MUSCLE (3.8) multiple sequence alignment

CAGL0M03047g       MLKRPNTPTMKSIRNFPFSKLLFKLTKLTIIFQVLYIY-FTPKVEDLNKENLTKLLP---
TBLA0B03300        ---------------MNFSTNEIRTVKLILIFWLIYIF-NSNSIKLLNDQSFNYFNKHIQ
KLLA0D01430g       ---------------MILLRGLNKFVLWYLVFLVIYGC-LTKTIKEHNRWYFHELVSESM
Kpol_1068.4        ---------------MSWMSFVFKAIKLYFLLWCGYVW-FAGAIRGENARQVRGPGY---
ABL120W            -----------------MFGSFFAVVKLYLLLLAVYCW-SRRRLERHNTQVFERLVG---
Ecym_4617          -----------------MFGSFFAVIKLYLVLLAVYCG-SYKHLETHNSKVYEYLVG---
SAKL0D01320g       ---------------MRVVEVVAKLLKAYALLSVLYIC-VSQRIAAHNRQVFRNVFP---
KLTH0C03740g       ------------------MRILKVVCKLLAVLCILYFA-SSARIKASNEQAFTTLFS---
Kwal_27.10227      ------------------MGAFRTVFKVSGILWLVYIL-GSVQIERSNRRALGSLFR---
KAFR0B03960        --------------MIHISKLIFKITKLTLIFWCLYIV-LSPKIQLSNDQILNTFIPSLI
KNAG0J00240        ------------MFRFNFSRFIYKVTKLSLLLGILYIYASTSKIGSFNYTNLETL-----
NDAI0K00330        -------------MSLRFSKFTYKSFKLFLLLWMFYMI-STQKISSYNKKSFDNSVLNQI
NCAS0C00380        ----------MFLSNFSFSKLIFKVTKLFLVLWLLYLL-SSNRIEQFNTLNYSQLNTKIF
TPHA0I00280        ------------------MGILFKLFKCYCILSILYIW-LTPHIEDLNLKSFYSNVQLNI
Suva_13.470        ---------MSKRVKVCFSKLLFKITKLAIVLTVLYIY-FTPKILSRNTDSLQHVFP---
Skud_13.453        ---------MSRRVKVNFSKLVYKITKLAIVLTILYIF-FTPKIISRNDELLQHVFP---
YMR281W            -------MKMLRRTKVNFSKLLYKITKLAIVLTILYIY-FTPKIVSRNNASLQHIFP---
Smik_13.494        -------MKMPRRVRVNFSKLLYKITKLSIVLTILYIY-FTPKIISRNNESLQHVFP---
ZYRO0G14300g       ------------------MVVAIKFPKVYFLLWVLFIA-FSVRIKSRNGSVFNDNLK---
TDEL0B00520        ---------------MNVSGGAVKVFKLLFFLSILYVA-LTARINGRNEVQWQQHAA---
                                                 .:   :       :   *            

CAGL0M03047g       THDNF---------GVLNLVIAHPDDEIMFFSPTILQLIDHV-----QELNVVCLSNG--
TBLA0B03300        LMSNKQHVKI----NSLSLIIAHPDDEIMFFSPTLLQLNNYL--EKDIMFNVVCLSQGLD
KLLA0D01430g       VSKL----------TSVTLVVAHPDDEVMFFSPTLTQFNELL--PISIPINVVCMTAG--
Kpol_1068.4        FSGS----------SSVNLVIAHPDDEVMFFSPTLMQLDNWL--PNDVAINVICFSKGVN
ABL120W            GDSQH---------TSLTLVIAHPDDEVMFFAPTLLQLDARL--PAWMPFRVVCLTDG--
Ecym_4617          SHGNY---------TSVTLIIAHPDDEVMFFAPTLLQLDARM--AQSVPFRVVCLTDG--
SAKL0D01320g       SRTP----------TSVNLIVAHPDDETMFFSPTLLQLHVNY--PPSVPLRVICLTNG--
