGLFSTKLATRKMATEIFVCMLEKK----NKS-RFEA
V---LTSLDKKFRIGQNLHMIQNFKKMPQYFSHLTLESHL-----------KIIQAWLFA
VEQTLDGRGKMGSLVGASDEFKNGGGENAILEYCQWTMVFINHLCSCSDNINQRMLLRTK
LENCGILRIMNKIKLLDYDKVIDQIELYDNNKLDDFNVKLEANNKAFNVDLHDPLSLLKN
LWDICKGTENEKLLVSLVQHLFLSSSKLIEENQN-SSKLTKQLKLMDSLVTNV--SVAST
SDEETNMNMAIQRLYDAMQTDEVARRAILESRALTKKLEEIQAERDSLSEKLSKAEHGLV
GQLEDELHERDRILAKNQRVMQQLEAELEELKKKHLLEKHQQEVELRKMLTILNSRPE--
-----ESFNKNEGTRGMNSSLN-SSEKANIQKVLQDGLSRAKKDYKDDSKK----FGMTL
QPNKRLKMLRMQMENIENEARQLEMTNFAEFEKDRLEPPIHIKKPKVKKMKNKDRKPLVK
PQEAD----------VNKLNDLRRALAEIQMESNDISKFNVEERVNELFNEKKSLALKRL
KELETKYKGFGIDFNVDEIMD----SPKKNTGDVETEEDANYAS----------LDPKTY
QKKLDEINRITDQLLDIQTQTE--------------------------------------
HEIQVEEDGESDLSSSSSDDESEEIYQDASPTQELRS---------------EHSELSSG
SGPGSFLDALSQKYGTGQ-------NVTASAAFGENNNG----SGIGP-------LHSKV
EKTFMNRLRKSTVSSA-------PYLEELTQKVN---KVEPYEQNEDEGLDKKSLPENST
ASAASAFDKAEKDMRQHVENGKQGRVV--------NHEEDKTADFSAVSKLNN------T
DGAEDLSTQSSVLSSQPPPPPPPPPPVPAKLFG---ESLEKEKKSEDDTVKQETTGDS--
-PAPPPPPPPPPPPPMALFG-----------KP---KGETPPPPPLPSVLS---------
---SSTDG----VIP------------PAPPMM-PASQI-KSAVTSPLLPQSPSLFEKYP
RPHKKLKQLHWEKLDCTDNSIWGTGKAEKFADDLYEKGVLADLEKAFAAREIKSLASKRK
EDLQKITFLSRDISQQFGINLHMYSSLSVADLVKKILNCDRDFLQTPSVVEFLSKSEIIE
VSVNLARNYAPYSTDWEGVRNLEDAKPPEKDPNDLQRADQI-YLQLMVNLESYWGSRMRA
LTVVTSYEREYNELLAKLRKVDKAVSALQESDNLRNVFNVILAVGNFMNDTSKQAQGFKL
STLQRLTFIKDTTNSMTFLNYVEKIVRLNYPSFNDFLSELEPVLDVVKVSIEQLVNDCKD
FSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARKKGDLLEDEVKLTIMEFES
LMHTYGEDSGDKFAKISFFKKFADFINEYKKAQAQNLAAEEEERLYIKHKKIVEEQQKRA
QEKEKQKENSNSPSS---EGNEEDEAED---RRAVMDKLLEQLKNAGPA-KSDPSSARKR
ALVRKKYLSEKDNAPQLLNDLDTEEG----------------SILYSPEA----MDPTAD
TVIHAESPTPLATRGVMNTSE------------------DLPSPSKTSAL------EDQE
EISDRARMLLKELRGS-DTPVKQNSILDEHLEKLRARKERS----IGE--ASTGNRLSFK
------------------------------------------------------------
------------------------------------------------------------
-----
>NDAI0F04220
------------------------------------------------------------
-------------------------------MLRNSSN-KHNANQEQG-TKNNA------
TTSGSNLFQNLKRFATNSTGSSNN---------------TSPRTSNSSEPSQV---KRES
IP--QGSTSSLHSS---NEIKPLIKNTTLNTQNLSQYINSK------------N------
-----------IPDHSRSQSIQ--S----SSK--YSYSSRRASSQTN-------------
----------PSVTGYKLDRQYTNQS------SAVSVLSQG-SYSNL-SKFMTH-DGKLN
LEMPTDPSEIEYLYQEIMIKRNILQSLPGTKQDELMSYDIGKKWLIVKQDLQNEWKKFKS
--KGAKASHSIGPDNNNNNNNNYNNHLILGSPSKSNNMISPKS-----------------
-------------------------NLNNFESPSSSLSASTQTTTNNYKQY-NNKPSKRS
ASNISQPKSTTEVYS-NSHSNSSNTTLT-DKTNRLPIEYVKKIISDTLTSEEMKDLWVTL
RTEQLDWVDAFIEHQGHIAMANVLMKSIYK-TTPNEK---LTSQLLEKENSFFKCFRVLS
MLSQGLREFT---KHELMAQTIARGLFSTTLSTRKMATEIFVCMLNKK----NPE-RFKV
I---LNVLDQKFKIGQNLHMAHNLKKFGEYFGPLTLDSNL-----------KVTRAWLFA
VEHSLDGRGKMGSFVGASDDYKNSGGENATLEYCQWSMIFINHLCLCSDNINQRMLLRNK
LEYCGIVRIMNQIKSLHYEKVIEQIDVYENSKLDDINKLLELSNKNANINLHDPTSLVKN
LWDACKGTENEKLLISLVQHLFLSSSQLIEDKQD-ATQLSKQLKLMDSLVTNV--SVAST
-DQESTMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEESQAEIDLLSQKLKNAEHGLV
GQLQDELRQRDRMFAKNQRITEQLQAELEDLKKKHLLEKHEQEVELRKMLTILNARSDKG
E----IEKKSSKKHKRIPGSFE-SSKKQNIQKVLQEGLNRTKKDFTMDSKS----FGMTV
QPNKRLKALRMQMEDIENEARELEMTNFAEFEKKKLEPAPKIKKLKQKKQNKNEKKEEDD
K--------------IKKLNELRQTLANIQNESNDISKFNVEERVNELFNEKRSTALQRL
KELETKYKDFGINFNIDDISE------KTTGIDNSGDKSTEYSS----------LDPNAY
QIKLDELNRITEQLLDAQAKLN---------------------------EKNLKDSSNKS
TFSESSSSSSSSSSSSSSSSSSDEEEIDDIKSRDRQS---------------EISAQSTS
SAAGSFLEALSQKYAMGQ-------NNP----SSPQRDR----------------PVKAS
QYDFINRVRKNNITP--------QFLEELSGKVV-----PPSSGLSTTTKVVDVTSGGKS
