MUSCLE (3.8) multiple sequence alignment

TBLA0A05430        --MSEQEI-------ADESQRVTDQVTLLSTQLMESISKQSQLEDKLNQANKKLAAQKLT
KNAG0F00460        MEGAEQVGESVAVDTADESKRISLQITSMSTQLMESIQNQSLLEEKLNRANKAAAALKEQ
CAGL0J08228g       --MSDP---------IEESNRISVQVSTLSTQLIESIDRQSELEKRLRDAQIIINKQKHV
TPHA0B04500        --MSGN---------SDEDKRVSVQLTSLSTQLLESIEKQSSLEDKLRQSRKIIEEQKTT
Kpol_2000.67       --MEDS---------SDESKRFSIQLTTLSTQLMESINKQTQLEDKLQRSRRTIMEQQTA
ZYRO0F16698g       --MSEPSE-------VEESRRVSTQIMSLSTQLIESIERQSTLEKELNQANKIIEGHGGA
TDEL0C06200        --MGES---------VEESRRVSVQISSLSTQLIESIDKQFQLEEQLNQAKRTIQSQRNS
KAFR0D03960        --MDDL---------AEENNRISAQVTSLSTQLMESIQRESELEEKLKHLKKVALSQEGS
Suva_14.70         ---MEA---------SEEAKRISIQVTSLSTQLIESVDKQSHLEEQLNKSLKTIAGQKAA
Skud_14.68         ---MDA---------SEEAKRISIQVTSLSTQLIESVDKQSHLEEQLNKSLKTIASQKAA
Smik_14.65         ---MDA---------SEEAKRISLQVTSLSTQLIESVDKQSHLEEQLNKSLKTISSQKEA
YNL272C            ---MDA---------SEEAKRVSIQVTSLSTQLIESVDKQSHLEEQLNKSLKTIASQKAA
NDAI0F04230        --MPET---------SEESKRISIQVSSLSTQLIESIGKQSDLEEKLNQANRTITSQKKS
NCAS0A00580        --MSEQ---------SEESKRISQQVTALSTQLIESIDKQSKLEEKLNHANKIIASQQPS
KLLA0C02299g       --MAD----------QEESKRISLQVTSLSTQLIESIDKQSQLEEQLLVAKKTISTQQNI
AFR670W            --MSEQEDSKQMSE-QEENRRISVQVSSLSTQLIESIDKQSRLEEQLQHAKKALAAQKDV
Ecym_1085          --MSDQDESKRMTEQQEESKRISIQVSSLSTQLIESIDKQSRLEEHLNQAKKALSAQKDS
SAKL0C02596g       --MSD----------QEESKRVSMQLSSLSTQLIESVDKQSRLEEQLRKAKKTIASQSES
KLTH0F02354g       --MTE----------EEESKRVSVQVSSLSTQLIESIDKQSHLEEQLLQARKVIASQRES
Kwal_33.13389      --MTE----------EEESKRVSVQVSSLSTQLIESIDKQSHLEEQLLQARKVISSQRDA
                                   :* .*.: *:  :****:**: .:  **. *             

TBLA0A05430        IEKNSQIKATGSALQKNANDLESQLKIANAELVKERQLREKAEGECTALNKEVEDLTASL
KNAG0F00460        TVHYDELKGRVAKLEASLTNRDEEMAALKSALAEEKSKRAASDKSVEELQSEVEDLTASL
CAGL0J08228g       MHEFETLKQKNKELSDGQQSFEEKIRALSAQLEEEKSKRLAAEKEVDKLGQEVEDLTASL
TPHA0B04500        ITQYNELRIKYDQLDKNFSKKKVDLQRLEQQLQAEKLGKAEAERKVDELNKEVEELTASL
Kpol_2000.67       IEQYNDLKVKYDQLDKNFNVTKVKIAKLENESKEEHKLRLSAEQKVDELNKEVEELTASL
ZYRO0F16698g       MQEYEKLKKNFAELEKRESNKDAQLNKLREELRKQKEARTEADSNADKLNHEVEELTASL
TDEL0C06200        LDSYNDLKSKFDGVESSLQTKNQIIEELKEELVKEKTLRTTAERNVDDLNKEIEDLTASL
KAFR0D03960        IAKYDILKADYDKLKTTVSERNREIQNLQVNLKEESKLRSSAEAEVATLSQEVEDLTASL
Suva_14.70         IDNYNKLKTDYDTLKKTLLERDNEVMKLNGNIAKETQLRTKAEDESDKLNREVEDLTASL
Skud_14.68         IENYNQLETDHNTLKKTLSERDDEVKKLHEDIAKETQLRTKAEDENDKLNREVEDLTASL
Smik_14.65         IVNYNRLKTDYEALKRTVLEKDDEVNKLREDVVKENELRTKAEDENDKLNKEVEDLTASL
YNL272C            IENYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASL
NDAI0F04230        LEQSHMLEKKSIELEQSLTARTEEVNKLRERLTREIKLRESAEIEVEKLSKEVEDLTATL
NCAS0A00580        LDKYSNLKVEFEKLKISSEDQQKELDNFKVKIRRERELRENAEQEVEKLSKEVEDLTATL
KLLA0C02299g       ANSYNELKQELQSLKLQYETDKTK-------FKKQEEICADAEKKVATLNQEIEDLTASL
AFR670W            VKQCESARGEAQQLRSQLADRDTELERQGEELEEARKARLAAELAVERLNKEIEDLTTSL
Ecym_1085          ISQFDSLKQQLSDTKKQLAYTEEELAVKRRELVEAQEVRVAAERAAEKLNKEIEDLTTSL
SAKL0C02596g       AASYESLREQLEKAQQELASRSRESAELERKLAAETTARKMAQDKIDQLNKEVEDLTASL
KLTH0F02354g       LQNYEDLRQQLEQAESNLKSERSQNIKIQEELQAARSGKLTAEGEIDRLNKEVEDLTASL
Kwal_33.13389      LKSYESVGKRLEETEAELESVRAQNAKDKEALKAAQSETEAAKDEVSRLNKEVEELTASL
                                                            :.     *  *:*:**::*

TBLA0A05430        FDEANHMVADARKEKAAVELRNTKLMEQLKEKDTVLETLELQLKNLKKVLQEFQDEDS--
KNAG0F00460        FSEANNMVADARKEKHTTEILNRKLLEAVNEKDNALETMKIQLKHLRKMLEKVDVGSPSA
CAGL0J08228g       FDEANNMVSDARREKHDIEIQNSRLQETLKEKDTVLETLNLQLKNLKKVLQTVDSESSIN
TPHA0B04500        FDEANNMVADARKETDSIETKNKKLTEQLLEKDTILETLNLQLKNLKTVLQDLQTESSMS
Kpol_2000.67       FDEANNMVADARRGAQEIDIKNRKLVEMLHEKDTILETMNLQLKNLKNVLHDLQNDPANI
ZYRO0F16698g       FDEANNMVADARKASHATELRNAKLVEQLHERDALLETLNLQLRHLKKVIQTLDDDSMAS
TDEL0C06200        FDEANKMVATARKESYTIEIKNNKLKEQLDEKDMILETLNLQLKNLKKVIQNLEKESTTH
KAFR0D03960        FAEANDMVADARREKHITEILNTKLVEQLREKDTLLQTLDLQLKNLKKVLQNFEDENVTN
Suva_14.70         FDEANHMVADARKEKYAIEILNKRLTEQLREKDALLETLTLQLKNLKKVMHSLDNESTVT
Skud_14.68         FDEANTMVADARREKYAIEILNKRLTEQLREKDVLLETLTLQLKNLKKVMHSLDNESTVT
Smik_14.65         FDEANNMVSDARKEKYAIEILNKRLTEQLREKDTLLDTLSLQLKNLKKVMHSLDNESVVT
YNL272C            FDEANNMVADARKEKYAIEILNKRLTEQLREKDTLLDTLTLQLKNLKKVMHSLDNESTVT
NDAI0F04230        FDEANNMVADARKEAHAKEILNSRLMGQLREKDNLLETLTLQLKSLKKVLQNVETE----
NCAS0A00580        FDEANNMVADARKDKYTVEVLNTKLVEQLHEKDNLLETLNLQLKNLKKVLQTVEDENNSL
KLLA0C02299g       FDEANNMVADARKEQNAVEILNSKLKEQLKEKDLLLDTLSMQLKNLKNVLYKFENDFNSS
AFR670W            FDEANRMVSKARKEKHVVEQHNARLQEQLREKDMLLDTLTIQLKNLKDVLYKVEDEQNTR
Ecym_1085          FDEANSMVANARKEKHDVEVLNSKLQEQLREKDMLLDTLSIQLRNLKEVLYKVEDEHNTL
SAKL0C02596g       FDEANNMVADARREKHDVEVRNSKLHEQLHEKDALLETLEMQLKNLKKVLYSLEDENSSL
KLTH0F02354g       FDEANNMVADARRETHSVQVKNSKLAEQLQEKETLLETLEIQLKNLKKVLYNLEEESNDR
Kwal_33.13389      FDEANNMVADARKETHSIQVKNIKLTEQLQEKSSLLETLEIQLKNLKKVLYDLEEESNSR
                   * *** **: **.     :  * .*   : *..  *:*: :**. *. ::  .:      

