MUSCLE (3.8) multiple sequence alignment

CAGL0M03025g       --------------------MVSNADETF----------VAPRLIRVAG-----------
Suva_13.468        --------------------MANSSDRQG----------LEPRIIRTLGSQTLGT-----
Skud_13.452        --------------------MANNSDRQG----------LEPRIIRTLGSQTLSG-----
Smik_13.493        -------------------MANNNSDRQG----------LEPRVIRTLGSQALSG-----
YMR280C            -------------------MANNNSDRQG----------LEPRVIRTLGSQALSG-----
NDAI0K00390        -------------------MPSNVEEKTS----------LTVKDEEECNNHSDNNIAFET
NCAS0C00390        -----------------MPTNNSNVKVEG----------HSARHTDRLIPIQMQS-----
ZYRO0G14278g       -----------------MKDDADTRESNGSTRVPTTGAMQGPRYIRTLGSQSLGGLA---
TDEL0B00530        --------------------MKEMAAKDG-----------GPKYIRTMGSQSLSGLNPLS
KLLA0D01452g       --------------------MVEKKDSAG--RFNGQPSHGGPRFIRTLGSQSLSGLNPLS
ABL121C            -------------------MAGPRKEKDG----------YGPRIIRTLGSQALGGAG---
Ecym_4616          -----------------MSGNIGKKDKDT----------YGPRIIRTLGSQALGGHIRGG
SAKL0D01342g       ---------------------MSKRERET----------FAPRIIRTLGSQSLSG-----
KLTH0C03762g       ---------------------MGERENES----------FGPRFIRTLGSQSISVINP--
Kwal_27.10232      ---------------------MGERENES----------FGPRFIRTLGSQSLSGTNP--
KNAG0J00250        MRFLCLLFTGVFGLPVFSVQRRTKLMYAGESESWHFLAILYVGWNRSFSPGPLDGTSRSG
KAFR0B03950        ------------------------------------------------------------
                                                                               

CAGL0M03025g       -------------------------------------------GGDDDVHGSG-------
Suva_13.468        ------------------------------TN-----------APHKALNTEA-------
Skud_13.452        ------------------------------ST-----------VPNRTLSSEA-------
Smik_13.493        ------------------------------PN-----------ISNRTLSSEA-------
YMR280C            ------------------------------PS-----------ISNRTSSSEA-------
NDAI0K00390        DGSDDRTKNILSI-----------------IP-----------IQNTSLTNPR-------
NCAS0C00390        ----AKVIDPI--------------------R-----------SRTASLPVNA-------
ZYRO0G14278g       ------------------------------GS-----------NSSRSSTSPP-------
TDEL0B00530        S-----------------------------GG-----------SSQVSISHSP-------
KLLA0D01452g       NAQQGVSQQQQHLSHHSHNVTDSDSPSIQDSGIPITSALIKKESPSHAVSGIP------S
ABL121C            ------------------------------GS-----------SRASSVSQSP-------
Ecym_4616          HGSQGNNTRMV-------------------SG-----------SQPSSLSESPISVDVGA
SAKL0D01342g       -------LNPF-------------------SS-----------SNPSSLSQSP-------
KLTH0C03762g       ------------------------------LS-----------SQPSSISQSP-------
Kwal_27.10232      ------------------------------LS-----------SQPSSISQSP-------
KNAG0J00250        WCEGCLTLTHSCIRLYFTYLVVAGDNKIVMSK-----------KSGAAVNTPAASITTSD
KAFR0B03950        -----------------------------------------------MVKKEP-------
                                                                               