ETATENVLENTTEPVTEH-----------------SFRNAVLSNDKIDREENDTVISTTE
PTEKIGFNAEEKSAVAAPPPAPPLPAIL--------EGRSEEEDRSTANTNISKTSVS--
-PVPPPPPPPPPPPPLGLFGFNSNIPKLADTEP---LKQSASSPALSSPAP---------
---PPPPP----PPP------------PAPPML-PTNGP-KKVLSSPLLPQSPSLFENYP
RPHKKLKQLHWEKVEATDNSIWRANKAEQFADDLYEKGVLSELENAFAAREIKSLASKQK
KDLQKITFLSHDVSQQFGINLHMYASLDVPDLITKILKCDRDFLQTPSVIEFLSRPEIVD
VSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPNELQRADQI-YLQLMVNLQSYWGSRMRA
LKVITTFEKEYNELLTKLRKVDRAVSSLQESENLKNVFGVILAVGNYMNDTSKQAQGFKL
ATLQRLTFIKDSTNTMTFLNYVEKIVRTNYPAFNKFLVELEPVLDVVKISIEQLVDDCKE
FSQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVLPSLPDARKKGELLGDEVKLTIMEFLR
LMQIYGEDSGDKFAKNSFFKKFADFITEYKKAQTQNLRLEEEEKVYERHKKMVEEQQRKA
QEAEISRVNSGTDGT---KDDEDGPGDG----RAIMDTLLEQLKNVTPTNKTDPSSARKR
ALVRKKLMGE--STSNILKDIDTEDD----------------SIIYSPDA-----KKPMA
TTVDMANTTLESELDVSSPTR------------------HNSSPIKNEISMNVD--EEEE
EIGNRAQALLIQLTGS-HSPTKRHSLLNEHKERLRARRRRT----TNE---FVSGKLQFV
GEDETIVNTNENMNNNETDSENTPTETTIIPP------------------------GSAD
TETTSLEQPATTTDVSLNKDDVKGVDDHNSNDNDE-------------------------
-----
>NCAS0A00590
------------------------------------------------------------
------------------------------MMVRNSSS-KSSTSNNNSS-----------
ASTGSSIFQNLRRLTNPSSNHTNK----------------------SPSGSSP---RTSY
SPERDSTTTRESHT---NSLKPLNKKTSLNTQNLSQYINDKH------------------
-----------SPQHTRSASVQ--S----SSK--YSY-SRRSSSQTL-------------
-----------GSTLNQIARQHTNQ-------SSASILSQG-SFTNL-SKFIAP-DGKIN
LEMPRDPNEVEVLFEDIMLKRNILQSLPTDKQNELMSYDLEKKWLIVKQDLQNEMKKMRL
-------------KTNSTNTNNNNNNNRSSMSPENSSTINLNS-----------------
-------------------------PATMQMSPHHHIGSNSNSSINSHHTP--ITISKRP
TGPISNPIPNADMYK-LSMRNTSSSSMS-DKTNRPPIHYVKRIIADTITSEEMKDLWVTL
RTEQIDWVDAFIEHQGHIAMANILMKSLYK-TSSDGT---PNPQLLEKENAFFKCFRVLS
MLSQGLREFT---RHEIMSQTVARGLFSITLSTRRMATEIFVCMLEKK----NPE-RFKV
I---LNALDQKFKIGYNAHMTQNIKMFPDYFTHLTLDSQL-----------KVTQAWLFA
VEHTLDGRGKMGSLVGASDDFKNSGGENAILEYCQWSMIFINHLCSCSSNINQRMLLRTK
LENCGILRIMNKVKTLDYDKVIEQIDLYENNKLDDLNTLLESNNKNANINLQDPTSMLRN
LWDACKGTENEKLLISLMQHLFLSSSQFIEEKKD-PVKLSRQLKLLDSLVTNV--SVSST
-DQEASMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEEVQAERDLLSQKLKNAEHGLV
GQLQDELAQRDRILSKNQRVMEQLQGELEELKKKHLLEKHEQEVELRKMLTILNARPEIV
E----GNGTSKKTKAKNPSALD-PSKKQSIQQALQDGLSRTKKDYSVDARN----FGMTI
QPNKRLKLLRMQMEDIENEARELEMTNFTEYEKRKLEAPSKIKKPKKVATKKEIDPS---
---------------INKLNDLRQTLAEIQMESNDISKFNVDERVNELFNQKRITALKRL
QDLETKYKDFGIDFNIDELVD----SASKDENGNN-QQSGDYSS----------LDPKAY
QRKLDELNRLTDELLRVKNKVN-----------------------------------ASD
NNLSSRRPSASSSSESASSSSDSDDGESLIERQDTQS-----------------NFSGTS
AGPGSFLEALTQKYATGQ-------------KSASPRDQ----------------STRMK
DNIFINRIKQTNVAP--------PFLDELTDKVA---EAPPVEASLAEPDNNNTINESSK
EETGEANLTSSDNE---------------------VVAQASLSNPEVSPKHDNNSVKDVN
ESDDKAEVSAKDTSADSQPPPPPPPPLPDFF--------TNEQKNSSSET----------
-----SIPLPSPPLPEKLFENAGAHPL----KH---LRQSASSPALNSALP---------
---PPPPP----PPP------------PP---L-PTDGPRKKVIASPLLPQSASLFENYP
RPQKKLKQLHWEKLDATDNSIWKTNKAEKFADDLYEKGVLTDLEKAFAAREIKSLASKKK
EDLDKISFLSRDISQQFGINLHMYANLPVDDVVKKILKCDRDFLHTPSVIEFLSKPEIVE
VSVNLARNYAPYSTDWEGVKSVEDAKAPEKDPNELQRADQL-YLQLIINLQSYWGSRMRA
LTVITTFDKEYNELLTKLRKVDKAVSSLQESENLKNVFNVILAVGNYMNDTSKQAQGFKL
ATLQRLTFIKDSTNSMTFLNYVEKIVRSNYPSFNDFLTELEPVLDVVKISIEQLVSDCKE
FSQSIVNVERSVEFGNLSDSSKFHPQDRVLAKVLPILPDARKKGELLGDEVKLTIMEFLR
LMQIYGEDSEDKFAKNSFFKKFADFITEYKKAQNQNIKAEEEEQVYERHKKMVEDQQKKL
QEQENGSNGS--------ENGEEGSGDDSGDRRAMMDKLLDQLKNAGPS-KTDPSSARKR
ALVRKKLMTE---STALLKDIETEDD----------------SIIYSPEG-----KNPFV
NPVDLDTPHDESEMDVSSSPIQ-----------------RSLSPSRNSTLLS----DDQD