TBLA0A05430        -NNKRN------SMLSEVTIHSGSS--QRAGSPTIISTTNSES----FANIIYSPNISDI
KNAG0F00460        --TGRS------SMTSADTDTN-----SLKGIVT-RSSNQSQS--DTAPLVVYSPSVGSV
CAGL0J08228g       ANIR--------SPISTENSTTTSA--SGNK----LTRRQSQLSISHNESPLFSPYVTTL
TPHA0B04500        IINNGNISLKGDVPLSNENGGSSSH--SLKKMST-TTSFQSQQ--EVVNYAIFTPKITNI
Kpol_2000.67       AVSNRN------SLISTTSASSSSV--SLKKTI--TSNSTTNI--DLLSNAIYTPKVPAV
ZYRO0F16698g       EQVK--------TLANASDNANLAA--SLSKN---LSSSHGRQ-IEAPLGPIFSPNITAV
TDEL0C06200        SGSR--------SSFVGNDNSTSSI--SLNK----TSTSNSDE---LSLGPIYSPNITSV
KAFR0D03960        KASSIA------PDFLGSEQKSASA--SLSNEVG-----------DPSNKGVYSPYISTI
Suva_14.70         NNSGRY------STILSDSATSSST--SLNKVP--TSNSFTSQ--DLYSGIVYSPTISSI
Skud_14.68         NNSNRY------STILSDSATSSST--SLNKVP--TLNSFASQ--DMYSGIVYSPTISSI
Smik_14.65         NSSNRY------STILNDSATSSST--SLNKVP--TLNSSASQ--DMYSGIVYSPSISSI
YNL272C            NNSNRY------STILSDSATSSST--SLNKVP--TSYSLASQ--DIYSGIVYSPSISSI
NDAI0F04230        --NNRY------SMILPDSATISGA--SLDKVTTRTSSSFSQQ--PMNNGIIYSPNISSI
NCAS0A00580        IGNNRY------SIIQPDSATTSSSTTSLEKITT-TVSSYSQNISNMANGIIYSPIISSI
KLLA0C02299g       K-----------NVSLSDSATSSTT--SIDRSTTNLTSVNDNS--LSFQGVLFSPLLHSL
AFR670W            --SRRQ------SVMDSVNPSHTSL--DVDG----YASAFDNM---LSSGLLFTPAVQSL
Ecym_1085          NSYRQS------IIMEGSNGSNA----SLDKEALGNPGLIYDH--HHHMNLLFSPLAQSL
SAKL0C02596g       AKTKRN-----SAFLSSDTATSSNV--SLEKTAT-GGTSLGEL--SGAGGVLFSPVLQSL
KLTH0F02354g       LKSNQA------SVAAEDSVASSSES-ALEKT---MNALNGTA--SPPSPALFSPLLKSL
Kwal_33.13389      LQSNRS------PVMDTSDNSTVSSAIALENT---MHALNGTA--RSPNNVLFSPVLKSL
                                                                      :::*    :

TBLA0A05430        RYDLPLYGEFLKFVAVLPFVKNIKQTTNDSKLLRRLVNDEIQPVLRLDNADGLGWVVKRT
KNAG0F00460        RYDLSLYSEFLKFLVSLPRCTQIRDTESESKLVRRLINDEIAPILRIDSAPGIGWMAKKS
CAGL0J08228g       RYDQSLYNEFLKFLAVLPSSSSLKATSTESKLLKRLVSDEIQPVLKIDNASGIGWLVRKS
TPHA0B04500        RYDTFLYNEFLKFVAVLPHCNSIKNTSAESKLLRRLISDEIHPVLRLDTSNGLGWLTKRT
Kpol_2000.67       RYDLYLYNEFLKFIAVLPFCESIKHTTSESKLLRRLINDEIQPVLRLDNASGLGWIVKRT
ZYRO0F16698g       RYDLGLYHEFLKFLAVLPDYQDIKDTASDSKLLRRLVNDEIQPVLKLENASGLGWILKRT
TDEL0C06200        RYDLNLYTEFLKFIAVLPYCETLKDTSSDSKLLRRLVNDEIQPALRLDNASGLGWIVRRT
KAFR0D03960        RYDLALYNEFLKFIAVLPYCKNLKDTSSESKLMRRLINDEIQPILRIDSANGIGWLAKKS
Suva_14.70         RYDSNLYNEFLKFVAALPHCENIKATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKT
Skud_14.68         RYDISLYNEFLKFVAALPQCENIKATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKT
Smik_14.65         RYDVSLYNEFLKFVAALPNCDNIKATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKT
YNL272C            RYDISLYNEFLKFVAALPRCENIKATSTESKLIRRLVNDEIQPILKIDNASGIGWLVKKT
NDAI0F04230        RYDLSLYEEFLKFIAVIPHCKSIKDTSSDSKLIRRLITDEISPVLKIDNANGLGWLVKKT
NCAS0A00580        RYDLPLYEEFLKFIAVIPHCRTIKDTSSDSKLIRRLVNDEINPVLKLDNASGLGWIVRKT
KLLA0C02299g       RYDVPLYTEYLKFLAVLPQCENLQQTTSESKLLRRLINYEISPVLRLDNASGVGWLVKRN
AFR670W            RYDIPMYTEYLRFLAVLPMCKSIRDTRHDSKFLRRLVSDEIQPVLRLDSATGLGWLVRRN
Ecym_1085          RYDIPLYTEYLRFLAVLPMCKGIKDTRHDSKFLRRLVLDEIQPVLRLDAASGLGWLVRRN
SAKL0C02596g       RYDLGLYNEFLKFVAMLPICRSIKGTTTESKLLRRLMHDEIQPVLRLDNASGLGWLVRRS
KLTH0F02354g       RYDLVLYNEFLKFIAALPQCASIRDSTSYSKLLRRLIHDEIQPVLRLDNASGIGWYLRRN
Kwal_33.13389      RYDLNLYNEFLKFIAALPTSASIKDTASESKLLRRLVHDEIQPLLRLDNASGLGWYFKRS
                   ***  :* *:*.*:. :*    :. :   **::.**:  ** * *.:: : *:**  ...

TBLA0A05430        LLTQMMEGLVMVEPLSGVNELYTHSRNRRSATSNNTTGSTRDISGKDTNGSSNQKNS---
KNAG0F00460        LMNVMLEGMVIIEPNSGVNENYQHGHSSPSI----------------SQHSLGKSQP---
CAGL0J08228g       LLTSMMEGQVVVEPLSGINEAYQLGYETKE----------------HVSQNEGEEMP---
TPHA0B04500        LMNQIVEGLVVIEPLSGINETYRQSALYEVSISK------------SSIKSDQITKA---
Kpol_2000.67       LMNLMIEGLVVIEPLSGVNENYRFSSSAPVSNVNS-----------NNDPKLTSKND---
ZYRO0F16698g       LVNLMIEGLVAVEPISGLNEMHQYGYASPMLNQHSKMGGNNSNSLENSPATTSNTSTTTK
TDEL0C06200        LMSLMMEGLVVVEPLSGLNENFQYGYTSPVLPSS------------SFNPSMGGKDS---
KAFR0D03960        MLTLMIDGLVVIEPLSGVNENYQLGHVSSSDQS-------------NRPSMESKRES---
Suva_14.70         LLSLIIDGMVVVEPLSGVNATYQIGYNSSSP-----------------VKQAAPNMP---
Skud_14.68         LLSLIIDGLVIVEPLSGVNATYHIGYNSSSP-----------------VKQSTANMP---
Smik_14.65         LLSLIIDGLVVMEPLSGVNATYQIGYNSSSP-----------------VKQATPNMP---
YNL272C            LLSLIIDGLVVVEPLSGVNATYQIGYNSSSP-----------------AKQATSNMP---
NDAI0F04230        LLSTMMEGLVIVEPLSGINEMYQMGHTTPPLGMNT-----------QEEADAQRKVP---
NCAS0A00580        ILSTMMEGLVVVEPLSGVNETFQMGNSTQPPNAEA-----------SNKNESQSSMP---
KLLA0C02299g       LMNLMMEGLVSIEPISGINETYRTGYSSPSI---------------PDSPEVENKDS---
AFR670W            LMNLMIEGLVVVEPLSGINETYRMGYASPQTH--------------SHSKSSEPAAV---
Ecym_1085          LMNLMIDGLVVVEPLSGINETYRIGYASPQS---------------NSHKVTEVDNA---
SAKL0C02596g       LMSLMIDGLVVVEPLSGVNETYRMGYSSPQLHAQ------------QNAHFGQERAA---
KLTH0F02354g       LMSLMIDGSIVVEPVSGINETYRVGHMSSQVEAVP-----------QFQGPEQQSRP---
Kwal_33.13389      LMTLMMDGLVVVEPVSGINETYRVSHASGVENTKL-----------QRPRSEQRIEG---
                   ::. :::* : :** **:*  .  .                                   

TBLA0A05430        -------------HLFNFPTNSPPVAVHEPCAFCNEKRDDSVQHARIHLLKTQSRSETGK
KNAG0F00460        -------------HLFSYPADSPPIASFESCALCGESRSDIYEHERLHKMKIQQKRDDGT
CAGL0J08228g       -------------HMFNFPLNSPPIAVRDPCAFCAEQRDDIIEHARMYVMKTFNKENDGS
TPHA0B04500        -------------KMFNFPADSPPIAVRDPCAFCDESRSDCIGHARMYMLKTQTRNDDDT
Kpol_2000.67       -------------HLFKYPSNSPPIAVHEPCAFCGENRNDVLEHARMYMLKTQTKNEDNT
ZYRO0F16698g       RNHSRSSSMTKSLNLFNYPSDSPPVALREKCAICGECRDDLVEHARLHILKTQSRADDGT
TDEL0C06200        -------------HLFSYPSDSPPIAVHDKCSFCSEARDDVIEHARMYVLKTQTRIEDGS
KAFR0D03960        -------------HLFNYPTDSPPVAVHEPCSFCGENRDDILEHARMHVLKTQSKSEDGS
Suva_14.70         -------------KMFKFPLDSPPVAVHAACSFCGESRDDIIEHARMYVLKTLHKADDGT
Skud_14.68         -------------KMFKFPLNSPPVAVHAACSFCGESRDDIIEHARMYVLKTLHKADDGT
Smik_14.65         -------------RMFKFPLDSPPVAVHAACSFCGESRDDIIEHARMYILKTLHKADDGT
YNL272C            -------------KMFKFPLDSPPVAVHAACSFCGESRDDIIEHARMYILKTLHKTDDGK
NDAI0F04230        -------------KMFKFPSSSPPVAVRDPCAFCGEERNDIIEHARMYLLKTQTTQDDGT
NCAS0A00580        -------------KLFKFPLTSPPIALHEPCSFCGESRDDIIEHARMYVLKTQNKQEDGT
KLLA0C02299g       -------------HLFSRPVNSPPVAMVEPCAFCGENRNDILEHGRLYIFKTYQKLENGK
AFR670W            -------------KMFTYPVNSPPVAIEAPCAFCSEARNDILEHGRLYVLKTLQKTETGE
Ecym_1085          -------------KMFNYPSNSPPVAIQDPCAFCSESRNDILEHGRLYVLKTLQKNEDGS
SAKL0C02596g       -------------HLYNYPTDSPPVAIHEACAFCSESRNDILEHGRLYVLKTLQRNEDGT
KLTH0F02354g       -------------HLYNYPADSPPVAIESPCSFCSESRNDILEHGRLYVLKTLQKMENGI
Kwal_33.13389      -------------HLYNYPADSPPVAIQDPCSFCSESRNDILEHGRLYVLRTLQKTEEGT
                                .::. *  ***:*    *::* * *.*   * *:: :.     : . 