KLTH0C03740g       VLNP----------TSINLVIAHPDDEVMFFAPTLLQLDHYF--DTDIPVSVFSLTDG--
Kwal_27.10227      GSAP----------TSINLVIAHPDDEVMFFAPTLLQIDEWL--PGSIEVNVISLTDG--
KAFR0B03960        KDRSND--------PSLTLVVAHPDDEVMFFSPTLLQLDSHL--PPNCKFNIISYSDG--
KNAG0J00240        GEHDI---------NSVNLVIAHPDDEVMFFAPSLINLNEQIRDPSTV-FNIICFSNG--
NDAI0K00330        LRQDHSHADISEPITQLSLVIAHPDDELMFFAPTLLQLNRFL--PTSIPFNIICFSDG--
NCAS0C00380        HEG-----------TTLNLVIAHPDDEVMFFAPTLLQLDNLM--PLSIPINVICFSNG--
TPHA0I00280        SQQSL---------KSVNLIIAHPDDEVMFFTPTLLQLDDIL--PTHVPFNVICLSKGVD
Suva_13.470        HRDRN---------SQINLVIAHPDDEVMFFSPVISQLHAYF--PDTVPFNILCLSKG--
Skud_13.453        HKNRD---------SQINLVIAHPDDEVMFFSPVISQLHSYF--PITVPFNIICLSKG--
YMR281W            HKYGD---------YEINLVIAHPDDEVMFFSPIISQLNSYF--PRTVPFNIICLSKG--
Smik_13.494        NKYSD---------YQINLIIAHPDDEVMFFSPMISQLHSYF--PNTVPFNIICLSKG--
ZYRO0G14300g       FLDEI---------DSLSLVVAHPDDEVMFFAPTILELDSRL--PPNVEFNVVCLSKG--
TDEL0B00520        AIGTP---------ESLTLLIAHPDDEVMFFSPSLLQLDRLL--PQSVRFNFVCLSKG--
                                   :.*::****** ***:* : ::           . ... : *  

CAGL0M03047g       -DADGLGELRAKELKDAIGYLTVNRNL----RNVSLNILDYTDGQNEVW--SGVATDLKK
TBLA0B03300        STGSFKDPQRVHELNDSLNLLFNRGSNNEHNRNFKLIQLDYTDGMKEIWNMDLIVDDLLQ
KLLA0D01430g       -DADGLGHIRKQELVDSLRIMF-HG------RQFGCDVLDFEDGMDAVWDQVLLEKQLRS
Kpol_1068.4        VDGSIAGESRARELKKSVSMLIEHD------RPVTVHQLDYKDGKDQIWDLDSMVWDLKT
ABL120W            -GAEGLGQLRRAELQKALRLLV-LE------HDVTLEVADFTDGMKEDWDLAEVRTRLGE
Ecym_4617          -DADGLGEVRRRELHKALRLLV-LE------RDVEIQMGGFKDGMDEEWKMEVVREELAQ
SAKL0D01320g       -DADGLGAVREQELRLSMQLLL-PA------RNTSVIVEGFEDGMGVEWDTRQVVATINR
KLTH0C03740g       -GADGLGKLREEELRDSVHLLF-RR------RKAEVTVLNFEDGMKVEWDLQKTSEALRK
Kwal_27.10227      -GADGLGDLRTKELQDCVRLLL-RK------RKASVEVLDFLDGMDVEWDLERAVKALQE
KAFR0B03960        -DAEGLGSLRSNELAHSIDMLI-PR------RNKEIFIFNHTDGMNEVWDNKLMLHQLES
KNAG0J00240        -GADGLGNVREQELSDSIAMLL-PT------RNTSIVVLDFKDGMKEKWDVKEMIAKLRN
NDAI0K00330        -DAEGLGYLRRKELHDSINLLL-SSSN---NRKINISILDFIDGMDQVWDGKQLLSSLQN
NCAS0C00380        -DAQGLGEKRQHELQSSIHALIQNQ------RQTNVTVLHFQDGNDQIWDIDQMTQYLPQ
TPHA0I00280        VDGRAVGDLRSNEIMDSLTMLL-GHRRAGLNREVKLHQFEYEDGMDKQWDISKVVTDIQN
Suva_13.470        -DAEGLGETRAKELNDSAVLLLRNE------RPVSVQVMDFEDGMDEVWDIDSITSTLSQ