EVTDRAKALLMELRGS-NTPSKRNSLLDEHKEKLRARRRKT----NSD--LHSGTRLQFV
GETVPEKEVEPIT-------------------------------------------GEPD
GTSTELEETSNLSSENQQKVDVESIEDEKADEPHTADST---------------------
-----
>ZYRO0F16676g
------------------------------------------------------------
-------------------------------MIRSSGS-KNNNNNNHG-SNSNT------
SSSGSGLIQGLKRLANPQSSSSAAASPTP----------PSNQRIETGDISSP---KKVS
VP------SRVTNA---NDLRPLN-------HHYNHHHN---------------------
------------HHHSRTPSQQ-ST----GSK--YTY-PKRTSSSITGGNPSLPSSSATP
I--------PAPVTPGQLSRQQTNHSHANSQSSAASVLSQG-SLTNL-GRFMRP-DGKVR
LDMPQDYHEVESLFEDIMYKRNIMQTLPPEKQQELRNYDIDKKWLIVRQDLSSDLKKMMA
----------------------KSSSSATQASANTTDLSLTNT-----------------
-------------------------ISSHDYSDATSIRHMKTNASSKSLNS---------
-----------NLYS-NANANSSNTTVNTEKINRPPTYYVKKIIADDLTIDELNDLWVTL
RTEQLDWVDAFLEHQGHIAMANVLMKSLYK-TTQEVK---LTEKSLEREASYFKCFRVLV
MLAQGLYEFT---KHAIMAETVAYALFSIRLPTRKMATEIFVCMLEKK----NKS-RFDV
I---LTALDKKFMIGENLHMMQFVKNSPQQFIHLKRDSQF-----------KIVQAWLTG
LETALQGRGKMGSLVGASEEVRAAGGENSILEYSQWTMVFINHLCMGTDVVNQRVLLRTR
LENAGALRIMNRFKLLDYDKITAQIEYYENGKLDDINNLLESEGRNTQVNMQDPMMMLQT
MWDYCKGTENEKTFISLIKHLFLSSSKVADDRGD-PSKLAKQLKLMDSLVANV--SVSAV
-DEESSVNVAIQRLYDAMQTDEVARRAILESRQLTKELEEIQAERDFLRQKLNSTGDGIV
GRLEEELKQRDDILAKNQRVNRHLQAELEELKKKHLLEKHEHEVELRKMLTILNARPDD-
-----ENLAKSTKVTKSVNGLD-PDRQTSIQKALQDGLQRTRKDLSVDSKR----FGITV
QPNKRLRMLRMKMEGIEQEARELEMTNFAEHEEKQLEEPVGTGTKKKAG-----------
---------------VRKLSELRKQLSDIQKETNEVTKFNVEERVKELFNQKRLKALKRL
KELETTYKGFGIDFNANALLE--------SKGGDIHWNDDEIDG----------QDLQGA
QEKMDEMDRIANELTAMKMKVE--------------------------------------
----IQNQQQHTDSSSTESSSEDDDGATGSRT-DTAS---------------EFSQKSFG
SGAGSFLEALSQKYGAGQ-------NTT--ISNSPFPGV-------DR-------KSSNH
RTSFANRMKKSNAT---------PYFDELTRKVA---KAPSLNDPSSPGSNEPGDDDTLP
ATSPTVPQSINDTV---------------------SKDKNSTSSPEAPPTLDP-------
-----------GSVHSDERAPPPPPPLPSMLFG------EKAPQHGTGA-----------
----PAPPPPPPPPPLPIFNQASV-------KG---STAIPPPPLPPALGG--SN-----
---SPTPS----PTP------------PPPPLFAGQKKMYRSDM-SNYLEETPTFRDNYP
QPHKKLKQLHWEKLDATEDSIWSSGVAEKFAGDLYEKGVLAGLEKAFAAREIKNLATKKK
EDLKKITFLSHDFSQQFGINLHMYSHMSVNDLVIKILKCDRDFMQTPSVIEFLSKSEITE
VSVNLARNFSPYSTDWDGIKSLEDAKPPEKDPNDLQRADQI-YLQLIFNLQAYWGSRMRA
IKVITSYDKEYLELVTKLRKVDKAVGAILKSENLSNIFNVILAVGNFMNDTAKRAQGFKL
STLQRLTFIKDTNNSMTFLNYVEKIIRGNYPSFNDFLKELEPVLNVTKISIDQLVNDCNE
YCQAVTNVERSIEIGNLSDSSKFHPLDRVLIKVLPVLPEARKKCDLLDDEVRLSIMEFEN
LMQKYGEDTGDKFAKNSFFKKFADFVQEYKKAQNQNLKVEEEERVYERHKKMVEEQQRRE
QTPSKNRDYVV-------NEDEDIADDDDQDRRAMMDKLLDQLKNAGPT-TSDPSSARKR
ALMRRKLQADKDAAAHLISDLDSNED----------------SIVYSPNA-----SQDQS
ANAEEASPTVHKGSNKNNKPVLS----------------DLESPIKASRNADRNNENEEE
EISDKAKNLLMELSGN-GAPTRREELLNGHKERLRARRRRT----QGHGELISSNKLAFL
DDETPPVTPTDSEFNRDALSSSHSSHRETPDSGGRSATVTPNRHFEEQQQQYHHQQHQSD
GSLNNLKFETRTQDASYTSPPIYEDTMRDDARDDSRDDSASFKDVLESVAPEDAGSTEEE
AREQR
>TDEL0C06190
------------------------------------------------------------
-------------------------------MLKGSHS-KGSQGNG---SDSRD------
SNTGSGLLSNLKRFAGSSGSQSGS------------------QRIETSDISSP---RKVS
VP------SRVSNA---NDLRPLNKKSTMNTQNLSHYMNGKSSAESL-------------
-----------SSNHSRSPSVQ--S----STK--YTY-SRRSSSHLS-------------
----------TPGVNSTLTREPTNQSL-----SSSSVLSQD-SFSNL-AIFMTP-DGKIK
LDMPSS-HEVENLFEDMMYKRNILQNLSPDKQKELMDYDVDKKWLIVKQDLQNDFKKLLA
-------------KGVPAAHAAISSSNSDSLPSSLKVSSPRSS-----------------
-------------------------MTYESIQQAIKFNKTNNGSSSGPASN---------
--------NKSKLQQ-LSDKNSSTSTLTTEKINRPPIHYVKRIIADKLTGNEMNDLWVTL
RTEQLDWVDGFLEHQGHIAMANVLTTSIYK-TDPETP---LSYDLLEKEHAFFRCFRVLS
VLTQGLYELS---RHNIMAETVANGLFSVRLATRKMATEIFVCMLEKK----NKV-RFEA