TBLA0A05430        ITVTNQFPLCQSCVLKVRQTGEIFAFLRSLALGTWKLEKIAIANLSKSDP-TKIKGSPAS
KNAG0F00460        LEVVNLYPLCLWCLLRVRQTCEIFSFLRSLKTGVWGLETIKTRGSPTSAK-SKKFDLNNA
CAGL0J08228g       TTITNSFPLCHWCLMKVRQTCEIFAFLRSLKLGTWHLEKVTLNTISKGESLSKFSEVTKS
TPHA0B04500        LSITNQYPLCQACLIKVRQTCDIFAFLRSLKSGVWQLEKVTLSTISKGDT-SSFLKVAEN
Kpol_2000.67       LSITNQFPLCQMCLIKVRQTCEIFAFLRSLKLGAWNLEKVTLSTIAKGDS-KKFSSVTAA
ZYRO0F16698g       VTVNNTFPLCKYCVLKIRQTCEIFAFLRSLKLGAWKLEKVSLTSVSKGDS-KEFSQVSMV
TDEL0C06200        LVVTNSFPLCRYCLLKVRQTCEIFAFLRSLKLGAWNLEKVTLTKIAKGES-SEFSQVSNG
KAFR0D03960        ITVTNSYPLCSWCLTKVRQTCEIFAFLRSLKIGTWNLEKVTLNSIAKGES-NKFTEVTRA
Suva_14.70         EHVTNTYPLCHWCLLKVRQTCEIFAFLRSLKVGAWHLEKVTMQNIVKGDL-ERFSEVTKR
Skud_14.68         EQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLVMQNIAKGDL-VKFSEVTQR
Smik_14.65         EQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLEAQSITKGDL-GKFSEVTKR
YNL272C            EQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLTTQNITKEDL-EKFSEVTKH
NDAI0F04230        LIIANTYPLCHWCLFKIRQTCEIFAFLRSLKTDIWNLEKVPLSAISKYGS-SKFSEVTTT
NCAS0A00580        IMVTNTFPLCHWCLFKVRQTCEIFAFLRSLKTGVWNLEKVTMKSISSKDS-SRFSVVTSA
KLLA0C02299g       NELTNQFPVCHYCLLKLRQVCEIFAFLRSLRSGAWHLEKVALASIHQGKV-NAYSEVTKA
AFR670W            LLTENQYPLCHFCLLKVRQTCEIFAFLRSLKTGSWNLENVTLSC-AKQES-DAFTQIPNS
Ecym_1085          TTSETQYPLCHYCLLKVRQTCEIFAFLRSLKSGAWNLENVTLSCARPGS--DEFTKVDRN
SAKL0C02596g       TETTNQYPLCHYCLLKVRQTCEIFAFLRSLKEGVWHLEKVTLTSIATGGS-SKFSEVTKT
KLTH0F02354g       TETSSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLEAVTISKTN-----NAFSVQTNS
Kwal_33.13389      TEVNSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLESVTVDANSQRSS-TEFKSQSKL
                       . :*:*  *: .:**. :**:*****  . * ** :                    

TBLA0A05430        P--------TKDKEKEKKKAKRKSFIKGLNMAQTASVLNPATSNPFFQQTQTNPVGDTSL
KNAG0F00460        PIR------RNKTKNSANRTKRMSWMAGLGLNTPTSSSSAPNDVSLMEP---ST------
CAGL0J08228g       T--------NGSTSNEEKKSNRKSFIPSLPK-GSPKKSSPVVE---------TH------
TPHA0B04500        QFKQ-----NEKATAQEKKQKRKSIISSLGK-SHSSYVNAKLDC----------------
Kpol_2000.67       TSSISKS--KIEEKFDSKLMKRRSIMAGFGISSISNTTTTKSET--------SV------
ZYRO0F16698g       NSNEDKP--NRDSKKENRKTARKSFMAGMNA-LNSKNTTVTPEV----------------
TDEL0C06200        N--------HKGPQKEEKRLQRMSLITGKNQ---SSKLAPQVDI----------------
KAFR0D03960        IKS------NKHGKSDEKKLKRKSFMVGLGI-NASSNLTPQVEV--------GA------
Suva_14.70         TKA------DGRVSPHDKMAKRLSFMAGLGI-NSSTKSKPRVEVP-------SS------
Skud_14.68         TKT------EDRVSSHDKKSKRLSFMAGLGI-NSTAKSKPKMEVF-------SS------
Smik_14.65         TKT------DGRVSSQDKKAKRLSFMAGLGI-NSSSKSKQKMEVF-------SS------
YNL272C            TKR------DGRVSSQDKKTKRLSFMAGLGI-NSSTKNKPKMEIF-------SS------
NDAI0F04230        NTNGSKKNIAATPKSENKKSKRMSFMAGLGRTHSSKITAARVEPHGNHNNNNTN------
NCAS0A00580        ---------IRQTKTEDRRSKRMSFIGGLTK-NSSAINTAQVE---------ST------
KLLA0C02299g       S-------------RPKMKSKRLSIFQGLKQ---SQSSTPIIEN--------GP------
AFR670W            VQASPVI--HRDENSITSSSKRLSFMSSLSRVSTTSKTTPRIEA--------VT------
Ecym_1085          STTNS----ASNKEANSTSSKRLSFMSGLSRTSSSTRMTPRIET--------VT------
SAKL0C02596g       P--------HTSAAKEDAKSKRMSFMAGLSR-PSTTKLMPTVEG--------AP------
KLTH0F02354g       VSNSPTLESPPDKMKPDRKSKRMSFMAGLSK-TLPLKTSYTVES--------AS------
Kwal_33.13389      STPERG---SERKVKSDRKSKRLSIMAGLTK-SFPSKTSYAIEE--------TP------
                                        * * : .      .       .                 

TBLA0A05430        TDVDTFGQPTTNIQRAWLQLCKLRCMLHWSHMGIWSLDDSIEAKFAPLSISESNIKDLDQ
KNAG0F00460        TFTDKNGLPNTNIKRAWLQLCKLRSILHWAHIGIWSVSDALDLKIGPITTDPD-----DA
CAGL0J08228g       IDTTKAGQPTSNIQRAWVHLCKLRSMLHWAHVGIWNMEDSISLKMGPITDHPT-----HS
TPHA0B04500        -TVEPVGLPSTNIQRAWLQLCKLRSILHWSHIGISNTEDCVTSTFAPVATNNKVVADKLE
Kpol_2000.67       GVVDQSGLPTTNIQRAWVHLSKLRSMLHWAHIGIWNTDNAVTTKLRPELSESN------Q
ZYRO0F16698g       -PVSQAGAPTTNIQWAWIQLCRLRSMLHWTHIGIWNVDDCITSKIGPLVINDGSNNAAGK
TDEL0C06200        -PVDQIGAPTTNIQRAWLQLCKLRITLHWAHIGIWSVEDAVTQKIGPFVKEED------E
KAFR0D03960        STIGNAGQPTTNIQRAWVQLCKLRSMLHWTYMGIWSVDESISLKIGPQVKDDN-------
Suva_14.70         EMTVKPGHPTTNIQRAWIQLCKLRCILHWSHIGIWAVDDSISSKIGPFVDDEG------T
Skud_14.68         EINAKPGQPTTNIQRAWLQLCKLRCILHWTHIGIWAVDDSISSKIGPLVDDED------S
Smik_14.65         EANAKPGQPTTNIQRAWLQLCKLRCILHWSHIGIWAVDDSISSKIGPFVGDED------S
YNL272C            ETNAKPGQPTTNIQRAWLQLCKLRCILHWTHIGIWAVDDSISSKIGPLVEDDS-------
NDAI0F04230        SPIENIGQPTTNIQRAWLQLCKLRSILHWAHIGIWSVDDSVSTKVGPEVFTQD-----EE
NCAS0A00580        TSMEITGLPTTNIQRAWIQLCKLRSILHWAHVGIWSIDDSITSKIGPEIKDPD-------
KLLA0C02299g       QFADKNGLPTTNIQRSWARLSQLRASLQWSHIGVWSLDESVATDIAPSTDISK-------
AFR670W            DFNEKKGLPPTNVQRSWVHLCKLRASLHWSHIGVWTLDDAVQTKVVPLSPEDK------I
Ecym_1085          DFSERKGLPSTNVQRSWVHLCKLRASLHWCHIGVWTLEDSIQLKVAPMSAQAK------V
SAKL0C02596g       NFAGQSGQPVTNIQRAWAQLCKLRASLHWAHIGVWSIEDSVALRIGPLMPEEK---TEQV
KLTH0F02354g       PCPEQITTPTTNIQRAWAQLCKLRSSLHWAHIGIWTLEDVVETKVGPVVAVDR-------
Kwal_33.13389      GSNSQVTTPTTNIQIAWAQLCKLRSTLHWTHIGIWSIGDSVETKLGPMTFPDS------A
                           * :*:: :* .*..**  *:* ::*:    : :   . *             