Skud_13.453        -NADGLGESRVKELNGSAALLLQNE------RPVSVQVMDFEDGMDEVWDINSIVSTISQ
YMR281W            -NAEGLGETRVRELNESAALLLHNE------RAVSVQVMDFQDGMDEIWDIDSITSSLSQ
Smik_13.494        -NAEGLGQTRVRELNDSAALLLHNE------RAVSVQVMDFQDGMNEVWDIDSITSTLSQ
ZYRO0G14300g       -GADELGDTRVQELKESVNLLL-ANSK----RQYQLQQHDYPDGHEETWDQESVQSTIKD
TDEL0B00520        -DADHLGETRELELQRSLNLLT-SNSQ----RKTQLYQFDYPDGFDEKWEIESVVSIVES
                     .   .  *  *:  .   :          .        . **    *        :  

CAGL0M03047g       YILTSEPGVKQKDIILTFDREGISGHRNHIACNEGVISYLKT---------IKSNSFVFL
TBLA0B03300        NLNFTD---NGINLLLTFDKSGVSNHKNHLACNEAVTKLLKY--------SNPDSNLIGI
KLLA0D01430g       SIP------DSNPLVLTFDQFGVSGHINHISCGRLVEKL---------------PYSHKL
Kpol_1068.4        LINPSKDY-KRKDLLITFDEHGVSDHPNHIACHNAVHRLIEE-----------EPLFMAY
ABL120W            LVT------DAKPLVLTFDERGVSGHRNHIGCALAAARL----------------GHKTL
Ecym_4617          VVT------DRRPLVLTFDERGVSGHRNHIACAHAAAKL----------------GHHTL
SAKL0D01320g       HVS------DASPLLLTFDEHGVSGHVNHVSCNTAVSALVEQ-------REQREQRFTAL
KLTH0C03740g       QVV------GDQPLFLTFDDHGVSSHINHISCYETVRNLRAA-----------HPESRSF
Kwal_27.10227      RIL------DESPLFLTFDENGISGHVNHISCYKAVQKVRKH-----------YSKSSCF
KAFR0B03960        ILSD-----SQTNILLTFDQFGVSNHINHKACHQVVTSYIQS----------HAKNNFAL
KNAG0J00240        IVPK-----LGHNVLLTFDGKGVSGHLNHIACYRAALGYYNE--------FKSKQKLTVL
NDAI0K00330        ELLVNVPPSIKNNILLTFDANGISNHPNHIACNKAVHDLISY-----DGGKDKEMNIIGL
NCAS0C00380        ---------NDHQAFLTFDSHGVSGHKNHIACHNAVWNLKNT-----------NNNVTIL
TPHA0I00280        TISMESNVDGLKHWLLTFDAQGVSEHPNHIACYDAMMTLKQK--------SSNPGDYLLM
Suva_13.470        TIDVNNE--KVSQIIVTFDSYGVSNHINHKSCHIAVEKFIDDYVGSKTKEKAENAHITAL
Skud_13.453        TIDLSNE--QLNQIIVTFDSYGVSDHINHKSCHTAVKRLIDRYAESKAETNEETPHITAL
YMR281W            KIDIKNH--NLNQIIVTFDSYGVSNHINHKSCYAAVKKLVDDYAQPKTKRNEQPPHVTAL
Smik_13.494        TIGINNN--ELNQIIVTFDSYGVSGHINHKSCHTAVRKLIADYTRSNVRKEVKTPLITAL
ZYRO0G14300g       SVLQG----RRSSVLLTFDDKGVSKHVNHIACHEAVSNLVQD----------ESNVKAAL
TDEL0B00520        KVFIG----SGFNLLLTFDAHGVSNHPNHVACHNAVARLIEK-------------GHKAL
                                 .:***  *:* * ** .*                            

CAGL0M03047g       ELKSL-----STWQIISKYSGVVPKLLE-----------IIYNKIRASN--KTFVSYLPN
TBLA0B03300        FLNS------HSKNFFLKYSFFVSKLFTIIKLKFFRSISLFYSFCFPNSDFLQSYQIISH