V---LNALDKKFKIGENLHMLHYMKNSPQHFSHFTRDSQF-----------KIVQSWLFA
VEQSLEGRGKMGSLVGASEDFKASGGENAILEYSQWTMVFINHFCNGTDVINQRILLRTR
LENAGGLRIMNQFKLLDYDKVMELVEAYENLKLDDLNSVLETGAHASDIDMNDSASLLKK
LFDYCKGTESEKLLNSLVKHLFLSTSRLMEDNQD-PTKLSKQLRLMDSLVTNV--SVSAV
-DESSSINMAIQRLYDSMQTDEVARRAILESRTLTKKLEEAQAERDFLSQKLSKTGNGLV
GQLEKEVQQRDDILEKNQRVTLQLQDELEELKKKHLLEKHEHEVELRKMLTILNSRPEGD
-----LSRKGSVHSKAQPGILD-PDKKSTIQQALQDGLLKTKKDLSVDSKR----FGITV
QPNKRLKMLRLQMEDIEQEARELEMTNFADHNKAVLQAPVKVESSNYVRKENELRAKELK
---------------ANKLSELRKALADIQKESNGVSKFNVEERVNELFKQKKLSALDRL
NDLENMYKEYGIDLSTHFPIQ----DEPQESAESE-KNAEGPST----------LDPRAY
QAKLDEIDRISKELIEMKSELK--------------------------------------
----NDKALRRHESPSKQDTDDDEIQDTGSMVNEDLQ----------------------S
SGTSSFLESLSQKYGTGK-------NATNMLTNDILNSS------E---------RKGHS
RQSFMERMKKPSGVP--------AYLEELPLKVP---KAPPLGVAETEDSSDNIAEDVEK
ESAEHD-----------------------------EQEENSGKPDVASQKVPQ-------
------------ESGKAGTPHPVPPPMPDML--------KKGPETST-------------
-----APPPPPPPPPPPMFAQARN-------SG---PIPPPPPPPPPSLTP--STSE---
---AAKLS----PPP------------PPPPLL-GQKMAYRTAVPSPLLPQSPSLFSSYP
RARKKLKQLHWEKLDATDNSIWSSGKAEKFAGDLYEKGVLEDLEKAFAAREIKSLATKKR
EDLDKITFLSRDVSQQFGINLHMYSQLSVEELVTKILKCERDFMDTPSVLEFLSKPEIIE
VSTNLARNYSPYSTDWDGVSKVEDAKSPEKDPAELQRADQL-YLQLIYNLQPYWGSRMRA
LRVITSYEREYSELVTKLRKVDKAVAVIQKSTNLRNVFNVILAVGNYMNDSAKQAQGFKL
STLQRLTFIKDANNSMTFLNYVEKIVRDNYPSFNDFLEDLQPVLDVVKISIEQLISDCKE
FSQSITNVERSIDIGNLNDSSKFHPLDKVLVKVLPVLPEASKRVELLDEEVKLSIMEFES
LMQRYGEDSADKFAKNSFFKKFADFINEYKRAQAQNLKAEEEERLYQTHKKMVEEQQKRA
E-EKERSENAT-------EEDASEENED---RRAMMDKLLEQLKNAGPV-KADPLSARKR
AMIRKKMLNDSEAVSDVLDSIQQEDD----------------SMIYSPEK----------
-QEGITNPTGD----------------------------SSQSPSKGAANNQ----QDEE
EITDRAKALLMGLRGG-ESPSKRNNVLNGHKEKLRARRRKT----NTD--MSPEGSFLFN
EEVRGTISSADTDYSNE---------------------------------------QQSN
SEANTLTKSIRSTLTEENDDPE--------------------------------------
-----
>KLLA0C02321g
------------------------------------------------------------
-------------------------------MQRSQSS-RGPTGNENSHSRSLS------
NSQGSSLFSNLKKLATGGNHGSSQ-----------------PSQTRKELISSP---KRVF
TT---ASLESATPI---GGSKPLNKISSLNTHNLSHYTMD--------------------
-----------PEANSRSQSASLLTS---PTK--YSY-SRRSSQ----------------
-----------------LTRSSTNKSI---ISSSAVSVSSN-STSIL-NRFLTN-DGTLK
LDRPENPEEINGLFMDLLIKRNVFDSVSSQDQKDMLNYPIEKKWLMVKQDLQSEFKRLKS
------------------------------------------------------------
--------------------------TKPRFSANDTQNMLKRKTSTSKLNT---------
------------QYEGMLHTNESQGSLL-SPSHFPPEYYVRQIISKKIKNKELNDLWVSL
RTEPLDWVISFLEAQGQVAIANLIITSMHQ-DTTDNQNAVTDPQFLERETALFKCLRVLL
NIRECLEEAV---NSTLVTNALVEGLLSTKIPTRRLATETLIYLVTKDEDFKSRTAGLDC
FSLVMESLNHETSLVQNIHMKAKFSTNDSTDPESNPQLYQ---------VCKILQQWLYV
VEQTLDGRGKMGSLVGASDEYRNNTGENSIYEYLVDSIVLIDQLCLNNEDVKKRHMMRTQ
LKSFGLNRILQKMQLLDYPPLSTMLLQFEDAAIDDYNSLIDSQKFTENVDMDDPVSILQK
LTSSFKGTEAESYLLSMLQNLFLSSNKNAQESDD-PGKNVQQLKLIDSLISNV--AITTL
-DSESNFNVAIQRLYDSMQTDEIARRAILESRELTKKLEEVKAERDYLNDKISKAENGLV
GQLQKELAERDLILDKTQRVTEQLQSELEELKKRHLLEKHEHEIELRKMLTIVNSKTS--
-----DDLESGSTVQNDPKPLN-PERKTAIQNVLQRSLQKTEQDLLNESRR----LGTAV
GSKSRLKLLRSKMEDIENQARELEMTNFADVK------PKQNQKFKEQVKGQQ-------
---------------ATKLAELRKKLAIIQNESNDITKFNIEARVNELFQDKKLAALDRL
KDLENKYNGFHIDFADDPELK-----------ELLTQSSNGGPS----------LDPTIV
QRKVEEMNSIIDELNALKEEMK--------------------------------------
----NRPKTGSSSSSSSSLSSASSSSEDGSSQSQASH------------------GSDIV
SNGSSFLESLSQKYSTGQ--------QTATSTNGGRVGR----ETRYP-------GSGYH
RKSFLNRLKNTTVNPTATSEHLPPFLTELKSKVK----MTDDIDDVPVGIGISVSPGASL
KSTEKPVSQFTEKPIL-------------------TDAQQGSDKISNVILNDKYSPTTMQ