TBLA0A05430        NTDNFTSSQLPSTSPSNNNINSTNTLMHR----------DTQILKNHIDTTDQESFSLKQ
KNAG0F00460        EDDYSQSSFMNLNLNSNNDSSEGQ---------------PRNSIPP---TAQSLVIAEES
CAGL0J08228g       QELLLPVLSESESLNMLEEYVPAN---------------DSESFNL-KKTETSNTFDFEK
TPHA0B04500        PSLSGTSGTNGSFIPQRDNNASEE---------------SFLSIPE-DIDNDDDIFDFEN
Kpol_2000.67       NGTELEDQQILANINNTSEESFTS---------------VRESVEP-SDNEDDEPFDFET
ZYRO0F16698g       TTTHDINGSVNKDGSSSNETPTGEAYGEKHSQVPPVPSTPVAASEPANNSNEPDTFDFEA
TDEL0C06200        NDDEPISPNENPPLTKVTSEDGSF---------------TLKNSDEIDEINDDDAFDFEK
KAFR0D03960        ----NEITGTTVDVASVLTGNTEN---------------VSNSIKDTVSAPERNAYNQAS
Suva_14.70         DEGQNDTIPVRLQDKSLWKKNADT---------------PLSSSST-DESQKSDTFDFES
Skud_14.68         DDNQNDAISVRLQDKTLWKKNKGA---------------PSSSSSA-DESQKSDTFDFES
Smik_14.65         DENRDDSISVRLQDKALWKKSTGK---------------CSSSSSP-GEGPKSDTFDFES
YNL272C            DEDQNDAISVRLQDKALWKQDAKR---------------PFSSSSA-EESQKSDAFDFES
NDAI0F04230        FTTIDMTAEYIAQDMPLATRNLGD-----------------------ENTDAELAADVEA
NCAS0A00580        DKLEPASIEANIKITKKQIEKDVE-----------------SIISE---NNQGESFDFES
KLLA0C02299g       AKSFEEEQGLGIASNNIPVPITHE---------------------------EDETFDFEA
AFR670W            SSVSSESISPQDWTKLPSPQSVEN---------------SFIFQKE-DEIEEG--FDFEH
Ecym_1085          VTSTRSSVVPQNWTEDICSPQSGE---------------NFFVFQH-EDGLEDEEFDFEN
SAKL0C02596g       EGSSASSMGREEWVP--MESPDDE---------------SFALQKD-EDAESAETFDFEK
KLTH0F02354g       --PGNDSIVGDGLVPELGQEARES----------------FSLHNE-EEVDNEEGFDFEK
Kwal_33.13389      EAVASSSNEVLTHLQSLASSNNDE-------------------------------FDFEK
                                                                               

TBLA0A05430        ETDDAFDFENNS----------------------------------------IDTKLEKL
KNAG0F00460        GK----------------------------------------------------------
CAGL0J08228g       SSNDAVDISSNQ---------------------------------------DINSQTKVA
TPHA0B04500        EGNTTGNIENGN--------------------------------------------TTLE
Kpol_2000.67       NESTIQDAVPAN------------------------------------AEVNDGGETETE
ZYRO0F16698g       GGDTPIDDQKTK--------------------------------------------TESP
TDEL0C06200        GKAPVQTAEITE------------------------------------------------
KAFR0D03960        IDS---------------------------------------------------------
Suva_14.70         DDTEDGTTDESP----------------------------------------TGVSSTDA
Skud_14.68         EDTENEKTGESS-----------------------------------SDGLSTDGSSTDE
Smik_14.65         EEIESGTTGESSTGESSTGESSTGESSTGESSTGESSTDDSATDESSLDGSSTNGSLTEE
YNL272C            GDMENEITGESS------------------------------SDESSSDGSSTDNSTADS
NDAI0F04230        TGNTTL------------------------------------------------------
NCAS0A00580        SASTSGATEA--------------------------------------------------
KLLA0C02299g       DTANSISVDETV------------------------------------------------
AFR670W            GEDTIDTLKAAP------------------------------------------------
Ecym_1085          GEKTLDTIK---------------------------------------------------
SAKL0C02596g       GDTTGDTTGGTI-------------------------------------QAHGDLQGSLQ
KLTH0F02354g       MNSTLESAGLEG---------------------------------------------KET
Kwal_33.13389      TTNSSELVD---------------------------------------------------
                                                                               

TBLA0A05430        NSTSNNSFKSPLEKELKNLQEDLRPSDKHINSNGIPATNTQHVSSNVQNRNSTASAENPT
KNAG0F00460        -----------------------LAEESAVNSVNSPAV----------------------
CAGL0J08228g       PDVNENLKGQPSTGEASTIEPVNIKVD-PATIGANVDAKKKNAISGNTLDTAKDTDNLSK
TPHA0B04500        DRKEENETANLTDELDTANVRDIVDSTDGVEAVDDIEATDEIGATDETEATVEDD-----
Kpol_2000.67       TENHLGNILDDYDTESIGFENSETEPVLGKENDLTPEEETIEKDESTVGESAEIIDIVQE
ZYRO0F16698g       KKEKEHSTPQKPTHSPETIQEEKENINEDNPRSSEVEEKKTEDEKKEKKNSSKISESNEN
TDEL0C06200        ATNNESRTSEHAASQNNAGQPLKDEVITTADSSTTRSATEVDHMPSSKDNIGSLDVDK--
KAFR0D03960        PQFDENKTKSQNLDDGVEHFSTDTNSKNGISSITVSTERAENS-----------------
Suva_14.70         SSSAASSSAATTTSDGNSSAAEELGQNEGDDTVTKDDESSSKSIKNLNEESDTTNDKKVQ
Skud_14.68         SSTEESSSTVSTTSHGNS---EDLDRNEGDDTVTNYDERSTNSTKKKKESVNKTDDGVRK
Smik_14.65         SSAEESSPAASITIHGDSTPPENLHEDEGDDTITKDDKSSIKSIKNNEENSNSDDEKRKN
YNL272C            SSEDESSLADSTTSSADSSSPESIDNGEGDDTVTKDDKSSIKSANNNEENSDCGDKKGRS
NDAI0F04230        QNKEEQNEDKEATSTSGSVSDSSADSKFGTPKESLESETSEEELQDESNDEGT-------
NCAS0A00580        -----------------SSEEKSIAGESETKVHASQDNSEHQSANALEQETKNNFEE---
KLLA0C02299g       ----NGIRHTDQSSDDIGDHNEKTNEKTATDLQGKNEEKKSKKIEPQHSR----------
AFR670W            -TQKDKSSTQSEDETAQNINKKETSLEAPVVLTDRSKKQATQLLPATQDDEA--------
Ecym_1085          AEVIEQGISKNLENEAA------LNKKKSVETMAEPTTKPDSTVNSSSRPNV--------
SAKL0C02596g       ESLHGDLQTKPQEDTSTTHDPAKTDDQTPIQIDDSLEHAPDDSSVQDKKEEESKDTPRLT
KLTH0F02354g       SQTTQTSSGNPTTLDPRTSEGGDAGAKIGASFVQTIADSDTGASSPIQESQTKTARTVEK
Kwal_33.13389      PDVHEEKIMSKSEVSTPTLSPTVIAAPNESETHSADQKSKV-------------------
                                                                               

TBLA0A05430        MLED------------------EQESESSIAANDD--TLTKSITPVDDQNIEHESTISSD
KNAG0F00460        -------------------------------------KEERANEELELDAKPGDGQLETT
CAGL0J08228g       DKMEAKMIEKDTTEDSKKTTKSSKRTSEIIDQLND--IGSDAKELFGTVEESGKESQSDD
TPHA0B04500        ----------------------ILSVGDLVKIIDE----NTITHVNKEKLHIVEENLNLE
Kpol_2000.67       SEVTANDDELKNEAEVTEIQETHEIAENLKEEESNLEIAEDIVKTVDEEQSPLTPEDEHA
ZYRO0F16698g       ----------------------SNSSKELLDNLDK--LGEQLKEESGTSEAPQTNGNGSK
TDEL0C06200        -------------------------------------VSISLGSDSNTSPPVPADDLESK
KAFR0D03960        -------------------------------------------NDAAENDSPDGELRHQS
Suva_14.70         EKPKRKASQR------------KLQKKKLLKDLDD--LEEQFREESADVQDELKSSDDVK
Skud_14.68         KSKRKASQH-------------EIQKKKLLQDLDE--LEEQFREESANNQDEPKSSDDVE
Smik_14.65         IPKRKAARH-------------RLQKEKLLQDLDH--LEEQFMEESAINQKEPEAFDDIV
YNL272C            IIKKKAPQR-------------KIQKKKLLQDLDD--LEEQFREESAIDQTEFENAESNV
NDAI0F04230        -------------------------------------NSVDIIESYDNHSKEGNVEDVTE
NCAS0A00580        -------------------------------------VTKKDIEQESESERKPKEAGDET
KLLA0C02299g       -------------------------------------QPSQSSTVLNDNKESAESAHDTH
AFR670W            -------------------------------------TEPPLPKIAAGSASPPKSDRGLC
Ecym_1085          ----------------------VEKGTNLYEGSHP--VPPEQIEDEVDEVQESDEVKEVH
SAKL0C02596g       RKPSAISRK-------------KLQTGKLFEGLDA--LSEGFKQDMDKGLGLDKPTLAEH
KLTH0F02354g       KAAVPGSIDLD-----------EQNYAQNVEAPAR--MVKSRTSEAPNGEGTAENIIELV
Kwal_33.13389      ----------------------EQENGDAVVLLRQ--EEPEILNHVTLGSSSEEDQKPDT
                                                                               