CAGL0M03025g       ---------------------------------SGAGPANGNSVSGS------NTGSRG-
Suva_13.468        ------------------------------------NPNFSENIKEALIKT--NSPTPL-
Skud_13.452        ------------------------------------NPHFSENIKEATVNT--TSPTPL-
Smik_13.493        ------------------------------------NSHSSENTKDAMIKT--TSPTPL-
YMR280C            ------------------------------------NPHFSKNVKEAMIKT--ASPTPL-
NDAI0K00390        ----------------RKGRGNSNMAVSKRKLDSISNSSSTDTKDDSVS----ISITDS-
NCAS0C00390        ---------------------------------TTAASSPSVQPPPPSSTS--SSVAPN-
ZYRO0G14278g       ----------------YEQDDDSKESSSVPQSASMTGSSSQNAQREGGGNG--SIASPA-
TDEL0B00530        -------SVLLDDNGSEDVRSAKRKSPSLLAGTPSQRPRLNTEVSEVASY---TSVNSA-
KLLA0D01452g       NSNSINNNSKSNSNNNPSSVFSSRNNTSIQQLQQGPSPTLSNSESPVNASLLSSITTPLL
ABL121C            --------------------------GGPEGATGGASPAAAPQSTTG------TPLSSL-
Ecym_4616          LQDEAHGGSQSSQQGQQKQQLVQQLGQQLGQVRGALSPTMVQASATPGS----TPLSSM-
SAKL0D01342g       ------------------ATSSTVPHVAANNTTMSPTPLNSNNMGTGTSVTS-GADTPA-
KLTH0C03762g       -----------------------------------AQPKANTNTQTTATASISPTASVT-
Kwal_27.10232      -----------------------------------AQPRTNNSAAPNAARSISPVTSAT-
KNAG0J00250        AAGGTENTVREEVTGLLPNEGKKSLKELKDTLSPISRPSSSTTANGDGAE---PLLSSR-
KAFR0B03950        ---------------------------------GSSDPRKQD-----------SDVNHP-
                                                        .                      

CAGL0M03025g       --------------------STPTY--RVAQACDRCRLKKTKCDGKIPQCSQCALVGFEC
Suva_13.468        --------------------STPIY--RIAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC
Skud_13.452        --------------------STPIY--RIAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC
Smik_13.493        --------------------STPIY--RIAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC
YMR280C            --------------------STPIY--RIAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC
NDAI0K00390        --------------------TSGNYSKRISQACDRCRSKKTRCDGKRPQCSQCAIVGFEC
NCAS0C00390        --------------------EDSNL--RIAQACDRCRSKKTRCDGKRPQCSQCAIVGFEC
ZYRO0G14278g       --------------------GSQNL--RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC
TDEL0B00530        --------------------ANSNL--RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC
KLLA0D01452g       HQTGSASHPPSNTGSSTNGTTTPSY--RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFEC
ABL121C            --------------------TPTNY--RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC
Ecym_4616          --------------------TPMSY--RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC
SAKL0D01342g       --------------------SASNY--RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC
KLTH0C03762g       --------------------PSSNY--RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC
Kwal_27.10232      --------------------PTSNY--RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC
KNAG0J00250        --------------------PDAAG--RASQACDRCRLKKIKCDLKRPQCSSCASVGFEC
KAFR0B03950        --------------------SSSNY--RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFEC
                                              * :******* ** .** . ***:.** *****