SEIGDSESIEANPTTTIVSAASPPPP----------------------------------
-----PPPPPPPPLPVSLGG----------------TLTAVPSPLPTALSP--GI-----
---APPPP----PPP------------PPPPPF-PSANTPKATVTSPLLPQSPSLFERYP
RPKKKLKQLHWEKIDNAGDSIWKNAQAEKVADDLFERGVLSQLEKAFAARETKSLKGKSK
EANEKITFLSRDVSQQFGINLHMFSNLDVKDVVGKVMKCDREFLSTPSVIEFLSKPTIIE
VTNNLARYFNPYSTDWEGVTSVDDAKPPEKDPNELQRADQL-YVEFMINLQPYWGSRMRA
ITMITTYEKDYSDLVTKLRKIDRAVQCIEQSESLRHVFDVILAVGNYMNDSSKQAQGFKL
STLQRLTFIKDEKNSMTFLNYVEKIIRENYPEYSHFVEELEPIFSVTKISIEQLVTDCKE
FSQSVINVERSIEIGNLSDPSKFHPLDRVLNKVVPVLPEARKKADLLSDEIKLSLLEFEN
LMKKFGEDANDKFSKNSFFQKFADFITEFKKAKTHNVKLEEEERAYERRKKMIEDQQRKQ
QEADSKATAKN-------LSTSQEPSDD----RDDIEKLLDKLKNAAPS-KGDPSSTRKR
ALARKKLLDGK-SGASIFDNITADST----------------IEAFVEQN----------
-RTLTESPTAKK---------------------------SASLPETESLS------SSKQ
DPADRARNLLLELRGP-DERKDASPSPIKAKDKLRDLKKKD----SSVKVDQP-NKLQFV
GS------------------------------------------------------LEVG
PHPKPLSPTQDLMDTSNSSEDEFIDA----------------------------------
-----
>AFR669W
------------------------------------------------------------
-------------------------------MKKSTHSNKHSKTQHAGQVAGATHANG--
GHSGGGLFSNLMKLTGSSGS----------------------QRIATSDISSP---KKVT
LP-------SNLDL---SGAKPLNKLNTINASNLPQVSG---------------------
-----------EVTQARSASGAALSS---PSK--YSY-SKRSSQWASSKQANHPEHDQQY
PQHLNHLFVQPHPHHSALTRQMTNQSN-----YSASSYT---SLSLL-HKATDI-DGTLT
LEKPEDPQEIEELYQELLQKRNIPQSVSVHGHRELMSYGIDKKWLMVKQDLQTEYKKMKN
-----------------------------SMPPSSTVESIASS-----------------
-------------------------ALAKSPGGSISSGSITRSISQNSAKP---------
------------------------MAVAYEPAHLSPDHYVRKIISDRVTAQELNDLWISL
RTESIDWVIGFIDAQGQVAIANRLLKFVQR-ESLDIL---HDYDALEKENAYYKCLRVLT
NLREGMQEAL---KSKLVISSVVEGLLSSRLSTRRVATETLLYMLSDDELKTADT-GQDA
IFPLLVALDQESKFAANIHLRGRLHETNKRKSLPTGRADFHV-------VAKRLEQWLYV
IEYTLDGRGRMGSLVGASDDYK--GGENTVLEYLLYSMILLNLLCSNHPDVQQRNLLRSR
LKSYGLARIIKKMELLKYPALENEVRKFEDATLDDYNLLMTSTTVDSAVDMKDPAALWQD
FWTQHRGTEAEGHLLSLLQHLFLWS-RAFAEYRD-PAESIKQLKLLDALVTNV--TFSSI
-DTESGFNGAIQRLYDAMQTDEVARRAILESRELTKKYEEIKAERDNLASKLSQAQNGLV
GQLQSEVEQLERILEKSNRVTDQLKGELHALKKKHLLEKHEHEVELRKMLTILNSKPHG-
-----ENGGSPEVNTSTPSPLK-PEKKMAIQKALQDRLRQTEKDLTRDSKR----LNTVP
APNRRLKMLRSKMDIIEKEARLLEMTNFADFKKE----PEEENEPKLLSPPKIQRSLRGE
Q--------------VKELAALRKRLAIIQQESNEVSKFNVEERVNELFYEKKNKALDRL
RDLENKYKGFGIDFNEDPELMSLRLANGSVDLDGPTIDLESSAP----------LDPAHL
DAKIEEMTKILDRLNKLKKDID------MSSVGTSTSNESASISTEELAGNNSSHSEISC
TSPHSLSKPSISSTTGGSDAETAADAADDISDNDDET-----------SSSMIVTGAEAI
ISNASFLETLSQKYGTGS-----QSGAASVSSSEHMRGV----VNVKRRTSQNSINSGNH
RKSFVNRMKRTITPTSS------NFLEELTQKVS-----PARSQSARSSRGSATTPQSIK
SDAADIFTAGQDKTAVVSGNSANGSDATEP-----SEIFDESRNEPLKEGTPSAPIIGTS
AIGTDAKDVQAAPPPPPPPPPPPPPPIPPMF-----ANTTSSTEQVTASIQVGGAAPPPP
PPPPPPPPPPPPPLPSSLTG----------------KRTVDTSVGTEDMTE--NTESS--
---SGTFP----PPP------------PPLPQL-GRSKTY-GGSPSPLLPQSPSLFERYP
RPKKKLKQLHWEKIDDPDNSIWENARAEKFADDLYEKGVLSELEKAFAAREIKSFKGRKK
DENNKITFLSRDISQQFGINLHMYSSLPVSAVVSKILKCDKDFLSTQSAIEFLSKPEIVE
VSTNMARSFAPYTTDWEGVSSVEDAKSPEKDPSELQRSDQL-FLNLIVNLQSYWSSRMRG
LKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDTSKQAQGFKL
STLQRLTFIKDEKNSMTFLNYVERIVSQNYPSFNSFLQELEPVLQVVKISIEQLANDCNE
FCSTVTNVERSLEIGNLSDSSKFHPDDRVLAKVLPILPEARKKANLLADEVQLSLMEFEN
LMRMFGEDADDKFAKNSFFKKFADFILEYKRAQEFNRKIDEEERAYERRKLMIQEQQRRA
KLVQEGDETTCAR-----LSAISASGDD----RDVMDKLLEKLKNAGPS-KGDPSSARKR
ALARKKLMGGRE-GSIILEGLDVDD-----------------LQSAAPDV-----QPDTP
LRAASASPPP-------------------------------------------------D
PAADRARHLLLELRNG-EHPESRKSMLDEHK-----------------------------
------------------------------------------------------------
------------------------------------------------------------