TBLA0A05430        ---------------REDTSATNSTGIINSVNGETNEP-------STQLTSDNDNQNDDI
KNAG0F00460        ---------------KTNESDDVIGSYAEEVQSPVDEA---------------------H
CAGL0J08228g       ---------------KQSDKHLNSDETKNGDATMPNED--------------DMTLDAKE
TPHA0B04500        ---------------VIDSSPAKNTNKKSNKHKDFRKS--------------ILNDLDAL
Kpol_2000.67       VPIHIVEEVQNEEFIGTSKVEDKVLLKEQNFDEDTEKVVPSNLQVEQPKAEESLVINEEA
ZYRO0F16698g       ---------------NVNSNTNRNNGSPSPKKKDVQRH--------------RSIKSVLQ
TDEL0C06200        ---------------SYDKKHTDSIEGLENAQETGLTP--------------LDAPNDIQ
KAFR0D03960        ---------------PETQTDTHSINILEEYENTVGTV-------------------SQI
Suva_14.70         ---------------TQVVSPDNTISAEKDAGIDEHLSNKESKLSVNNKHKEQINENSPA
Skud_14.68         ---------------KHTEFLKKPFATKEDVRKNEDLSIEESNLAISDKHQEQIRENSPS
Smik_14.65         ---------------KQIESSEKASTADKNFAIDNLQSTKEQNLTISNKHKEQIRENSPS
YNL272C            ---------------KQNISSKRASSGDENSKKDNNEKTLKTNLTIGDKTQEQIGENSPS
NDAI0F04230        ---------------KQSQNTNSELPSVSNKTQNAEVL---------------AYAEAPS
NCAS0A00580        ---------------LTHEPNSISPKIEEENKEDTASS--------------KASNEDDE
KLLA0C02299g       ---------------ASSEEPSDLLETYQDLSADLEPE-------------------SEK
AFR670W            ---------------PVEKPDLVATESHDSVSSSKSKP----------------KGEDVL
Ecym_1085          ---------------EEQEKQKIPLRILNDLLIAKLQL--------------MKSIVNPS
SAKL0C02596g       ---------------TQQEVPTSSPKESEGESTALKES----------------------
KLTH0F02354g       ---------------AESDTKKITGKAPESASSDHAKS------------------RSEL
Kwal_33.13389      ---------------GHQQSEEKSEEQIAALDNHANSS--------------HSEIENDA
                                                                               

TBLA0A05430        LDSYIDDMNDDEEVIPTSERIENKPIDEESSRSTVT--------------
KNAG0F00460        PDSSTSN----------DNF--------DDAKENI---------------
CAGL0J08228g       VMRGLND--DDADSSSLDNF--------DDSKEFQ---------------
TPHA0B04500        EEQFESG----------LKL--------NNSNENVNTTK-----------
Kpol_2000.67       SEEHSVD-NDEQVEEETSTIVENEGTTVEETKNEQNKKKRNKNKKKNKKR
ZYRO0F16698g       SDNESAS--NTE-----DQY--------DDAQEIQ---------------
TDEL0C06200        IETSSIS--NND-----EEF--------DDAIENQDD-------------
KAFR0D03960        SDGSSSS--DDE------KF--------DDANETKDSN------------
Suva_14.70         SGLHASS--SND-----DNF--------DDAQEQQ---------------
Skud_14.68         SALHASS--SND-----DNF--------DDAQEQQ---------------
Smik_14.65         SGLHASS--SND-----DNF--------DDAQEQQ---------------
YNL272C            SGLHASS--SND-----DNF--------DDAQEQQ---------------
NDAI0F04230        AETDISN--VRE----------------DSIKIKET--------------
NCAS0A00580        NGTAASS--INETDDVLDNY--------TDAND-----------------
KLLA0C02299g       PENLDNS--DEE-----DSF--------NDAKDVVN--------------
AFR670W            TDVTDSS--EHDTNETHSSY--------HEAKESLSNTEGTITC------
Ecym_1085          NLNHRLN--HHA--------------------------------------
SAKL0C02596g       ADSDANG----------EEF--------DDALTGQE--------------
KLTH0F02354g       PSQSATD--DEE-----AGF--------DDARSTFS--------------
Kwal_33.13389      PKSQNIT--DDE-----TVF--------DDARSGLSQA------------
                                                                     