KLLA0D01430g       HLRS-------DQPIYVKYSAFIAGIFQ-----------LGISTVYPDY-----------
Kpol_1068.4        QLES------HSTNVILKYSFFAREIVK-----------YFYNYCHQRIKGQTSLN----
ABL120W            FLRS-------ERNLLRKYSFFVLDVFR-----------VVFGT----------------
Ecym_4617          HLDS-------GHNLIRKYSFFFVDLFR-----------LLFGY----------------
SAKL0D01320g       YLNS-------KRYFPPKYGSFAVDLAR-----------IITG-----------------
KLTH0C03740g       SLTS-------KRSIFQKYTAFVPSLIT-----------VLRG-----------------
Kwal_27.10227      KLVS-------KRYLFEKYSGFIPALFH-----------SFIS-----------------
KAFR0B03960        LLDS------YSSNLLKKYTGFAWQLVF-----------LAKNYWIHGK-----------
KNAG0J00240        SLQS------YSKNIVKKYSSYIWELIK-----------LLYSSWVPSR-----LGNVLP
NDAI0K00330        MLSSKSDEYNIVMNLLSKYTFFVIDLVK-----------VYWNLATGTF----------N
NCAS0C00380        TLDS------IHHSLLAKYTFFIIDLVK-----------LYWNLWKDQQ-----------
TPHA0I00280        TLNS------YGSNIILKYSSFLPVVFK-----------LLINIINDKF-RIFELKQVPF
Suva_13.470        YLRS------YKNNIFLKYNSFIWEILK-----------MLYRTVSPFG---RSIQPLAA
Skud_13.453        YLKS------YKNNIVLKYNSFIWEILK-----------ILYSVIVPFP---KTIQ---P
YMR281W            YLRS------YKNNIVLKYNSFIWEILK-----------ILYDLISPFR---RIIQAL-P
Smik_13.494        YLRS------YKNNIVLKYNSFIWEILR-----------MLYGLISPFR---KTTQAL-P
ZYRO0G14300g       YLDS------YGDNIVLKYSAFFWEIWK-----------LTRD-W---F--LHRVLPTSS
TDEL0B00520        YLNS------HSRNLPLKYSGFIWELIR-----------MLSDSVMKLE-----------
                    * *          .  **      :                                  

CAGL0M03047g       RDSIATDS-NVCFISTFDQYALSFAAMCYAHKSQMVWFRYLWWSFSRYVFVNDLSRITV-
TBLA0B03300        YDLNTKTNLSFTFFNPFAKYMLSYSTMLNAHESQMVWFRYLWWIFSRFAFINDLTIVN--
KLLA0D01430g       ------GK-PRCFISTLPQYLLAASAMSLAHTSQMVWFRVGWWLFSRFCFINELITSI--
Kpol_1068.4        -KNMDVPY-EYVLFNTHSEYIMAYATMLNAHESQVVWFRYGWWFFSRLTYANELKLFKGQ
ABL120W            ------PP-PTVFVSTLAQYLHALVAMVVAHRSQMVWFRWGWWMASRYVYANEY------
Ecym_4617          ------PM-PTVFLSTFSQYLHSLVTMLVAHKSQMVWFRWGWWTASRYVYANEF------
SAKL0D01320g       ------RQ-PPVFMSTFPQYLLSLAAMCNAHVSQMVWFRWGWWLASRFVFVNELHG----
KLTH0C03740g       ------SR-QAVFMSTFKQYLLALSVMMNAHTSQMVWFRYGWWFFSCYVFANEVREF---
Kwal_27.10227      ------SS-PSTLINSFRQYLLALSSMMNAHVSQMVWFRYGWWLFSYYVYANELQAF---
KAFR0B03960        --TLPNLD-HLALFNPYSDYITAYATMLKAHKSQMVWFRYGWWFFSRFVYVNDLKLYTH-
