MUSCLE (3.8) multiple sequence alignment

KNAG0G03480        MVFYKVTLARSLIGMPRATRQIVKTLGLGKRGSTVYKRATPAIAGSLLKVKELITVEVSP
KAFR0A02870        MVYYRATLVRSLIGLPKTTRTIVKTLGFTKRGSTIYRKVTPAITGSLLKVKELISLKLTE
TBLA0B02910        -MFYKITLQRSLIGLPQKSRSIVKSLGLGKRGSIAYQKISPSTAGAILRVKELVDVELTD
CAGL0I02706g       MAYYKVTLVRSLIGTPEATRNIVKAIGLGKRGSVVYRKVSPSMAGSLAKIKELISVDVTK
KLLA0C06270g       MVFYRITLQRSVIGTPQKTRAVVKSLGLGKRGSVAYQPATPSIAGAVAQIKELVSVELAD
Ecym_4624          MVFYKIVLSRSTIGMPAKTRAVVKSLGLGKRGSVVYHSVSPTVAGAIAKVKELVNVEVTD
Kpol_237.2         MAFYKITLTRSLIGLPQATRNIVKTIGLGKRGSIVYREVTPSIAGSLAKVKELVSVELSD
TPHA0I00330        MVFYKITLARSLIGTPPYIKNVVKAIGLGKRGSVVYREATPAMAGTLAMVKEIVKVEVTE
NCAS0B00260        MVYYKITLARSVIGLPQATRDIVKTLGLGKRGSVIYRQVTPAIAGSMIKVKEIIDVEVTK
NDAI0E00250        MVFYKITLQRSLIGLPKQTRTIVKTIGLGKRGSIVYRRVTPAMAGSLAKVKELIDVEITE
AFR450C            MVFYKITLARSTIGLPDKVKGVVHSLGLGKRGTTVYRKVSPGSAGSIAKIKELVKVEVTE
SAKL0D01144g       MVFYKITLARSTIGLPKATKSIVKSLGLGKRGSTVYRRVTPSIAGSITKIKELVDLEVTE
KLTH0C03630g       MVFYKITLSRSTIGLPKATKSVVSSLGLGKTGSVVYRQVTPSIAGSIAKVKEVVRVEVTE
Kwal_27.10209      MVFYKITLTRSTIGLPKAVKDVVSSLGLGKTGSVVYRQVSPSIAGSIAKIKEVVKVDVAE
TDEL0B00200        MAFYKITLARSVIGTPHTTKSIVKSLGLGKTGSIVYKQVTPACAGALAKVKELVKVEVTE
ZYRO0C14894g       MVFYKVTLSRSLIGVPHTVRNVVKSLGLGKRGSTVYRRVTPQCAGSLAKVKELVNVEVTQ
Smik_13.502        MAFYKIALKRSLIGVPHTTKSIVKSLGLGKRGSIVYKRVNPAIAGSLAKVKELVTVKVTK
Skud_13.459        MVFYKITLNRSLIGMPHTTKSIVKSLGLGKRGSIAYKRVNPAIAGSLAKVKELIMIEVTE
Suva_13.476        MVFYKITLSRSLIGMPHTTKSVVKSLGLGKRGSIVYKRVNPAIAGSLAKVKELVTVEVTE
YMR286W            MVFYKVTLSRSLIGVPHTTKSIVKSLGLGKRGSIVYKKVNPAIAGSLAKVKELVKVEVTE
                     :*. .* ** ** *   . :* ::*: * *:  *.  .*  :*::  :**:: :.:: 

KNAG0G03480        QKVSKGEMRLARKSNPGYVVEAQS---------
KAFR0A02870        KSVTKAEQREIRKSNPGYIVEKRIP--------
TBLA0B02910        KALTKAEVHDSRRSNPGFIIEKRVST-------
CAGL0I02706g       SRLTKQQQRELRKTNPGFTVEKQEDGLLE----
KLLA0C06270g       KALSKAEQRELRKSNPGFTVEKRV---------
Ecym_4624          KALSKEEQRQLRTSNPGYTVEKRL---------
Kpol_237.2         KMLTREEVNASRKSNPGFTVEKRVNV-------
TPHA0I00330        NQLSKEQQRELRKSNPGFTVQKRETISN-----
NCAS0B00260        DSLNKFEQRQLRKSNPGFVVEKRSDLLG-----
NDAI0E00250        KALNKMEQRELRKSNPGFTIEKRNLNGIIDDTL
AFR450C            HALTKEEQRMLRKSNPGFTVEKRV---------
SAKL0D01144g       KALSKEEQRELRKSNPGFVVEKRL---------
KLTH0C03630g       HALTKEQQRELRKSNPGFTVEKRV---------
Kwal_27.10209      QALSKEQQRELRKSNPGFIVEKRL---------
TDEL0B00200        NKLSKEEQRELRKSNPGFIVEKRQLL-------
ZYRO0C14894g       HALTKEQQRELRKSNPGFTVEKRV---------
Smik_13.502        HELTPSQQRVLRMSNPGFVVEKRS---------
Skud_13.459        HELTSTQQRELRKSNPGFVVEKR----------
Suva_13.476        HELTPYQQRELRKSNPGFVVEKR----------
YMR286W            HELTPSQQRELRKSNPGFIVEKRTID-------
                     :.  : .  * :***: :: .          