FASTA FORMAT for MUSCLE Version 3.6

>TBLA0A05430
--MSEQEI-------ADESQRVTDQVTLLSTQLMESISKQSQLEDKLNQANKKLAAQKLT
IEKNSQIKATGSALQKNANDLESQLKIANAELVKERQLREKAEGECTALNKEVEDLTASL
FDEANHMVADARKEKAAVELRNTKLMEQLKEKDTVLETLELQLKNLKKVLQEFQDEDS--
-NNKRN------SMLSEVTIHSGSS--QRAGSPTIISTTNSES----FANIIYSPNISDI
RYDLPLYGEFLKFVAVLPFVKNIKQTTNDSKLLRRLVNDEIQPVLRLDNADGLGWVVKRT
LLTQMMEGLVMVEPLSGVNELYTHSRNRRSATSNNTTGSTRDISGKDTNGSSNQKNS---
-------------HLFNFPTNSPPVAVHEPCAFCNEKRDDSVQHARIHLLKTQSRSETGK
ITVTNQFPLCQSCVLKVRQTGEIFAFLRSLALGTWKLEKIAIANLSKSDP-TKIKGSPAS
P--------TKDKEKEKKKAKRKSFIKGLNMAQTASVLNPATSNPFFQQTQTNPVGDTSL
TDVDTFGQPTTNIQRAWLQLCKLRCMLHWSHMGIWSLDDSIEAKFAPLSISESNIKDLDQ
NTDNFTSSQLPSTSPSNNNINSTNTLMHR----------DTQILKNHIDTTDQESFSLKQ
ETDDAFDFENNS----------------------------------------IDTKLEKL
NSTSNNSFKSPLEKELKNLQEDLRPSDKHINSNGIPATNTQHVSSNVQNRNSTASAENPT
MLED------------------EQESESSIAANDD--TLTKSITPVDDQNIEHESTISSD
---------------REDTSATNSTGIINSVNGETNEP-------STQLTSDNDNQNDDI
LDSYIDDMNDDEEVIPTSERIENKPIDEESSRSTVT--------------
>KNAG0F00460
MEGAEQVGESVAVDTADESKRISLQITSMSTQLMESIQNQSLLEEKLNRANKAAAALKEQ
TVHYDELKGRVAKLEASLTNRDEEMAALKSALAEEKSKRAASDKSVEELQSEVEDLTASL
FSEANNMVADARKEKHTTEILNRKLLEAVNEKDNALETMKIQLKHLRKMLEKVDVGSPSA
--TGRS------SMTSADTDTN-----SLKGIVT-RSSNQSQS--DTAPLVVYSPSVGSV
RYDLSLYSEFLKFLVSLPRCTQIRDTESESKLVRRLINDEIAPILRIDSAPGIGWMAKKS
LMNVMLEGMVIIEPNSGVNENYQHGHSSPSI----------------SQHSLGKSQP---
-------------HLFSYPADSPPIASFESCALCGESRSDIYEHERLHKMKIQQKRDDGT
LEVVNLYPLCLWCLLRVRQTCEIFSFLRSLKTGVWGLETIKTRGSPTSAK-SKKFDLNNA
PIR------RNKTKNSANRTKRMSWMAGLGLNTPTSSSSAPNDVSLMEP---ST------
TFTDKNGLPNTNIKRAWLQLCKLRSILHWAHIGIWSVSDALDLKIGPITTDPD-----DA
EDDYSQSSFMNLNLNSNNDSSEGQ---------------PRNSIPP---TAQSLVIAEES
GK----------------------------------------------------------
-----------------------LAEESAVNSVNSPAV----------------------
-------------------------------------KEERANEELELDAKPGDGQLETT
---------------KTNESDDVIGSYAEEVQSPVDEA---------------------H
PDSSTSN----------DNF--------DDAKENI---------------
>CAGL0J08228g
--MSDP---------IEESNRISVQVSTLSTQLIESIDRQSELEKRLRDAQIIINKQKHV
MHEFETLKQKNKELSDGQQSFEEKIRALSAQLEEEKSKRLAAEKEVDKLGQEVEDLTASL
FDEANNMVSDARREKHDIEIQNSRLQETLKEKDTVLETLNLQLKNLKKVLQTVDSESSIN
ANIR--------SPISTENSTTTSA--SGNK----LTRRQSQLSISHNESPLFSPYVTTL
RYDQSLYNEFLKFLAVLPSSSSLKATSTESKLLKRLVSDEIQPVLKIDNASGIGWLVRKS
LLTSMMEGQVVVEPLSGINEAYQLGYETKE----------------HVSQNEGEEMP---
-------------HMFNFPLNSPPIAVRDPCAFCAEQRDDIIEHARMYVMKTFNKENDGS
TTITNSFPLCHWCLMKVRQTCEIFAFLRSLKLGTWHLEKVTLNTISKGESLSKFSEVTKS
T--------NGSTSNEEKKSNRKSFIPSLPK-GSPKKSSPVVE---------TH------
IDTTKAGQPTSNIQRAWVHLCKLRSMLHWAHVGIWNMEDSISLKMGPITDHPT-----HS
QELLLPVLSESESLNMLEEYVPAN---------------DSESFNL-KKTETSNTFDFEK
SSNDAVDISSNQ---------------------------------------DINSQTKVA
PDVNENLKGQPSTGEASTIEPVNIKVD-PATIGANVDAKKKNAISGNTLDTAKDTDNLSK
DKMEAKMIEKDTTEDSKKTTKSSKRTSEIIDQLND--IGSDAKELFGTVEESGKESQSDD
---------------KQSDKHLNSDETKNGDATMPNED--------------DMTLDAKE
VMRGLND--DDADSSSLDNF--------DDSKEFQ---------------
>TPHA0B04500
--MSGN---------SDEDKRVSVQLTSLSTQLLESIEKQSSLEDKLRQSRKIIEEQKTT
ITQYNELRIKYDQLDKNFSKKKVDLQRLEQQLQAEKLGKAEAERKVDELNKEVEELTASL
FDEANNMVADARKETDSIETKNKKLTEQLLEKDTILETLNLQLKNLKTVLQDLQTESSMS
IINNGNISLKGDVPLSNENGGSSSH--SLKKMST-TTSFQSQQ--EVVNYAIFTPKITNI
RYDTFLYNEFLKFVAVLPHCNSIKNTSAESKLLRRLISDEIHPVLRLDTSNGLGWLTKRT
LMNQIVEGLVVIEPLSGINETYRQSALYEVSISK------------SSIKSDQITKA---
-------------KMFNFPADSPPIAVRDPCAFCDESRSDCIGHARMYMLKTQTRNDDDT
LSITNQYPLCQACLIKVRQTCDIFAFLRSLKSGVWQLEKVTLSTISKGDT-SSFLKVAEN
QFKQ-----NEKATAQEKKQKRKSIISSLGK-SHSSYVNAKLDC----------------
-TVEPVGLPSTNIQRAWLQLCKLRSILHWSHIGISNTEDCVTSTFAPVATNNKVVADKLE
PSLSGTSGTNGSFIPQRDNNASEE---------------SFLSIPE-DIDNDDDIFDFEN
EGNTTGNIENGN--------------------------------------------TTLE
DRKEENETANLTDELDTANVRDIVDSTDGVEAVDDIEATDEIGATDETEATVEDD-----
----------------------ILSVGDLVKIIDE----NTITHVNKEKLHIVEENLNLE
---------------VIDSSPAKNTNKKSNKHKDFRKS--------------ILNDLDAL
EEQFESG----------LKL--------NNSNENVNTTK-----------
>Kpol_2000.67
--MEDS---------SDESKRFSIQLTTLSTQLMESINKQTQLEDKLQRSRRTIMEQQTA
IEQYNDLKVKYDQLDKNFNVTKVKIAKLENESKEEHKLRLSAEQKVDELNKEVEELTASL
FDEANNMVADARRGAQEIDIKNRKLVEMLHEKDTILETMNLQLKNLKNVLHDLQNDPANI
AVSNRN------SLISTTSASSSSV--SLKKTI--TSNSTTNI--DLLSNAIYTPKVPAV
RYDLYLYNEFLKFIAVLPFCESIKHTTSESKLLRRLINDEIQPVLRLDNASGLGWIVKRT
LMNLMIEGLVVIEPLSGVNENYRFSSSAPVSNVNS-----------NNDPKLTSKND---
-------------HLFKYPSNSPPIAVHEPCAFCGENRNDVLEHARMYMLKTQTKNEDNT
LSITNQFPLCQMCLIKVRQTCEIFAFLRSLKLGAWNLEKVTLSTIAKGDS-KKFSSVTAA
TSSISKS--KIEEKFDSKLMKRRSIMAGFGISSISNTTTTKSET--------SV------
GVVDQSGLPTTNIQRAWVHLSKLRSMLHWAHIGIWNTDNAVTTKLRPELSESN------Q
NGTELEDQQILANINNTSEESFTS---------------VRESVEP-SDNEDDEPFDFET
NESTIQDAVPAN------------------------------------AEVNDGGETETE
TENHLGNILDDYDTESIGFENSETEPVLGKENDLTPEEETIEKDESTVGESAEIIDIVQE
SEVTANDDELKNEAEVTEIQETHEIAENLKEEESNLEIAEDIVKTVDEEQSPLTPEDEHA
VPIHIVEEVQNEEFIGTSKVEDKVLLKEQNFDEDTEKVVPSNLQVEQPKAEESLVINEEA
SEEHSVD-NDEQVEEETSTIVENEGTTVEETKNEQNKKKRNKNKKKNKKR
>ZYRO0F16698g
--MSEPSE-------VEESRRVSTQIMSLSTQLIESIERQSTLEKELNQANKIIEGHGGA
MQEYEKLKKNFAELEKRESNKDAQLNKLREELRKQKEARTEADSNADKLNHEVEELTASL
FDEANNMVADARKASHATELRNAKLVEQLHERDALLETLNLQLRHLKKVIQTLDDDSMAS
EQVK--------TLANASDNANLAA--SLSKN---LSSSHGRQ-IEAPLGPIFSPNITAV
RYDLGLYHEFLKFLAVLPDYQDIKDTASDSKLLRRLVNDEIQPVLKLENASGLGWILKRT
LVNLMIEGLVAVEPISGLNEMHQYGYASPMLNQHSKMGGNNSNSLENSPATTSNTSTTTK
RNHSRSSSMTKSLNLFNYPSDSPPVALREKCAICGECRDDLVEHARLHILKTQSRADDGT
VTVNNTFPLCKYCVLKIRQTCEIFAFLRSLKLGAWKLEKVSLTSVSKGDS-KEFSQVSMV
NSNEDKP--NRDSKKENRKTARKSFMAGMNA-LNSKNTTVTPEV----------------
-PVSQAGAPTTNIQWAWIQLCRLRSMLHWTHIGIWNVDDCITSKIGPLVINDGSNNAAGK
TTTHDINGSVNKDGSSSNETPTGEAYGEKHSQVPPVPSTPVAASEPANNSNEPDTFDFEA
GGDTPIDDQKTK--------------------------------------------TESP
KKEKEHSTPQKPTHSPETIQEEKENINEDNPRSSEVEEKKTEDEKKEKKNSSKISESNEN
----------------------SNSSKELLDNLDK--LGEQLKEESGTSEAPQTNGNGSK
---------------NVNSNTNRNNGSPSPKKKDVQRH--------------RSIKSVLQ
SDNESAS--NTE-----DQY--------DDAQEIQ---------------
>TDEL0C06200
--MGES---------VEESRRVSVQISSLSTQLIESIDKQFQLEEQLNQAKRTIQSQRNS
LDSYNDLKSKFDGVESSLQTKNQIIEELKEELVKEKTLRTTAERNVDDLNKEIEDLTASL
FDEANKMVATARKESYTIEIKNNKLKEQLDEKDMILETLNLQLKNLKKVIQNLEKESTTH
SGSR--------SSFVGNDNSTSSI--SLNK----TSTSNSDE---LSLGPIYSPNITSV
RYDLNLYTEFLKFIAVLPYCETLKDTSSDSKLLRRLVNDEIQPALRLDNASGLGWIVRRT
LMSLMMEGLVVVEPLSGLNENFQYGYTSPVLPSS------------SFNPSMGGKDS---
-------------HLFSYPSDSPPIAVHDKCSFCSEARDDVIEHARMYVLKTQTRIEDGS
LVVTNSFPLCRYCLLKVRQTCEIFAFLRSLKLGAWNLEKVTLTKIAKGES-SEFSQVSNG
N--------HKGPQKEEKRLQRMSLITGKNQ---SSKLAPQVDI----------------
-PVDQIGAPTTNIQRAWLQLCKLRITLHWAHIGIWSVEDAVTQKIGPFVKEED------E
NDDEPISPNENPPLTKVTSEDGSF---------------TLKNSDEIDEINDDDAFDFEK