CAGL0M03025g       KISDRLNRKSFPRGYTETLEERVRELETENKRLMALCNSDL-------------------
Suva_13.468        RISDKLLRKAYPKGYTESLEERVRELEAENKRLLALCDIKEQQINLVSQSRPPT------
Skud_13.452        RISDKLLRKAYPKGYTESLEERVRELEAENKRLLALCDIKEQQISLVSQSRPST------
Smik_13.493        RISDKLLRKAYPKGYTESLEERVRELEAENKRLLALCDIKEQQISLVSQSRPPT------
YMR280C            RISDKLLRKAYPKGYTESLEERVRELEAENKRLLALCDIKEQQISLVSQSRPQT------
NDAI0K00390        KVSDKLQRKSYPRGYTETLEEKIRELQTENKRLLAIYNLKQNQLSVSS-SSSSTSPN---
NCAS0C00390        KISDKLQRKSFPRGYTETLEEKVRELENENRRLLAICQFNKLQSQ---------------
ZYRO0G14278g       KISDRLSRRAFPRGYTETLEERVRELEAENRRLVALCDIKEQQIHLFSQQHSP-------
TDEL0B00530        RISDKLSRRAFPRGYTETLEERVRELEAENRRLVALCDIKEQQIHLVS--HFPTNK----
KLLA0D01452g       KISDKLSRRAFPRGYTETLEERVRELEAENRRLVALCDLKEEQLHLVSKYSNSKDENGV-
ABL121C            KISDKLSRRAFPRGYTETLEERVRELEAENRRLVALCDLKEEQLRLVSKYGCASAPATSS
Ecym_4616          KISDKLSRRAFPRGYTETLEERVRELEAENRRLVALCDLKEEQLRLVS--KYSAGSVGVG
SAKL0D01342g       KISDKLSRRAFPRGYTETLEERVRELEAENRRLVALCDLKEEQLHLVSKYSNKRTS----
KLTH0C03762g       KVSDKLSRRAFPRGYTETLEERVRELEAENRRLVALCDLKDEQMHLVYKYSSNKRP----
Kwal_27.10232      KVSDKLSRRAFPRGYTETLEERVRELEAENRRLVALCDLKDEQMHLVS--KYSSNKRH--
KNAG0J00250        KLSDKLTRNSFPRGYTESLEERIRELESENRRLLAMNDLKEQQLFKIP------------
KAFR0B03950        KVSDKLIRKAYPRGYTESIEERVRELEAENRRLLALCDLKEQQISLVA--KYSSNKSNIL
                   .:**.* *.::*.****::**.:***: **.**:*: : .                    

CAGL0M03025g       ---------------------------------------------------GSNTRSDGL
Suva_13.468        ---------------------------------------------------SLDNTVSDN
Skud_13.452        ---------------------------------------------------SLDSNVDGN
Smik_13.493        ---------------------------------------------------SMDNTANGS
YMR280C            ---------------------------------------------------STDNTINGN
NDAI0K00390        ---------------------------------------------------KKGNGNDCA
NCAS0C00390        ---------------------------------------------------KNDTIDNST
ZYRO0G14278g       ---------------------------------------------------GGRRKDDER
TDEL0B00530        ---------------------------------------------------KKIGGNDEQ
KLLA0D01452g       ---------------------------------------------------EIPSTEEEQ
ABL121C            SSANKKGDS------------------------------------------DHTTLEDEQ
Ecym_4616          VGGPVTAGTTVGNRSSVNGAVNESASSTVGSIATAGSTAGLAHQNKKCAGSDSTTPEEDR
SAKL0D01342g       ---------------------------------------------------EISENEDEQ
KLTH0C03762g       ---------------------------------------------------EPSSTEEEQ
Kwal_27.10232      ---------------------------------------------------EPSSTEEGR
KNAG0J00250        -----------------------------------------------------------E
KAFR0B03950        PTDRCIIEL----------------------------------NSDSDCTNNIKGELNKD
                                                                               

CAGL0M03025g       EKQSPSKRKRSPSMERDSERGFTENMELQLQQSCSS------------------------
Suva_13.468        FKQDLKDA----PLNLSSTNIYLLNQTVNKQLQNGK------------------------
Skud_13.452        CKKELKDA----PLNLSSTNIYLLNQTVNKQLQSGK------------------------
Smik_13.493        FKQELKDA----PLNLSSTNIYLLNQTVNKQLQNGK------------------------
YMR280C            FKHDLKDA----PLNLSSTNIYLLNQTVNKQLQNGK------------------------
NDAI0K00390        VQSNSTSTSAINDTNENGSNETAMKEIIQSQLIPLTNINSVHDP----------------
NCAS0C00390        TQEEVY------SIRSNSASSTAIETDSN-------------------------------
ZYRO0G14278g       MLRELQSANGG-SLNISSTNLYLLNTGSHQRQGPQG------------------------
TDEL0B00530        MLQELTGANNG-RLRISSTNLFLLNKARDGKQPATI------------------------
KLLA0D01452g       ILHELSKTNGG-SLRVSSTNLYLLNKKASPGDDSH-------------------------
ABL121C            ILQQLSNSDGG-ALRVSSTNLYLLNKKTAAFPLVQP------------------------
Ecym_4616          ILQQLSKSDGG-TLRVSSTNLYLLNKKTSGQQQLLL------------------------
SAKL0D01342g       ILQQLSAANGG-SLRVSSTNLYLLNKTTPGDQ----------------------------
KLTH0C03762g       MLEQLSSSNGG-SLRVSSTNLYLLNKTSPAGHEVPE------------------------
Kwal_27.10232      MLEQLSNSDGG-SLRVSSTNLYLLNKTTPAVQDGSE------------------------
KNAG0J00250        DIQSVVDVDAELNSSNQTKNMYA-------------------------------------
KAFR0B03950        RQNDVTTIPNSLPLNISQTNLYLLNQTQKKAELNNGNKMFQQNQSNVSTSSSSSPFFANK
                      .            .                                           