-----
>Ecym_1086
------------------------------------------------------------
-------------------------------MKRSTHSNKSSKGQHSHFSNGHGGTNTPI
NGGGGGLFSNLMKLTGSSSALSQQ-------------------RIATSDISSP---KKVS
IP-------SSLDL---STAKPLSKHSTLNTSSLSQYAD---------------------
-----------EIAQSRTPSGP--VSLGSPSK--YSY-SKRSSQWSGGNSN---KQLLLL
P--------QPQHSQHTLSRQPTNQSN-----NSDNSFS---SVTLL-QKITDS-DGNLS
LEKPKYPQEIEELYQELLQKRNILNSVSVHSHRELMGYDLDKKWLMVKQDLQAELKRMKN
--------------------------------------NVPQS-----------------
-------------------------TVADPLSNSVHLKSPRGSFSSSNMSA---------
--------------RSISQNSAKQLAVSYDPSHLSPDHYVRKIISDRITAYELNDLWVSL
RTESIDWVIGFIDAQGQVAIANRLIKFAQR-ESLESL---LDSDLLEKETAYYKCLRVLT
NLREGMQAAL---SSKLVISAVVEGLLSIRLTTRRIATETLLYMLTDDELKTADT-DFDA
IFPVLHALDQESKYSSSIHLRGRLHETNKRRSLPTGRADLHV-------IAKKIEQWLYV
LEYTLDGRGRMGSLVGASEDYKN--GENTVLEYLLYSMILINLLCSSHPDLHQRNLLRSR
LKSYGLSRVIKKMELLKYPALENEVSKFEDRTLDDYNSLMASSTVDSSVDMKDPESLWNN
FWTRHKGTESEAHLLSLMQHLFLWSSKAFSESTD-PAEGSKQLKLLDALVSNV--TFSSI
-DTESGFNGAIQRLYDAMQTDEVARRAILESRELTKKCEEMKAERDHLQTKLAQAQDGLV
GQLQGEVQQLQRILEKSNRVTDQLKADLHDLKKKHLLEKHEHEVELRKMLTILNSKPNDA
SN---DAVSPDGINNKTPSPLK-PEKKMAIQKALQDRLRQTEKDLTRDSRR----FGTVP
APNRRLKMLRSKMDDIEKEALMLEMTNFAEFKKE----TKVEDLPRLQSPPKIERNVRSE
K--------------VKELAALRQRLAVIQQESNEISKFNVEERVNELFYEKKTKALDRL
RDLEEKYRSFGIDFNMESELL----IETDREGDGDASVGEASNSTAPNSLDSCVLDPARL
DAKIEEMTKILEELNRLKCQVDPTTANSGADISTSISTDDFNIDNTSLPSTVVEGSPSSY
FKKASLSTFASSSFSTDAEDELSAETAEDSNKNNEDSVVGEHGVSPSGSVAMERSDSILT
TSNTSFLESLSQKYGTGTNLQPAEDGAKRLSSSSAFRAG----DSSQR-------NSGYH
RKSFVNRMKKNSTPKSS------SFVDEVSQKMT-----PVHVAQSPDSLQNTATSSSTP
QSAKSEDAVGIGIFSKGTNTGMA------------VDTANDGQTPWIENGEDS-----IS
PMSPSKRNSKSKNVSKGVSKAPLPPPLPPMF-----VNNNNNNNNNNNNNNDNNNNNREG
ISLSTAPLPPAPALPANLFGNTSLPPTPTVQDDDHENESIPLAPPQPPVFRNISAETKPG
AAPGGPPP----PPP------------PPPPQL-GRTKKYKGSSPSPLLPQSPSLFEKYP
RPKKRLKQLHWEKIDDLDNSIWENARAEKFADDLYERGVLTELEKAFAAREIKSLISRKK
DE-NKVTFLSRDISQQFGINLHMYSSLTVDQIVTKILKCDKDFLNTQSAIEFLSKHEIVE
VSINMARCFAPYTTDWEGVSSVEEAKQPEKDPNELQRADQL-YLDLIVNLQSYWNSRMRA
LKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDSSKQAQGFKL
STLQRLTFIKDEKNSMTFLNYVEKIVRTNYPGFDVFLQELEPVLQVVKISIEQLANDCGE
FCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKVLPVLPEARKRANLLADEVQLSLMEFES
LMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQEFNKKMEEEERAYERRKIMIEEQQKRA
RKNIQIDTSFSRRGSSLSTSSISASGDD----RDVMDRLLEKLKNAGPS-KADPSSARKR
ALARKKLMDGKKSGSIILDGLDVEELANIQSDGLDDQSDSNPAILGSPTS-----TVGAT
ADVEGLNPDHDLPSAPISAEKG-----------------SVSSALSHSSESPSKKILDED
AVTHRARNLLQELRSSDDHTEDRKSLLDEHKEKVRQRRNKKLIEESGGNNTSNEVMEAVR
STENHESTPNFKSVSPNNDI------------------------------------PITT
PSAIHTLRTGSTPSTDETSEDDLNDKYVDADT----------------------------
-----
>SAKL0C02618g
------------------------------------------------------------
-------------------------------MNRSSNS-GSRRTSHNHSSSN--------
SSGSGGLFSNLKKLTGSGNNANTS------------------NKIEPSDISSP---KIVS
TP--------AVPE---FSGKPLSKQTTLNTQNLSSYVDMN-------------------
-----------TPHHNRSPSGMSGS----PTK--YSY-SRRSSQWSN-------------
--------GNNIGNGGRLSRQQTNQSL-----SSASIFSQG-SMTNL-TKFMGA-DGKVK
LDRPSNPQEIEDLFAELMHKRNFFQSLPAAGQKELMNYDLDKKWLLVKQDLQSELKKLAN
------------------------KKNTHVAPAGAAGLAATIS-----------------
-------------------------AATQGTSGAGGVGGVDGTQAGSKGHN---------
-STSSPILGGGGFYE-SGNQNSSTATLSQDPLHLSPDYYVRKIISDKISTKQLKDLWVSL
RTEQLDWVVGFLDAQGQVAIANVLLRFFHK-ESPDAL---LNDEALDKEFAFFKCLKTLL
NLKEGANEAV---RTKLVVSAITDGLLSLRISTRRIASEMLVFITQWD----IPY-GLNQ
V---IGELDQESHVSSNVHLQARLLSANKRDSLLAQDHEL---DLTRDHASKKFEQWLFV
VEYTLDGRGKMGSLVGASEDFKSAGGENAILEYGYLTLLLVNQLCNTPADVNQRTLLRSR