FASTA FORMAT for MUSCLE Version 3.6

>KNAG0G03480
MVFYKVTLARSLIGMPRATRQIVKTLGLGKRGSTVYKRATPAIAGSLLKVKELITVEVSP
QKVSKGEMRLARKSNPGYVVEAQS---------
>KAFR0A02870
MVYYRATLVRSLIGLPKTTRTIVKTLGFTKRGSTIYRKVTPAITGSLLKVKELISLKLTE
KSVTKAEQREIRKSNPGYIVEKRIP--------
>TBLA0B02910
-MFYKITLQRSLIGLPQKSRSIVKSLGLGKRGSIAYQKISPSTAGAILRVKELVDVELTD
KALTKAEVHDSRRSNPGFIIEKRVST-------
>CAGL0I02706g
MAYYKVTLVRSLIGTPEATRNIVKAIGLGKRGSVVYRKVSPSMAGSLAKIKELISVDVTK
SRLTKQQQRELRKTNPGFTVEKQEDGLLE----
>KLLA0C06270g
MVFYRITLQRSVIGTPQKTRAVVKSLGLGKRGSVAYQPATPSIAGAVAQIKELVSVELAD
KALSKAEQRELRKSNPGFTVEKRV---------
>Ecym_4624
MVFYKIVLSRSTIGMPAKTRAVVKSLGLGKRGSVVYHSVSPTVAGAIAKVKELVNVEVTD
KALSKEEQRQLRTSNPGYTVEKRL---------
>Kpol_237.2
MAFYKITLTRSLIGLPQATRNIVKTIGLGKRGSIVYREVTPSIAGSLAKVKELVSVELSD
KMLTREEVNASRKSNPGFTVEKRVNV-------
>TPHA0I00330
MVFYKITLARSLIGTPPYIKNVVKAIGLGKRGSVVYREATPAMAGTLAMVKEIVKVEVTE
NQLSKEQQRELRKSNPGFTVQKRETISN-----
>NCAS0B00260
MVYYKITLARSVIGLPQATRDIVKTLGLGKRGSVIYRQVTPAIAGSMIKVKEIIDVEVTK
DSLNKFEQRQLRKSNPGFVVEKRSDLLG-----
>NDAI0E00250
MVFYKITLQRSLIGLPKQTRTIVKTIGLGKRGSIVYRRVTPAMAGSLAKVKELIDVEITE
KALNKMEQRELRKSNPGFTIEKRNLNGIIDDTL
>AFR450C
MVFYKITLARSTIGLPDKVKGVVHSLGLGKRGTTVYRKVSPGSAGSIAKIKELVKVEVTE
HALTKEEQRMLRKSNPGFTVEKRV---------
>SAKL0D01144g
MVFYKITLARSTIGLPKATKSIVKSLGLGKRGSTVYRRVTPSIAGSITKIKELVDLEVTE
KALSKEEQRELRKSNPGFVVEKRL---------
>KLTH0C03630g
MVFYKITLSRSTIGLPKATKSVVSSLGLGKTGSVVYRQVTPSIAGSIAKVKEVVRVEVTE
HALTKEQQRELRKSNPGFTVEKRV---------
>Kwal_27.10209
MVFYKITLTRSTIGLPKAVKDVVSSLGLGKTGSVVYRQVSPSIAGSIAKIKEVVKVDVAE
QALSKEQQRELRKSNPGFIVEKRL---------
>TDEL0B00200
MAFYKITLARSVIGTPHTTKSIVKSLGLGKTGSIVYKQVTPACAGALAKVKELVKVEVTE
NKLSKEEQRELRKSNPGFIVEKRQLL-------
>ZYRO0C14894g
MVFYKVTLSRSLIGVPHTVRNVVKSLGLGKRGSTVYRRVTPQCAGSLAKVKELVNVEVTQ
HALTKEQQRELRKSNPGFTVEKRV---------
>Smik_13.502
MAFYKIALKRSLIGVPHTTKSIVKSLGLGKRGSIVYKRVNPAIAGSLAKVKELVTVKVTK
HELTPSQQRVLRMSNPGFVVEKRS---------
>Skud_13.459
MVFYKITLNRSLIGMPHTTKSIVKSLGLGKRGSIAYKRVNPAIAGSLAKVKELIMIEVTE
HELTSTQQRELRKSNPGFVVEKR----------
>Suva_13.476
MVFYKITLSRSLIGMPHTTKSVVKSLGLGKRGSIVYKRVNPAIAGSLAKVKELVTVEVTE
HELTPYQQRELRKSNPGFVVEKR----------
>YMR286W
MVFYKVTLSRSLIGVPHTTKSIVKSLGLGKRGSIVYKKVNPAIAGSLAKVKELVKVEVTE
HELTPSQQRELRKSNPGFIVEKRTID-------