CAGL0M03025g       ---------CGNSDP-----------------------NHRC--------------VHLK
Suva_13.468        ---------IDTNRSDSTMGLLATSPPLPQK-------DHVCDGVSCTNN------LHAK
Skud_13.452        ---------MDNDNSDAAIDSLAASPSPPPK-------DHVCDGVSCTNR------LHVK
Smik_13.493        ---------MDSDNSNTVMNSLAAAPLPPQK-------DHVCDGISCTNH------LHVK
YMR280C            ---------MDGDNSGSAMSPLGAPPPPPHK-------DHLCDGVSCTNH------LHVK
NDAI0K00390        ---------IQNNDDNTHTDCCNHTIKTINPDNNNNYSTHTTNGKLHRDT--NDHHLHPK
NCAS0C00390        --------------------------------------ITTCLDTNCNND--THNHLHMK
ZYRO0G14278g       ---------PQQQEQLTQQKRQ----------------PHVCDGLCCAGK------LHVK
TDEL0B00530        ---------SNGDDHMTKPDHEHTG-------------KHRCDELDCNNK------LHSK
KLLA0D01452g       ---------IESSEPSIPVRKVAITAPSPRIMSPR---NSVADSDPSQTNTGNNDHIHSN
ABL121C            ---------VQQNLSPTQLRSNPYTRATLSP-------SHVAEADHVTDL---RKGLPAN
Ecym_4616          ---------PGSANKSEAFPIQPDSYKLQQRSQSTAS-SHVADSDNPAEF--QKEHLQPR
SAKL0D01342g       ---------QDEEDQMSSKT------------------TVDCNGVGCNHS--HQPNIHDK
KLTH0C03762g       --------------------------------------NHKCQGIDCNHT--SHPHLHEK
Kwal_27.10232      --------------------------------------LHKCQGLGCNHA--SHPHLHEK
KNAG0J00250        --------------------------------------THVCDGICCQDT-----KLHSR
KAFR0B03950        LNSNGTIRSPESNTTVSPLESHTKNLKSNIRNNNTTTTTHVCDGICCTDK------LHPQ
                                                                           :  .