KNAG0J00240        KRGSNVAR-KITIFSTYPQYVLSLAAMLNAHKTQVVWFRYGWWFFSRLVFVNDLDVISS-
NDAI0K00330        TIPNSASL-ELSFINTYSQYILSYASMLNTHKSQMVWFRYGWWWFSRFVFSNDLLVVSNI
NCAS0C00380        QPQWESHD-KITFFNAYSQYILAYSTMLNAHKSQVVWFRYGWWAFSRFVFSNHLKITT--
TPHA0I00280        LSMHKEHD-QIQFINTFPHYIMALSSMLNSHTSQMVWFRYGWWSFSRFVFVNDLHIIDL-
Suva_13.470        PSTTTEKN-GLLLMNTHSQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDIFTY-
Skud_13.453        PTTTTQRS-KLLLMNTHAQYVLAYAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDVYTY-
YMR281W            PNTAAEKD-KLSLMNTHAQYVLAFATMLNAHESQVVWFRYGWWIFSRFVFVNEFDVYTY-
Smik_13.494        SDVVAEKN-SLLLMNTHAQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDVYIY-
ZYRO0G14300g       YNENKPAT-EITLMSDYSSYILSFASMLHSHKSQMVWFRYGWWTFSRFVFVNDLKVVNK-
TDEL0B00520        ------RT-GLTFMNSFPQYILAFAAMANAHESQLVWFRYGWWSLSRFVFVNDLEIVI--
                               :..    *  :   *  :* :*:****  **  *   : *        

CAGL0M03047g       ---
TBLA0B03300        ---
KLLA0D01430g       ---
Kpol_1068.4        IIN
ABL120W            ---
Ecym_4617          ---
SAKL0D01320g       ---
KLTH0C03740g       ---
Kwal_27.10227      ---
KAFR0B03960        ---
KNAG0J00240        ---
NDAI0K00330        NNV
NCAS0C00380        ---
TPHA0I00280        ---
Suva_13.470        ---
Skud_13.453        ---
YMR281W            ---
Smik_13.494        ---
ZYRO0G14300g       ---
TDEL0B00520        ---
                      

FASTA FORMAT for MUSCLE Version 3.6

>CAGL0M03047g
MLKRPNTPTMKSIRNFPFSKLLFKLTKLTIIFQVLYIY-FTPKVEDLNKENLTKLLP---
THDNF---------GVLNLVIAHPDDEIMFFSPTILQLIDHV-----QELNVVCLSNG--
-DADGLGELRAKELKDAIGYLTVNRNL----RNVSLNILDYTDGQNEVW--SGVATDLKK
YILTSEPGVKQKDIILTFDREGISGHRNHIACNEGVISYLKT---------IKSNSFVFL
ELKSL-----STWQIISKYSGVVPKLLE-----------IIYNKIRASN--KTFVSYLPN
RDSIATDS-NVCFISTFDQYALSFAAMCYAHKSQMVWFRYLWWSFSRYVFVNDLSRITV-
---
>TBLA0B03300
---------------MNFSTNEIRTVKLILIFWLIYIF-NSNSIKLLNDQSFNYFNKHIQ
LMSNKQHVKI----NSLSLIIAHPDDEIMFFSPTLLQLNNYL--EKDIMFNVVCLSQGLD
STGSFKDPQRVHELNDSLNLLFNRGSNNEHNRNFKLIQLDYTDGMKEIWNMDLIVDDLLQ
NLNFTD---NGINLLLTFDKSGVSNHKNHLACNEAVTKLLKY--------SNPDSNLIGI
FLNS------HSKNFFLKYSFFVSKLFTIIKLKFFRSISLFYSFCFPNSDFLQSYQIISH
YDLNTKTNLSFTFFNPFAKYMLSYSTMLNAHESQMVWFRYLWWIFSRFAFINDLTIVN--
---
>KLLA0D01430g