FKSCGLSRIMQKLELLNYDKIDEQLRIFEDRTADDYNTIMASKSINHNVDMENPLSLLQN
LWESYKGTGAEKYLVSLVQHLFIASSKVQDEGDD-PTEASKQLKLIDSLVSNV--TMSSI
-DTESSFNGAIQRLYDSMQTDEVARRAIMEARELTRKFEEVKAERDYLGEKLSKAEGGLV
GQLQNELSQRDRILEKNQRVTEQLQADLEELKKKHLLEKHEHEVELRKLLTILNSRPQGS
SAV--QEEEAGTASSSAPGVLH-ADRKLAIQKALQDRLQQTKKDLTKESKRLGTTLGTTL
EPNRRLKLLRSRMEDIENEARELEMTNFADIQRQTVEEQTVVPALPPPAVPVLDRAPKAK
KQVKEDQ--------VRKLRELRQRLASVQKESNDVSKFNVEERINELFNDKKLSALDRL
KELETKYKGFGIDFQADPELSAM--LSDAPPENHHAKDGQAHPS----------LDPKHL
SRKIEEMSKIVDELTAFKKEIE--------------------------------------
--------NGPPSSSSSSSDEELEQDDRASIHSGNAS-----------------------
--TGSFLETLSQKYGTGQ-------NAGPTASSRAMVGR----ESNYP-------GRGYH
RRSFMERVKKSDAA---------PFLSELTQKVA---PKTPIDGAYEIEVGARSEEEHIG
IGIPSKRNGTVVEGMK-------------------DADNSGVSNAEVAPGESF----AAS
AAAPASAAAPATAAAPATAAAPAAPPMPSML--------KKDPSAEPSATG---------
-ATAAPPPPPPPPL--DLFAKNGLAAVS---PT---SAPPPPPPPPPAFLS--KGPPANG
TTPLAPPP----PPP------------PPPPLG-GPKAMYRAATPSPLLPQSPSLFERYP
RPKKKLKQLHWEKIEDTGNSIWKDAKAEKYADDLYERGVLAQLEKAFAAREIKLLANRRK
EDLNKVTFLSRDVSQQFGINLHMYAALSVKEVVHKILRCDKDFLGSASVIDFLLKPEIVE
VSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQRADQL-YLEMMVNLQGYWASRMRA
LKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRSVFEVILAVGNYMNDSSKQAHGFKL
ATLQRLTFIKDEKNSMTFLNYVEKIIRENYAEFNSFLQELEPVLDVVKISVEQLAADCRE
FSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPVLPEARKRSDLLSDEVKLTLMEFDG
LMQMFGEDASDKFAKNSFFKKFADFIQEYKKAQAHNIKMEEEERAYERRKKMVEEQHKRA
RLEAEKGGVDDGSEA---EGVTAVSRGE----RDVMDKLLEKLKNAGPG-KSDPSSARKR
ALARKKLLDGKRSSANILDNFEVDEAAPVNQ-----------SLVYSPET-----TLKAA
NAAHAESPTPKASRQGSVAGSG-----------------ATATPLLESPSKQAS--AGPE
DVADRARNLLKELRGP--ESEKRKPLLEDHREKMRARRRRV----NEG--ASSENKLVFV
GGASEAPTDSHKGLPNDTTADIPATPVSADDEPGS---------------------GRAG
DHDQALNAQEKGGSARDSDGDSDGSEFVDA------------------------------
-----
>KLTH0F02376g
------------------------------------------------------------
-------------------------------MNRSSNS-KSSKAPHNRSASS--------
SSGNGGIFSNLKRLTTGSGNSSVS---------------HNTQKLDISDISSP---KKIN
LP--------DTGE---FSHKPLSKQSTLNMASLSAYTDA--------------------
-----------VGAHNRSASNASVGS---PTK--YSY-SRRASQWSN-------------
N--------NSAVSGSKLSRQQTNQSM-----SSASIFSQG-SFSNL-SKFVGP-DGAVR
LERPRDPKEIEELFEEVLYKRNVYQSLPASAQRELNNYDLEKKWLMVRQDLQSEVKKFMN
----------------------SKNASKSSTVVGGSSSAVPDS-----------------
-------------------------PSASNFTSSTSPNGSFTGLSRPKIST---------
----SSVNTSEQFYS-SNLGTSSTTTLSQDPSHLSPDYYVRKIICNDISAKRLNDLWVSL
RTEQLDWVQGFLEAQGQVAIANVILKTCYR-ESPDNL---LGDEVLDKEFAYFKCLKTSL
NLREGADEAVMSNSARIIVSAIVEGLLSLRVATRRVASELLISLSQWS----LPH-GFNH
V---MDALDQESRFCDNVHLQARLITQSASKDPKKGSSIAPTPDGDGDRVMRKFEQWMLV
VEYTLDGRGKMGSLVGASEDFRTSGGENAIMEYAYLTLLLINHLCQTPVDVKQRTVLRAR
LKNAGLPRILNKMKLLNYEKVDEQLARFDDSTTDDFDALYSQESTGEGVDMKDPVSMTQN
LWNLCKGTDAEQHLTSLLQNLLISTGELGSKNKDDPTQRTKQLKLIDALVSNV--SMASV
-DMQSSFNSAIQRLYDAMQTDEIARRAILENRDWVKRYEEIKADRDNLKEKLSNAEGGLV
GQLQDEVRQRDHILEKSQRVNAQLQHELDESKKKLILAKHEHEVELRKTLTAMNSNFEG-
-----SHNMRDEKGSENPRPLR-PERKLAIQKALQAKLEKTSKEINVESKR----LGLSL
EPNKRLKLLRSRMEDIENQARELEMTNFSDYQKDDIKEPEVSNEDDHKAVSESEEKAQQI
S--------------ALKLEELRKKLASLQQESNDISKFNVEGRFHEMFSGQKSLALDRL
KKLETDYKGFGINFDPDSPLG-------QALAGKSVSSDDKART----------LDPKEA
LNIVEEVSNILSGLDSSKAAEK--------------------------------------
----SNETPLRTATSSDSSEDEMDDKNGDKIAADSTL-----------------------
-PTSSFLESLSQKYGGAQ-------NS--LSNRHSFAGG----EINYP-------GSGYH
RKSFMNRVKRTGAV---------PYLGELSGKIGSSSYIKPSEAEENVGIGIMVDEKPLS
RRVQEDAAGVSQLESNEEKPALSHDLDKNTTHSKPITIGENLAAAKTAGKQQAHEDEGTT
EGSSTDKDSHEIASATSAPPPPPPPPMDLFAKNGAPVKTDNPDPAVSDTKS---------