CAGL0M03025g       -----PVV-----------------SNIIVDSNTDVSFEQNVAPGLPAVKALNSMAEREE
Suva_13.468        -----PTS-----------------TSL--NDPTAISFEQNEAPGLPAVKALKSMTTHQR
Skud_13.452        -----PTS-----------------TSL--SDPTAISFEQNEAPGLPAVKALKSMTTHQR
Smik_13.493        -----PTS-----------------TSL--NDPTAISFEQDEAPGLPAVKALKLMTTHQR
YMR280C            -----PTS-----------------TSL--NDPTAISFEQDEAPGLPAVKALKSMTTHQR
NDAI0K00390        -----PVS-----------------TNS--NGLNSISFEQNEAPGLSTVKALKSMVNDEK
NCAS0C00390        -----PVS-----------------TK---PPQNIISFEQNEAPGLSAVKALKSMANHEQ
ZYRO0G14278g       -----PVS-----------------TNL--NDPTSVSFEQSEAPGLPAVQALTSVATREQ
TDEL0B00530        -----PVS-----------------TNL--NDPTAISFEQNEAPGLPAVKALTSMATREQ
KLLA0D01452g       -----NNN--------------HNQNNS--TDPYGISFEQNEAPGLPALKALSSLSKYKQ
ABL121C            -----PVAISSSVGQVPP----YPFTNL--NDPTSISFEQDQAPGLPAVKALSSLASHEE
Ecym_4616          TLPNIPVA-STAIPSAPPGVTAYSLANL--NDPTSISFEQDQAPGLSAVKALSTMANHEQ
SAKL0D01342g       -----PVS-----------------TNL--NDPTSISFEQNEAPGLPAVKALTSMANHEH
KLTH0C03762g       -----PVS-----------------TTL--SDPTTISFEQHEAPGLPAVKALSSMANHEY
Kwal_27.10232      -----PVS-----------------TSL--SDPAAISFEQNEAPGLPAVKALNTMANHEY
KNAG0J00250        -----PVA-----------------TNFNLNDPTSVSFEQNEAPGLMAARAIDQISNHEQ
KAFR0B03950        -----PVA-----------------TNY--NDPTSISFEQSEAPGLVAAKALKSINNQEE
                                             .        :****  **** : .*:  :   : 

CAGL0M03025g       SAQLAMLVSLALPRSTEEILFIPQLMANIQKTFGFSSKQSLYTVSLLSSLKKNLP-----
Suva_13.468        STQLATLVSLSIPRSTEEILFIPQLLTRIRQIFGFNSKQCLYTVSLLSSLKNRLPAPKLL
Skud_13.452        STQLATLVSLSIPRSTEEILFIPQLLTRIRQIFGFNSKQCLYTVSLLSSLKNRLPAPSIL
Smik_13.493        STQLATLVSLSIPRSTEEILFIPQLLTRIRQIFGFNSKQCLYTVSLLSSLKNRLPAPRLL
YMR280C            STQLATLVSLSIPRSTEEILFIPQLLTRIRQIFGFNSKQCLYTVSLLSSLKNRLPAPRLL
NDAI0K00390        NTQLATLVSLAIPRSTEEILFIPQILAKVRQNFGFTSKHCLYTVSLLSSLKSFLSNSNNS
NCAS0C00390        STQLATLVALAIPRSTDEILFIPQLLSKIRQNFGFTSKHCLYTVSLLSSLKPNLPPPKMI
ZYRO0G14278g       SNQLATLVALSVPRSTEEILFIPQLLARIRQIYGFTSKQCLYTVSLLSSLKSSLPEPH--
TDEL0B00530        STQLATLVALSVPRSTEEILFIPQLLARIIQIHGFTSKQCLYSVSLLASLKNNLPGPQ--
KLLA0D01452g       GTQLATLVAVSVPRTTEEILFVPQLLARIGQIHGFTSKQCIYTASVLASLKENNI-----
ABL121C            SSQLAALVAVSIPRTTEEILFVPQLLARIGQMHGFTSKQCLYTASVLASLKEITP-----
Ecym_4616          SSQLATLVAMSIPRTTEEILFVPQLLARIGQVHGFTSKQCLYTASVLASLKEIVP-----
SAKL0D01342g       SVQLATLVALSVPRSTEEILLIPQLLARIGQVHGLTSKQSLYTASLLASLKESIP-----
KLTH0C03762g       STQLACLVALSVPRSTEEILFIPQLLARLGQVHGLTSKQCLYTASLLASLKEPSQAV---
Kwal_27.10232      SAQLAYLVALSVPRSTDEILFIPQLLARLGQVHGLTSKQCLYSASLLAALKESSQTS---
KNAG0J00250        STQLAILVSLSIPRSTEEILFIPQLLAKIRQVFGFTSKQCLYTVSLLSSLKDDLPPPNLL
KAFR0B03950        ATQLAILVSLSVPRSTEEILFIPQLLAKIRQVHGFTSKQCLYTVSLLSSLKNSLPSPKSD
                     *** **::::**:*:***::**:::.: : .*:.**:.:*:.*:*::**         