GKAPVQTAEITE------------------------------------------------
ATNNESRTSEHAASQNNAGQPLKDEVITTADSSTTRSATEVDHMPSSKDNIGSLDVDK--
-------------------------------------VSISLGSDSNTSPPVPADDLESK
---------------SYDKKHTDSIEGLENAQETGLTP--------------LDAPNDIQ
IETSSIS--NND-----EEF--------DDAIENQDD-------------
>KAFR0D03960
--MDDL---------AEENNRISAQVTSLSTQLMESIQRESELEEKLKHLKKVALSQEGS
IAKYDILKADYDKLKTTVSERNREIQNLQVNLKEESKLRSSAEAEVATLSQEVEDLTASL
FAEANDMVADARREKHITEILNTKLVEQLREKDTLLQTLDLQLKNLKKVLQNFEDENVTN
KASSIA------PDFLGSEQKSASA--SLSNEVG-----------DPSNKGVYSPYISTI
RYDLALYNEFLKFIAVLPYCKNLKDTSSESKLMRRLINDEIQPILRIDSANGIGWLAKKS
MLTLMIDGLVVIEPLSGVNENYQLGHVSSSDQS-------------NRPSMESKRES---
-------------HLFNYPTDSPPVAVHEPCSFCGENRDDILEHARMHVLKTQSKSEDGS
ITVTNSYPLCSWCLTKVRQTCEIFAFLRSLKIGTWNLEKVTLNSIAKGES-NKFTEVTRA
IKS------NKHGKSDEKKLKRKSFMVGLGI-NASSNLTPQVEV--------GA------
STIGNAGQPTTNIQRAWVQLCKLRSMLHWTYMGIWSVDESISLKIGPQVKDDN-------
----NEITGTTVDVASVLTGNTEN---------------VSNSIKDTVSAPERNAYNQAS
IDS---------------------------------------------------------
PQFDENKTKSQNLDDGVEHFSTDTNSKNGISSITVSTERAENS-----------------
-------------------------------------------NDAAENDSPDGELRHQS
---------------PETQTDTHSINILEEYENTVGTV-------------------SQI
SDGSSSS--DDE------KF--------DDANETKDSN------------
>Suva_14.70
---MEA---------SEEAKRISIQVTSLSTQLIESVDKQSHLEEQLNKSLKTIAGQKAA
IDNYNKLKTDYDTLKKTLLERDNEVMKLNGNIAKETQLRTKAEDESDKLNREVEDLTASL
FDEANHMVADARKEKYAIEILNKRLTEQLREKDALLETLTLQLKNLKKVMHSLDNESTVT
NNSGRY------STILSDSATSSST--SLNKVP--TSNSFTSQ--DLYSGIVYSPTISSI
RYDSNLYNEFLKFVAALPHCENIKATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKT
LLSLIIDGMVVVEPLSGVNATYQIGYNSSSP-----------------VKQAAPNMP---
-------------KMFKFPLDSPPVAVHAACSFCGESRDDIIEHARMYVLKTLHKADDGT
EHVTNTYPLCHWCLLKVRQTCEIFAFLRSLKVGAWHLEKVTMQNIVKGDL-ERFSEVTKR
TKA------DGRVSPHDKMAKRLSFMAGLGI-NSSTKSKPRVEVP-------SS------
EMTVKPGHPTTNIQRAWIQLCKLRCILHWSHIGIWAVDDSISSKIGPFVDDEG------T
DEGQNDTIPVRLQDKSLWKKNADT---------------PLSSSST-DESQKSDTFDFES
DDTEDGTTDESP----------------------------------------TGVSSTDA
SSSAASSSAATTTSDGNSSAAEELGQNEGDDTVTKDDESSSKSIKNLNEESDTTNDKKVQ
EKPKRKASQR------------KLQKKKLLKDLDD--LEEQFREESADVQDELKSSDDVK
---------------TQVVSPDNTISAEKDAGIDEHLSNKESKLSVNNKHKEQINENSPA
SGLHASS--SND-----DNF--------DDAQEQQ---------------
>Skud_14.68
---MDA---------SEEAKRISIQVTSLSTQLIESVDKQSHLEEQLNKSLKTIASQKAA
IENYNQLETDHNTLKKTLSERDDEVKKLHEDIAKETQLRTKAEDENDKLNREVEDLTASL
FDEANTMVADARREKYAIEILNKRLTEQLREKDVLLETLTLQLKNLKKVMHSLDNESTVT
NNSNRY------STILSDSATSSST--SLNKVP--TLNSFASQ--DMYSGIVYSPTISSI
RYDISLYNEFLKFVAALPQCENIKATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKT
LLSLIIDGLVIVEPLSGVNATYHIGYNSSSP-----------------VKQSTANMP---
-------------KMFKFPLNSPPVAVHAACSFCGESRDDIIEHARMYVLKTLHKADDGT
EQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLVMQNIAKGDL-VKFSEVTQR
TKT------EDRVSSHDKKSKRLSFMAGLGI-NSTAKSKPKMEVF-------SS------
EINAKPGQPTTNIQRAWLQLCKLRCILHWTHIGIWAVDDSISSKIGPLVDDED------S
DDNQNDAISVRLQDKTLWKKNKGA---------------PSSSSSA-DESQKSDTFDFES
EDTENEKTGESS-----------------------------------SDGLSTDGSSTDE
SSTEESSSTVSTTSHGNS---EDLDRNEGDDTVTNYDERSTNSTKKKKESVNKTDDGVRK
KSKRKASQH-------------EIQKKKLLQDLDE--LEEQFREESANNQDEPKSSDDVE
---------------KHTEFLKKPFATKEDVRKNEDLSIEESNLAISDKHQEQIRENSPS
SALHASS--SND-----DNF--------DDAQEQQ---------------
>Smik_14.65
---MDA---------SEEAKRISLQVTSLSTQLIESVDKQSHLEEQLNKSLKTISSQKEA
IVNYNRLKTDYEALKRTVLEKDDEVNKLREDVVKENELRTKAEDENDKLNKEVEDLTASL
FDEANNMVSDARKEKYAIEILNKRLTEQLREKDTLLDTLSLQLKNLKKVMHSLDNESVVT
NSSNRY------STILNDSATSSST--SLNKVP--TLNSSASQ--DMYSGIVYSPSISSI
RYDVSLYNEFLKFVAALPNCDNIKATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKT
LLSLIIDGLVVMEPLSGVNATYQIGYNSSSP-----------------VKQATPNMP---
-------------RMFKFPLDSPPVAVHAACSFCGESRDDIIEHARMYILKTLHKADDGT
EQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLEAQSITKGDL-GKFSEVTKR
TKT------DGRVSSQDKKAKRLSFMAGLGI-NSSSKSKQKMEVF-------SS------
EANAKPGQPTTNIQRAWLQLCKLRCILHWSHIGIWAVDDSISSKIGPFVGDED------S
DENRDDSISVRLQDKALWKKSTGK---------------CSSSSSP-GEGPKSDTFDFES
EEIESGTTGESSTGESSTGESSTGESSTGESSTGESSTDDSATDESSLDGSSTNGSLTEE
SSAEESSPAASITIHGDSTPPENLHEDEGDDTITKDDKSSIKSIKNNEENSNSDDEKRKN
IPKRKAARH-------------RLQKEKLLQDLDH--LEEQFMEESAINQKEPEAFDDIV
---------------KQIESSEKASTADKNFAIDNLQSTKEQNLTISNKHKEQIRENSPS
SGLHASS--SND-----DNF--------DDAQEQQ---------------
>YNL272C
---MDA---------SEEAKRVSIQVTSLSTQLIESVDKQSHLEEQLNKSLKTIASQKAA
IENYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASL
FDEANNMVADARKEKYAIEILNKRLTEQLREKDTLLDTLTLQLKNLKKVMHSLDNESTVT
NNSNRY------STILSDSATSSST--SLNKVP--TSYSLASQ--DIYSGIVYSPSISSI
RYDISLYNEFLKFVAALPRCENIKATSTESKLIRRLVNDEIQPILKIDNASGIGWLVKKT
LLSLIIDGLVVVEPLSGVNATYQIGYNSSSP-----------------AKQATSNMP---
-------------KMFKFPLDSPPVAVHAACSFCGESRDDIIEHARMYILKTLHKTDDGK
EQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLTTQNITKEDL-EKFSEVTKH
TKR------DGRVSSQDKKTKRLSFMAGLGI-NSSTKNKPKMEIF-------SS------
ETNAKPGQPTTNIQRAWLQLCKLRCILHWTHIGIWAVDDSISSKIGPLVEDDS-------
DEDQNDAISVRLQDKALWKQDAKR---------------PFSSSSA-EESQKSDAFDFES
GDMENEITGESS------------------------------SDESSSDGSSTDNSTADS
SSEDESSLADSTTSSADSSSPESIDNGEGDDTVTKDDKSSIKSANNNEENSDCGDKKGRS
IIKKKAPQR-------------KIQKKKLLQDLDD--LEEQFREESAIDQTEFENAESNV
---------------KQNISSKRASSGDENSKKDNNEKTLKTNLTIGDKTQEQIGENSPS
SGLHASS--SND-----DNF--------DDAQEQQ---------------
>NDAI0F04230
--MPET---------SEESKRISIQVSSLSTQLIESIGKQSDLEEKLNQANRTITSQKKS
LEQSHMLEKKSIELEQSLTARTEEVNKLRERLTREIKLRESAEIEVEKLSKEVEDLTATL
FDEANNMVADARKEAHAKEILNSRLMGQLREKDNLLETLTLQLKSLKKVLQNVETE----
--NNRY------SMILPDSATISGA--SLDKVTTRTSSSFSQQ--PMNNGIIYSPNISSI
RYDLSLYEEFLKFIAVIPHCKSIKDTSSDSKLIRRLITDEISPVLKIDNANGLGWLVKKT
LLSTMMEGLVIVEPLSGINEMYQMGHTTPPLGMNT-----------QEEADAQRKVP---
-------------KMFKFPSSSPPVAVRDPCAFCGEERNDIIEHARMYLLKTQTTQDDGT
LIIANTYPLCHWCLFKIRQTCEIFAFLRSLKTDIWNLEKVPLSAISKYGS-SKFSEVTTT
NTNGSKKNIAATPKSENKKSKRMSFMAGLGRTHSSKITAARVEPHGNHNNNNTN------
SPIENIGQPTTNIQRAWLQLCKLRSILHWAHIGIWSVDDSVSTKVGPEVFTQD-----EE
FTTIDMTAEYIAQDMPLATRNLGD-----------------------ENTDAELAADVEA
TGNTTL------------------------------------------------------
QNKEEQNEDKEATSTSGSVSDSSADSKFGTPKESLESETSEEELQDESNDEGT-------
-------------------------------------NSVDIIESYDNHSKEGNVEDVTE
---------------KQSQNTNSELPSVSNKTQNAEVL---------------AYAEAPS
AETDISN--VRE----------------DSIKIKET--------------
>NCAS0A00580
--MSEQ---------SEESKRISQQVTALSTQLIESIDKQSKLEEKLNHANKIIASQQPS
LDKYSNLKVEFEKLKISSEDQQKELDNFKVKIRRERELRENAEQEVEKLSKEVEDLTATL
FDEANNMVADARKDKYTVEVLNTKLVEQLHEKDNLLETLNLQLKNLKKVLQTVEDENNSL
IGNNRY------SIIQPDSATTSSSTTSLEKITT-TVSSYSQNISNMANGIIYSPIISSI
RYDLPLYEEFLKFIAVIPHCRTIKDTSSDSKLIRRLVNDEINPVLKLDNASGLGWIVRKT