---------------MILLRGLNKFVLWYLVFLVIYGC-LTKTIKEHNRWYFHELVSESM
VSKL----------TSVTLVVAHPDDEVMFFSPTLTQFNELL--PISIPINVVCMTAG--
-DADGLGHIRKQELVDSLRIMF-HG------RQFGCDVLDFEDGMDAVWDQVLLEKQLRS
SIP------DSNPLVLTFDQFGVSGHINHISCGRLVEKL---------------PYSHKL
HLRS-------DQPIYVKYSAFIAGIFQ-----------LGISTVYPDY-----------
------GK-PRCFISTLPQYLLAASAMSLAHTSQMVWFRVGWWLFSRFCFINELITSI--
---
>Kpol_1068.4
---------------MSWMSFVFKAIKLYFLLWCGYVW-FAGAIRGENARQVRGPGY---
FSGS----------SSVNLVIAHPDDEVMFFSPTLMQLDNWL--PNDVAINVICFSKGVN
VDGSIAGESRARELKKSVSMLIEHD------RPVTVHQLDYKDGKDQIWDLDSMVWDLKT
LINPSKDY-KRKDLLITFDEHGVSDHPNHIACHNAVHRLIEE-----------EPLFMAY
QLES------HSTNVILKYSFFAREIVK-----------YFYNYCHQRIKGQTSLN----
-KNMDVPY-EYVLFNTHSEYIMAYATMLNAHESQVVWFRYGWWFFSRLTYANELKLFKGQ
IIN
>ABL120W
-----------------MFGSFFAVVKLYLLLLAVYCW-SRRRLERHNTQVFERLVG---
GDSQH---------TSLTLVIAHPDDEVMFFAPTLLQLDARL--PAWMPFRVVCLTDG--
-GAEGLGQLRRAELQKALRLLV-LE------HDVTLEVADFTDGMKEDWDLAEVRTRLGE
LVT------DAKPLVLTFDERGVSGHRNHIGCALAAARL----------------GHKTL
FLRS-------ERNLLRKYSFFVLDVFR-----------VVFGT----------------
------PP-PTVFVSTLAQYLHALVAMVVAHRSQMVWFRWGWWMASRYVYANEY------
---
>Ecym_4617
-----------------MFGSFFAVIKLYLVLLAVYCG-SYKHLETHNSKVYEYLVG---
SHGNY---------TSVTLIIAHPDDEVMFFAPTLLQLDARM--AQSVPFRVVCLTDG--
-DADGLGEVRRRELHKALRLLV-LE------RDVEIQMGGFKDGMDEEWKMEVVREELAQ
VVT------DRRPLVLTFDERGVSGHRNHIACAHAAAKL----------------GHHTL
HLDS-------GHNLIRKYSFFFVDLFR-----------LLFGY----------------
------PM-PTVFLSTFSQYLHSLVTMLVAHKSQMVWFRWGWWTASRYVYANEF------
---
>SAKL0D01320g
---------------MRVVEVVAKLLKAYALLSVLYIC-VSQRIAAHNRQVFRNVFP---
SRTP----------TSVNLIVAHPDDETMFFSPTLLQLHVNY--PPSVPLRVICLTNG--
-DADGLGAVREQELRLSMQLLL-PA------RNTSVIVEGFEDGMGVEWDTRQVVATINR
HVS------DASPLLLTFDEHGVSGHVNHVSCNTAVSALVEQ-------REQREQRFTAL
YLNS-------KRYFPPKYGSFAVDLAR-----------IITG-----------------
------RQ-PPVFMSTFPQYLLSLAAMCNAHVSQMVWFRWGWWLASRFVFVNELHG----
---
>KLTH0C03740g
------------------MRILKVVCKLLAVLCILYFA-SSARIKASNEQAFTTLFS---
VLNP----------TSINLVIAHPDDEVMFFAPTLLQLDHYF--DTDIPVSVFSLTDG--
-GADGLGKLREEELRDSVHLLF-RR------RKAEVTVLNFEDGMKVEWDLQKTSEALRK
QVV------GDQPLFLTFDDHGVSSHINHISCYETVRNLRAA-----------HPESRSF
SLTS-------KRSIFQKYTAFVPSLIT-----------VLRG-----------------
------SR-QAVFMSTFKQYLLALSVMMNAHTSQMVWFRYGWWFFSCYVFANEVREF---
---
>Kwal_27.10227
------------------MGAFRTVFKVSGILWLVYIL-GSVQIERSNRRALGSLFR---