CAGL0M03025g       -----------------TPNSNSSDENLSPNYYVSEDFRPFFYEVLKFDILGETETENGS
Suva_13.468        LSSTSTKIKE-------NDDSKFLNTFETTSLAEFGDLKKFLIS-LKFDINSFSNQQ---
Skud_13.452        LPSTSTNSKEKNEDKTPNDDSAFLKTFQSTSLSEFVDLKKFLIS-LKFDIDSFSKQP---
Smik_13.493        PPSTSTKLKEKGEDKILDDDSAFFKKFQTTNLSEFVDLKGFLVS-LKFDIDSFSKQS---
YMR280C            APSTSTKLKEKDEDKKLDDDSAFVKRFQSTNLSEFVDLKKFLIS-LKFNINSFSKQS---
NDAI0K00390        ISAA-------------SADNKNLETLKNTNLWKFNALFQFFTAFLKLDFLDSSLEKQNK
NCAS0C00390        ANNL-------------EMTKKLLNQLKITNLWKFDDLSQFINQYLKLDPLN--------
ZYRO0G14278g       -----------------LVKHEPLETLASTNLWEMDDLEQFFAEIFKFKLES--------
TDEL0B00530        -----------------LVKWDELDYLKTTNLWEVDNLDKFFHETLKFNILR--------
KLLA0D01452g       -----------------SSIPPELEVLKNHNLWEIDDVLHFWKNVFKLDFMT--------
ABL121C            -----------------RKTSSILEQLKAKNLWEIDNVDTFLLEGLQIDIRR--------
Ecym_4616          -----------------YQTSPELELLRSKSLWEIDDVDSFLSKGLRFSFPS--------
SAKL0D01342g       -----------------LTLPTNVDMLKSTNLWEVDDVIQFFQTVFKFDIQA--------
KLTH0C03762g       -----------------VPTTDGLTELKCTSLWEIDDPMRFFKDSCKFNLGS--------
Kwal_27.10232      -----------------FQGSPDYKDLKDKSLWEIDDCMTFFKTGCKFNLTS--------
KNAG0J00250        KNSKMI-----------LQNSSNFDILTSVNLWHLENLSNFFQNVLKLNILP--------
KAFR0B03950        FL---------------MDNSQNSLLLKNTNIWQINDLNVFFTDLLKFNISN--------
                                                 .         *     .:.           

CAGL0M03025g       NRNESPDSTIPNSRSD--------------------------------------------
Suva_13.468        -------PEVQNNKSDN-------------------------------------------
Skud_13.452        -------EKQANGHDS--------------------------------------------
Smik_13.493        -------ENLPNDHDN--------------------------------------------
YMR280C            -------EKPANDQDD--------------------------------------------
NDAI0K00390        GKKNGKVNNNNNNSANQDGI----------------------------------------
NCAS0C00390        -------QKNSN------------------------------------------------
ZYRO0G14278g       -------KSPSSYKGG--------------------------------------------
TDEL0B00530        -------PGVSDDGES--------------------------------------------
KLLA0D01452g       -------HTAVDHSS---------------------------------------------
ABL121C            -------GSSGDFNLENP-------------------------------------NGYKL
Ecym_4616          -------ATSAENNNEEPGCGVTTRAVADNTSANTTAVSTSTTNAAETTAAVNTTGARNA
SAKL0D01342g       -------ESSTTSQ----------------------------------------------
KLTH0C03762g       -------DNDV-------------------------------------------------
Kwal_27.10232      -------SKDA-------------------------------------------------
KNAG0J00250        -------DDDDHLKKND-------------------------------------------
KAFR0B03950        -------DSKTS------------------------------------------------
                                                                               