-AAAPPPPPPPPPIP-PMLASSSSGSTSKAGAP---PPPPPPPPPPPALLS--QSSN---
---NGPPP----PPP------------PPPPFG-ASVSRNKSATPSPMLPQSPSLFDRYP
RPSKKLKQLHWEKIDDAEDSIWRDAKAEKFADDLYEKGVLSRLEKAFAAREIKSLASRKK
KDSDKLSFLSRDVSQQFGINLHMYSSLSVEEVVSKILRCDRDFLSTPSVIDFLSKQEIVE
VSNNLARNFAPYTIDWEGVSSVENAKPPEKDPTELQRADRL-YLELFVNLQTYWSSRMRA
LKVITTYEKDYSDLVHKLSMIDKATCSIQQSENLRNVLDVILAVGNFMNDSSKQAQGFRL
ATLQRLTFIKDDKNSMTFLNYVEKIIRETYPEFNDFLKELEPVVAAVKISIEQVAQDCRE
FSQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTLPEARKKGDLLMDEMKLTLLEFDN
LMRLFGEDAMDKFARNSFFKKFADFLLEYKKAQVYNLKLEEEERAYERRKKLVEDQLKRT
RESESKNKGTTDAGG---DSVRNEVNED----RDVMDRLLEKLKNAGPA-KSDPSSARKR
AVARKRLLQGSSSNSTILDNFDIEDSDGK-------------SLVYSPDN----NSSEVQ
LNEADTSPTPERRVR------------------------DSNATSPASHD------TGSS
DLTDRARNLLIELRGP-ESPGVKMSAQHQRLSKLRARRKND----SSS--SGSENRLNFV
GAGQAENSD-----------------------------------------------EQNE
PEVLKSKPESANDDDNGEQSDSSDGEFLDA------------------------------
-----
>Kwal_33.13392
------------------------------------------------------------
-------------------------------MHRSTSS-KPAKTPHNRSASN--------
GSGNGGIFSNLKRLTGNANNSSSQ----------------TLQKVDISDISSP---KKIN
LP--------DTGE---FSHKPLSKQSTLNIANLSAYTDV--------------------
-----------ASTHNRSSSAASNSS---PTK--YSY-SRRASQWSSNG-----------
----------GTAPSTKLSRQQTNQSI-----SSASIFSQG-SFSNL-SKFVGP-DGSIR
LEKPRDPREIEELFEEVLYKRNVYQSLPPSAQKELNNYDLEKKWLMVRQDLQSEVKKFMN
---------------------NKSVSKSPAAASTGISLIAPES-----------------
-------------------------PSTGHFASNSSINESLAGSSRSRAQN---------
------PGTSDQFYG-SNNGTSSTTTLSQDPSHLSPDYYVRKIICNNISAKRLNDLWVSL
RTEQLDWVVGFLEAQGQVAIANVILKTCYR-ESPDNL---LGDEVLDKEFAYFKCLKTSL
NLKEGADEAVLSNSAKIIISAIIEGLLSLRVATRRIASELLVSLSQWA----LPH-GFTH
V---MNALDQESRFCDNVHLQARLLSQTSNKEIKNSLRSSLLADNNGDRIMRKFEQWMLV
VEYTLDGRGKMGSLVGASEDFRTSGGENAIMEYAYLTLLLVNHLCQTPVDVKQRTILRAR
LKNAGLPRILNKMKRLNYEKVDEQLAIFEDSTTDDFDTLYSQGPNGELINMQDPVSMTQN
LWDLCKGTEAEEHLMSLLQNLLISTGELGGTSKEDPAQRTKQLKLIDALVSNV--SMASV
-DLQSSFNSAIQRLYDAMQTDEIARRAILENRDWVKRYEEIKAERNNLKEKLSNAEGGLV
GQLQEELKQRDHILEKSQRVTAQLQHELDESKKKLILAKHQHEVELRKTLTALNSK----
-----GGDIQLTEDGGQPKPLK-PERMLAIQRALQIKLEKTSKEITVESSR----LGVSL
EPNKRLRLLRSRMEEIENQARELEMTNFSEYREDADKEIEMAHEGTHMYPSDVDVGTTQD
S--------------NLKLEQLRRKLASLQNESNDISKFNVEGRFHEMFSDQKIQALDRL
KKLENDYSGFGINYDP---------AESPSLKQEQGQDVNKSRT----------LDPKGP
NNSVDE------------SQLE--------------------------------------
----TDRANASIDSSPASESLEEEDVHLTKSTTEEIG-----------------------
---GSFLERLSQKYGKGQ-------AN--LSNRNSVVGR----ENSYP-------GSGYH
RKSFMNRVKKSDNV---------PYLEELSGKFG--TATHENESEENFGIGIRVNNEQLT
SLPSKDKENHGHTILQSQDPTRQYKAT--------TEESSHGHPKAKDVQQDSASLLTTT
ENISDDEDEGEIIESVSAAGAVQSSSKPRLAKANVHDSKDSASDDLSPSDEHQDTVSPT-
-VSPVPPPPPPPPIP-PLFAKASPPISSSKQAGLAPPPPPPPPPPPPALLS--KTQASSS
---SGPPP----PPP------------PPPPFG-SSLPRSRTTTPSPMLPQSPSLFERYP
RPTKKLKQLHWEKIDDAEDSIWKNAKAEQFADDLYEKGILSRLEKAFAAREIKSLTSRKK
KDSDKLTFLSRDVSQQFGINLHMYSSLSVEEVVTKILKCDKDFLTTPSVIEFLSKQEIVE
VSNNLARNFAPYTTDWEGITNVKDAKPPEKDPSELQRADRL-YLELFVNLQGYWSSRMRA
LKVITSYEKEYSDLIHKLRMIDKATCAIQQSENLRNVLDVILAVGNFMNDSSKQAQGFRL
ATLQRLTFIKDDKNSMTFLNYVEKIVRETYPEFNVFLKELEPVVAAVKISIEQVSQDCKE
FSQSVINVERSVDIGNLSDSSKFHPLDRTLLKVLPVLPEARKKGDLLMDEMKLTLLEFDN
LMKMFGEDAMDKFSRNSFFKKFADFLQEYKKAQTYNMKLEEEEKAYERRKKMVEEQQRRA
RESNEQENSVDGN-----ADDNTAASGD----RDVMDRLLEKLKNAGPG-KSDPSSARKR
AIARRKLLQGSSSNSTILDNFEIEKPEGK-------------SLVYSPEQ-------VTL
SNSVDHSPTPDVRKR------------------------EGQSTASEVQT------SESS
DLTDRARNLLIELRGP-ESPSRRASSKDQRISKLRARRKND----GSG-NSGSDNHLNFV
GQEGAALPDSDQN-------------------------------------------HRVE
EEEESILAESSRAEETGTDKPNYNDPDYSDSSDAEFLDA---------------------
-----