ILSTMMEGLVVVEPLSGVNETFQMGNSTQPPNAEA-----------SNKNESQSSMP---
-------------KLFKFPLTSPPIALHEPCSFCGESRDDIIEHARMYVLKTQNKQEDGT
IMVTNTFPLCHWCLFKVRQTCEIFAFLRSLKTGVWNLEKVTMKSISSKDS-SRFSVVTSA
---------IRQTKTEDRRSKRMSFIGGLTK-NSSAINTAQVE---------ST------
TSMEITGLPTTNIQRAWIQLCKLRSILHWAHVGIWSIDDSITSKIGPEIKDPD-------
DKLEPASIEANIKITKKQIEKDVE-----------------SIISE---NNQGESFDFES
SASTSGATEA--------------------------------------------------
-----------------SSEEKSIAGESETKVHASQDNSEHQSANALEQETKNNFEE---
-------------------------------------VTKKDIEQESESERKPKEAGDET
---------------LTHEPNSISPKIEEENKEDTASS--------------KASNEDDE
NGTAASS--INETDDVLDNY--------TDAND-----------------
>KLLA0C02299g
--MAD----------QEESKRISLQVTSLSTQLIESIDKQSQLEEQLLVAKKTISTQQNI
ANSYNELKQELQSLKLQYETDKTK-------FKKQEEICADAEKKVATLNQEIEDLTASL
FDEANNMVADARKEQNAVEILNSKLKEQLKEKDLLLDTLSMQLKNLKNVLYKFENDFNSS
K-----------NVSLSDSATSSTT--SIDRSTTNLTSVNDNS--LSFQGVLFSPLLHSL
RYDVPLYTEYLKFLAVLPQCENLQQTTSESKLLRRLINYEISPVLRLDNASGVGWLVKRN
LMNLMMEGLVSIEPISGINETYRTGYSSPSI---------------PDSPEVENKDS---
-------------HLFSRPVNSPPVAMVEPCAFCGENRNDILEHGRLYIFKTYQKLENGK
NELTNQFPVCHYCLLKLRQVCEIFAFLRSLRSGAWHLEKVALASIHQGKV-NAYSEVTKA
S-------------RPKMKSKRLSIFQGLKQ---SQSSTPIIEN--------GP------
QFADKNGLPTTNIQRSWARLSQLRASLQWSHIGVWSLDESVATDIAPSTDISK-------
AKSFEEEQGLGIASNNIPVPITHE---------------------------EDETFDFEA
DTANSISVDETV------------------------------------------------
----NGIRHTDQSSDDIGDHNEKTNEKTATDLQGKNEEKKSKKIEPQHSR----------
-------------------------------------QPSQSSTVLNDNKESAESAHDTH
---------------ASSEEPSDLLETYQDLSADLEPE-------------------SEK
PENLDNS--DEE-----DSF--------NDAKDVVN--------------
>AFR670W
--MSEQEDSKQMSE-QEENRRISVQVSSLSTQLIESIDKQSRLEEQLQHAKKALAAQKDV
VKQCESARGEAQQLRSQLADRDTELERQGEELEEARKARLAAELAVERLNKEIEDLTTSL
FDEANRMVSKARKEKHVVEQHNARLQEQLREKDMLLDTLTIQLKNLKDVLYKVEDEQNTR
--SRRQ------SVMDSVNPSHTSL--DVDG----YASAFDNM---LSSGLLFTPAVQSL
RYDIPMYTEYLRFLAVLPMCKSIRDTRHDSKFLRRLVSDEIQPVLRLDSATGLGWLVRRN
LMNLMIEGLVVVEPLSGINETYRMGYASPQTH--------------SHSKSSEPAAV---
-------------KMFTYPVNSPPVAIEAPCAFCSEARNDILEHGRLYVLKTLQKTETGE
LLTENQYPLCHFCLLKVRQTCEIFAFLRSLKTGSWNLENVTLSC-AKQES-DAFTQIPNS
VQASPVI--HRDENSITSSSKRLSFMSSLSRVSTTSKTTPRIEA--------VT------
DFNEKKGLPPTNVQRSWVHLCKLRASLHWSHIGVWTLDDAVQTKVVPLSPEDK------I
SSVSSESISPQDWTKLPSPQSVEN---------------SFIFQKE-DEIEEG--FDFEH
GEDTIDTLKAAP------------------------------------------------
-TQKDKSSTQSEDETAQNINKKETSLEAPVVLTDRSKKQATQLLPATQDDEA--------
-------------------------------------TEPPLPKIAAGSASPPKSDRGLC
---------------PVEKPDLVATESHDSVSSSKSKP----------------KGEDVL
TDVTDSS--EHDTNETHSSY--------HEAKESLSNTEGTITC------
>Ecym_1085
--MSDQDESKRMTEQQEESKRISIQVSSLSTQLIESIDKQSRLEEHLNQAKKALSAQKDS
ISQFDSLKQQLSDTKKQLAYTEEELAVKRRELVEAQEVRVAAERAAEKLNKEIEDLTTSL
FDEANSMVANARKEKHDVEVLNSKLQEQLREKDMLLDTLSIQLRNLKEVLYKVEDEHNTL
NSYRQS------IIMEGSNGSNA----SLDKEALGNPGLIYDH--HHHMNLLFSPLAQSL
RYDIPLYTEYLRFLAVLPMCKGIKDTRHDSKFLRRLVLDEIQPVLRLDAASGLGWLVRRN
LMNLMIDGLVVVEPLSGINETYRIGYASPQS---------------NSHKVTEVDNA---
-------------KMFNYPSNSPPVAIQDPCAFCSESRNDILEHGRLYVLKTLQKNEDGS
TTSETQYPLCHYCLLKVRQTCEIFAFLRSLKSGAWNLENVTLSCARPGS--DEFTKVDRN
STTNS----ASNKEANSTSSKRLSFMSGLSRTSSSTRMTPRIET--------VT------
DFSERKGLPSTNVQRSWVHLCKLRASLHWCHIGVWTLEDSIQLKVAPMSAQAK------V
VTSTRSSVVPQNWTEDICSPQSGE---------------NFFVFQH-EDGLEDEEFDFEN
GEKTLDTIK---------------------------------------------------
AEVIEQGISKNLENEAA------LNKKKSVETMAEPTTKPDSTVNSSSRPNV--------
----------------------VEKGTNLYEGSHP--VPPEQIEDEVDEVQESDEVKEVH
---------------EEQEKQKIPLRILNDLLIAKLQL--------------MKSIVNPS
NLNHRLN--HHA--------------------------------------
>SAKL0C02596g
--MSD----------QEESKRVSMQLSSLSTQLIESVDKQSRLEEQLRKAKKTIASQSES
AASYESLREQLEKAQQELASRSRESAELERKLAAETTARKMAQDKIDQLNKEVEDLTASL
FDEANNMVADARREKHDVEVRNSKLHEQLHEKDALLETLEMQLKNLKKVLYSLEDENSSL
AKTKRN-----SAFLSSDTATSSNV--SLEKTAT-GGTSLGEL--SGAGGVLFSPVLQSL
RYDLGLYNEFLKFVAMLPICRSIKGTTTESKLLRRLMHDEIQPVLRLDNASGLGWLVRRS
LMSLMIDGLVVVEPLSGVNETYRMGYSSPQLHAQ------------QNAHFGQERAA---
-------------HLYNYPTDSPPVAIHEACAFCSESRNDILEHGRLYVLKTLQRNEDGT
TETTNQYPLCHYCLLKVRQTCEIFAFLRSLKEGVWHLEKVTLTSIATGGS-SKFSEVTKT
P--------HTSAAKEDAKSKRMSFMAGLSR-PSTTKLMPTVEG--------AP------
NFAGQSGQPVTNIQRAWAQLCKLRASLHWAHIGVWSIEDSVALRIGPLMPEEK---TEQV
EGSSASSMGREEWVP--MESPDDE---------------SFALQKD-EDAESAETFDFEK
GDTTGDTTGGTI-------------------------------------QAHGDLQGSLQ
ESLHGDLQTKPQEDTSTTHDPAKTDDQTPIQIDDSLEHAPDDSSVQDKKEEESKDTPRLT
RKPSAISRK-------------KLQTGKLFEGLDA--LSEGFKQDMDKGLGLDKPTLAEH
---------------TQQEVPTSSPKESEGESTALKES----------------------
ADSDANG----------EEF--------DDALTGQE--------------
>KLTH0F02354g
--MTE----------EEESKRVSVQVSSLSTQLIESIDKQSHLEEQLLQARKVIASQRES
LQNYEDLRQQLEQAESNLKSERSQNIKIQEELQAARSGKLTAEGEIDRLNKEVEDLTASL
FDEANNMVADARRETHSVQVKNSKLAEQLQEKETLLETLEIQLKNLKKVLYNLEEESNDR
LKSNQA------SVAAEDSVASSSES-ALEKT---MNALNGTA--SPPSPALFSPLLKSL
RYDLVLYNEFLKFIAALPQCASIRDSTSYSKLLRRLIHDEIQPVLRLDNASGIGWYLRRN
LMSLMIDGSIVVEPVSGINETYRVGHMSSQVEAVP-----------QFQGPEQQSRP---
-------------HLYNYPADSPPVAIESPCSFCSESRNDILEHGRLYVLKTLQKMENGI
TETSSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLEAVTISKTN-----NAFSVQTNS
VSNSPTLESPPDKMKPDRKSKRMSFMAGLSK-TLPLKTSYTVES--------AS------
PCPEQITTPTTNIQRAWAQLCKLRSSLHWAHIGIWTLEDVVETKVGPVVAVDR-------
--PGNDSIVGDGLVPELGQEARES----------------FSLHNE-EEVDNEEGFDFEK
MNSTLESAGLEG---------------------------------------------KET
SQTTQTSSGNPTTLDPRTSEGGDAGAKIGASFVQTIADSDTGASSPIQESQTKTARTVEK
KAAVPGSIDLD-----------EQNYAQNVEAPAR--MVKSRTSEAPNGEGTAENIIELV
---------------AESDTKKITGKAPESASSDHAKS------------------RSEL
PSQSATD--DEE-----AGF--------DDARSTFS--------------
>Kwal_33.13389
--MTE----------EEESKRVSVQVSSLSTQLIESIDKQSHLEEQLLQARKVISSQRDA
LKSYESVGKRLEETEAELESVRAQNAKDKEALKAAQSETEAAKDEVSRLNKEVEELTASL
FDEANNMVADARKETHSIQVKNIKLTEQLQEKSSLLETLEIQLKNLKKVLYDLEEESNSR
LQSNRS------PVMDTSDNSTVSSAIALENT---MHALNGTA--RSPNNVLFSPVLKSL
RYDLNLYNEFLKFIAALPTSASIKDTASESKLLRRLVHDEIQPLLRLDNASGLGWYFKRS
LMTLMMDGLVVVEPVSGINETYRVSHASGVENTKL-----------QRPRSEQRIEG---
-------------HLYNYPADSPPVAIQDPCSFCSESRNDILEHGRLYVLRTLQKTEEGT
TEVNSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLESVTVDANSQRSS-TEFKSQSKL
STPERG---SERKVKSDRKSKRLSIMAGLTK-SFPSKTSYAIEE--------TP------
GSNSQVTTPTTNIQIAWAQLCKLRSTLHWTHIGIWSIGDSVETKLGPMTFPDS------A
EAVASSSNEVLTHLQSLASSNNDE-------------------------------FDFEK
TTNSSELVD---------------------------------------------------
PDVHEEKIMSKSEVSTPTLSPTVIAAPNESETHSADQKSKV-------------------
----------------------EQENGDAVVLLRQ--EEPEILNHVTLGSSSEEDQKPDT
---------------GHQQSEEKSEEQIAALDNHANSS--------------HSEIENDA
PKSQNIT--DDE-----TVF--------DDARSGLSQA------------