CAGL0M03025g       ----------------------------------DLLSWMEIQRLVDVYFECWSNTIPIF
Suva_13.468        ----------------------------------DLLSLNEIKELLHLFFKFWSNQVSIL
Skud_13.452        ----------------------------------DLLSLTEIKELLHLFFKFWSNQVPIL
Smik_13.493        ----------------------------------ELLSLTEIKELLHLFFKFWSNQVPIL
YMR280C            ----------------------------------ELLSLTEIKELLHLFFKFWSNQVPIL
NDAI0K00390        ----------------------------------SPLSSSEIDELLKLFFQNWSDFVLMI
NCAS0C00390        ----------------------------------DLLNQIEMDELINFFFQDWNDIIPII
ZYRO0G14278g       ----------------------------------AQLNLSEIEELISIFFEHSSIHIPIL
TDEL0B00530        ----------------------------------LGLSIKEIDELVNLFFDSWAVHIPIL
KLLA0D01452g       ----------------------------------THLNFAEVEELMQLFFQDWYELIPLF
ABL121C            ENEYHQTKDAHPELQEL-----------------TPLTFQEIEELIQLFFDDWYSLIPIF
Ecym_4616          DDDGTATATTNTTNSEIDIATTKVGGSRKSTAYPSGLSFQECDEMIHLFFDEWYSLIPIF
SAKL0D01342g       ----------------------------------DHLIATEIDGLVSDFFSQWYNFIPIL
KLTH0C03762g       ----------------------------------ELLSISEIEDLISIYFEECHALIPVL
Kwal_27.10232      ----------------------------------ECLTISEIEELISIYFGECHALIPVL
KNAG0J00250        ----------------------------------DHLALSEIDELVALYFKYWSDSIPIF
KAFR0B03950        ----------------------------------TLLSFDDIDDLTNLYFNHWSNLIPVL
                                                       *   : . :   :*      : ::

CAGL0M03025g       SRKLFIKQMKAFKTEV---DKFGDR---LFEVYKTEQIKINFLKIFATVLAVMCQMALLS
Suva_13.468        NNDHFLLYFNNFVEVIKALPLE------LKKTNGTKTHATTNHQIFALKLLIMLQMGLLI
Skud_13.452        NNDHFLLYFNNFVEIIKDFSLIS-----TKANSTTKNNVTTNHEIFTLKLLMMLQMGLLI
Smik_13.493        NNDHFLLYFNNFVEVVKDLSSAN-----LKTNVTNTSIVTTNHELFALKLSMMLLMGLLV
YMR280C            NNDHFLIYFNNFVEVVKHLSTEN-----LETNNTTKSTVTTNHEIFALKLLMMLQMGLLV
NDAI0K00390        NEKEFYQYYSVFKSDL--------Q---NNNISKMSLSTLMNYKIFGLIILLFCQMGLLS
NCAS0C00390        NKEEFLSNYNAFKLDL--------K---NSERDKLSSNLKMNYKIFGCILVLMCQMGLLT
ZYRO0G14278g       VKDEFYHYFNQFKENVLQNLEFL-KTPLQGPALTARRGKIISYKIFGCIILMLCQLGLLS
TDEL0B00530        DKEEFFSYYDKLKKDISTQPGLF-Q---EGPSNFARRNKIISYKIFACILFTVCQMGLLT
KLLA0D01452g       DKNEFNSYYEKFKLNV-TDPNFFVR---KDDTVFNNRTRSISYKIFSCLLIIIVQMGMLS
ABL121C            DRSEFESYWVKFKDNV-STPGFF-T---SGDTLFDRRHKSISYKIFACLLLTVCQMGLMS
Ecym_4616          DKSEFDNYWQKFKENV-STPEFF-T---SGDTIFAKRHKSISYKIFACLLVTVVQMGLMT
SAKL0D01342g       DKDEFYNYYNKFKTDL-MDPNFF-D---DEKNLFNKRNKSISYKIFGCILLIICQMGLIS
KLTH0C03762g       NENEFYKYYNKFKESLTVDPNFF-G---KANSSFAHRSKSISYKIFACILLVVCQLGIMS
Kwal_27.10232      NEAEFYKYYNKFKSNLTTDPEFF-K---TSTPSFAQRSKSISYKIFACILLVICQFGLMA
KNAG0J00250        NEKEFNSNYRVFKADL---MKLS-K---NGPSSLEN---ILNIKIFGCLLTVICQMGILI
KAFR0B03950        NEEEFFNRYNNFKIQC------------QSFIQGNQSNNLRDYKFFGCFLMVMCQMGLLI
                       *      :                               ::*   :  .  :.:: 