GSAP----------TSINLVIAHPDDEVMFFAPTLLQIDEWL--PGSIEVNVISLTDG--
-GADGLGDLRTKELQDCVRLLL-RK------RKASVEVLDFLDGMDVEWDLERAVKALQE
RIL------DESPLFLTFDENGISGHVNHISCYKAVQKVRKH-----------YSKSSCF
KLVS-------KRYLFEKYSGFIPALFH-----------SFIS-----------------
------SS-PSTLINSFRQYLLALSSMMNAHVSQMVWFRYGWWLFSYYVYANELQAF---
---
>KAFR0B03960
--------------MIHISKLIFKITKLTLIFWCLYIV-LSPKIQLSNDQILNTFIPSLI
KDRSND--------PSLTLVVAHPDDEVMFFSPTLLQLDSHL--PPNCKFNIISYSDG--
-DAEGLGSLRSNELAHSIDMLI-PR------RNKEIFIFNHTDGMNEVWDNKLMLHQLES
ILSD-----SQTNILLTFDQFGVSNHINHKACHQVVTSYIQS----------HAKNNFAL
LLDS------YSSNLLKKYTGFAWQLVF-----------LAKNYWIHGK-----------
--TLPNLD-HLALFNPYSDYITAYATMLKAHKSQMVWFRYGWWFFSRFVYVNDLKLYTH-
---
>KNAG0J00240
------------MFRFNFSRFIYKVTKLSLLLGILYIYASTSKIGSFNYTNLETL-----
GEHDI---------NSVNLVIAHPDDEVMFFAPSLINLNEQIRDPSTV-FNIICFSNG--
-GADGLGNVREQELSDSIAMLL-PT------RNTSIVVLDFKDGMKEKWDVKEMIAKLRN
IVPK-----LGHNVLLTFDGKGVSGHLNHIACYRAALGYYNE--------FKSKQKLTVL
SLQS------YSKNIVKKYSSYIWELIK-----------LLYSSWVPSR-----LGNVLP
KRGSNVAR-KITIFSTYPQYVLSLAAMLNAHKTQVVWFRYGWWFFSRLVFVNDLDVISS-
---
>NDAI0K00330
-------------MSLRFSKFTYKSFKLFLLLWMFYMI-STQKISSYNKKSFDNSVLNQI
LRQDHSHADISEPITQLSLVIAHPDDELMFFAPTLLQLNRFL--PTSIPFNIICFSDG--
-DAEGLGYLRRKELHDSINLLL-SSSN---NRKINISILDFIDGMDQVWDGKQLLSSLQN
ELLVNVPPSIKNNILLTFDANGISNHPNHIACNKAVHDLISY-----DGGKDKEMNIIGL
MLSSKSDEYNIVMNLLSKYTFFVIDLVK-----------VYWNLATGTF----------N
TIPNSASL-ELSFINTYSQYILSYASMLNTHKSQMVWFRYGWWWFSRFVFSNDLLVVSNI
NNV
>NCAS0C00380
----------MFLSNFSFSKLIFKVTKLFLVLWLLYLL-SSNRIEQFNTLNYSQLNTKIF
HEG-----------TTLNLVIAHPDDEVMFFAPTLLQLDNLM--PLSIPINVICFSNG--
-DAQGLGEKRQHELQSSIHALIQNQ------RQTNVTVLHFQDGNDQIWDIDQMTQYLPQ
---------NDHQAFLTFDSHGVSGHKNHIACHNAVWNLKNT-----------NNNVTIL
TLDS------IHHSLLAKYTFFIIDLVK-----------LYWNLWKDQQ-----------
QPQWESHD-KITFFNAYSQYILAYSTMLNAHKSQVVWFRYGWWAFSRFVFSNHLKITT--
---
>TPHA0I00280
------------------MGILFKLFKCYCILSILYIW-LTPHIEDLNLKSFYSNVQLNI
SQQSL---------KSVNLIIAHPDDEVMFFTPTLLQLDDIL--PTHVPFNVICLSKGVD
VDGRAVGDLRSNEIMDSLTMLL-GHRRAGLNREVKLHQFEYEDGMDKQWDISKVVTDIQN
TISMESNVDGLKHWLLTFDAQGVSEHPNHIACYDAMMTLKQK--------SSNPGDYLLM
TLNS------YGSNIILKYSSFLPVVFK-----------LLINIINDKF-RIFELKQVPF
LSMHKEHD-QIQFINTFPHYIMALSSMLNSHTSQMVWFRYGWWSFSRFVFVNDLHIIDL-
---
>Suva_13.470
---------MSKRVKVCFSKLLFKITKLAIVLTVLYIY-FTPKILSRNTDSLQHVFP---
HRDRN---------SQINLVIAHPDDEVMFFSPVISQLHAYF--PDTVPFNILCLSKG--
-DAEGLGETRAKELNDSAVLLLRNE------RPVSVQVMDFEDGMDEVWDIDSITSTLSQ
TIDVNNE--KVSQIIVTFDSYGVSNHINHKSCHIAVEKFIDDYVGSKTKEKAENAHITAL
YLRS------YKNNIFLKYNSFIWEILK-----------MLYRTVSPFG---RSIQPLAA
PSTTTEKN-GLLLMNTHSQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDIFTY-
---
>Skud_13.453
---------MSRRVKVNFSKLVYKITKLAIVLTILYIF-FTPKIISRNDELLQHVFP---
HKNRD---------SQINLVIAHPDDEVMFFSPVISQLHSYF--PITVPFNIICLSKG--
-NADGLGESRVKELNGSAALLLQNE------RPVSVQVMDFEDGMDEVWDINSIVSTISQ
TIDLSNE--QLNQIIVTFDSYGVSDHINHKSCHTAVKRLIDRYAESKAETNEETPHITAL
YLKS------YKNNIVLKYNSFIWEILK-----------ILYSVIVPFP---KTIQ---P
PTTTTQRS-KLLLMNTHAQYVLAYAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDVYTY-
---
>YMR281W
-------MKMLRRTKVNFSKLLYKITKLAIVLTILYIY-FTPKIVSRNNASLQHIFP---
HKYGD---------YEINLVIAHPDDEVMFFSPIISQLNSYF--PRTVPFNIICLSKG--
-NAEGLGETRVRELNESAALLLHNE------RAVSVQVMDFQDGMDEIWDIDSITSSLSQ
KIDIKNH--NLNQIIVTFDSYGVSNHINHKSCYAAVKKLVDDYAQPKTKRNEQPPHVTAL
YLRS------YKNNIVLKYNSFIWEILK-----------ILYDLISPFR---RIIQAL-P
PNTAAEKD-KLSLMNTHAQYVLAFATMLNAHESQVVWFRYGWWIFSRFVFVNEFDVYTY-
---
>Smik_13.494
-------MKMPRRVRVNFSKLLYKITKLSIVLTILYIY-FTPKIISRNNESLQHVFP---
NKYSD---------YQINLIIAHPDDEVMFFSPMISQLHSYF--PNTVPFNIICLSKG--
-NAEGLGQTRVRELNDSAALLLHNE------RAVSVQVMDFQDGMNEVWDIDSITSTLSQ
TIGINNN--ELNQIIVTFDSYGVSGHINHKSCHTAVRKLIADYTRSNVRKEVKTPLITAL
YLRS------YKNNIVLKYNSFIWEILR-----------MLYGLISPFR---KTTQAL-P
SDVVAEKN-SLLLMNTHAQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDVYIY-
---
>ZYRO0G14300g
------------------MVVAIKFPKVYFLLWVLFIA-FSVRIKSRNGSVFNDNLK---
FLDEI---------DSLSLVVAHPDDEVMFFAPTILELDSRL--PPNVEFNVVCLSKG--
-GADELGDTRVQELKESVNLLL-ANSK----RQYQLQQHDYPDGHEETWDQESVQSTIKD
SVLQG----RRSSVLLTFDDKGVSKHVNHIACHEAVSNLVQD----------ESNVKAAL
YLDS------YGDNIVLKYSAFFWEIWK-----------LTRD-W---F--LHRVLPTSS
YNENKPAT-EITLMSDYSSYILSFASMLHSHKSQMVWFRYGWWTFSRFVFVNDLKVVNK-
---
>TDEL0B00520
---------------MNVSGGAVKVFKLLFFLSILYVA-LTARINGRNEVQWQQHAA---
AIGTP---------ESLTLLIAHPDDEVMFFSPSLLQLDRLL--PQSVRFNFVCLSKG--
-DADHLGETRELELQRSLNLLT-SNSQ----RKTQLYQFDYPDGFDEKWEIESVVSIVES
KVFIG----SGFNLLLTFDAHGVSNHPNHVACHNAVARLIEK-------------GHKAL
YLNS------HSRNLPLKYSGFIWELIR-----------MLSDSVMKLE-----------
------RT-GLTFMNSFPQYILAFAAMANAHESQLVWFRYGWWSLSRFVFVNDLEIVI--
---