CAGL0M03025g       RLK---QLEATTQELECKRTQNLIAHYNQLIEKIHLDSFFQDMSTTTVQSLQLLSFISFY
Suva_13.468        KVK-REKIKDTVPGNQNSKFAKLMVYYHQVSSIIPKNPYFLNMSTTSLPSLQLLSLTSFY
Skud_13.452        KIK-KDKIKDTVPRNSNAKYIRLMSYYHQISLIIPKNPYFLNMSTTSLPSLQLLSLASFY
Smik_13.493        KIK-MEKIKYTVPKNPNSKYARLMAYYHQLSLIIPKNPYFLNMSTTSLPSLQLLSLASFY
YMR280C            KIK-MEKIKYTVPKNPKAKYARLMAYYHQLSLIIPKNPYFLNMSTTSLPSLQLLSLASFY
NDAI0K00390        KIKLSSNNTKSKNFKQQYHLKKVMNYYHNLINKLMWNEFF-KISNVTLQSLKLLSLILFY
NCAS0C00390        KIK-ATNGKS----SPNIHLKSIMAYYHQLIANLPINNFF-QIATISIPQLKLYVLILFY
ZYRO0G14278g       KIK-AENL------GATSKHHRLASYYHKAISLVYMNPYF-GVLSTSLQSLQFLSLVLFY
TDEL0B00530        KVK-GEKIT-----SADSPYVKLTSYYHRAISLIYLNPYF-GVLTTSLQSLQFLSLLLFY
KLLA0D01452g       KIK-RDKI-------TSGKLSTLMKYYDKLMTHIWINPYF-NSRNTSIQVLQCLSMLLFY
ABL121C            KVK-RERH------ERGDRLNNLMTYYDRAISHVIMNPYF-SSSSTSIQSLQLLSLLLFY
Ecym_4616          KVK-RENL------GRRHKLNILMTYYDRALSHIITNPYF-GSNSTSIQSLQLLSLLLFY
SAKL0D01342g       KVK-AENL------PATNKYSQLMAYYDIVVRQLMMNPYF-NLKSTSIQSLQFTSLQLFY
KLTH0C03762g       KVK-REQL------PAKSKFSRIMAYYNNAILALKLNPYF-SVKTTSVKTLQLMSLLLFY
Kwal_27.10232      KVK-REQL------PTKNKFSLLMSYYSNALLALKTNPYF-SVKNTSIQTLQLLSLLLFY
KNAG0J00250        KYK-NFK-------NKSPKFEKLLSYYHHLMYVLPKNSYF-GVITTSIKTVQILSLILFY
KAFR0B03950        KLK-EHKS--------NNSLFKILTYYHQLTYILPKNPVY-DFATTSIKSVQLLALLLFY
                   . *   .               :  :*      :  :  :    . ::  ::   :  **

CAGL0M03025g       FLNVGDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKFEQGERRLLFWAIYYL
Suva_13.468        FLNVGDIPAIYGLRGRIVSMSQQLRLHRCPSAVLSVHSNPVLQRFEQSERRLLFWAVYYI
Skud_13.452        YLNVGDISAIYGIRGRIVSMAQQLRLHRCPSAVLSVHSNPVLQKFEQSERRLLFWAIYYV
Smik_13.493        YLNVGDISAIYGVRGRIVSMAQQLRLHRCPSAVLSVHSNPVLQKFEQSERRLLFWAIYYV
YMR280C            YLNVGDISAIYGVRGRIVSMAQQLRLHRCPSAVLSVHSNPVLQKFEQSERRLLFWAIYYV
NDAI0K00390        NLHMGNISNIYELRSKVISMSQQLRLHRCPSAVLC-GSTLKIHKLEQSNRRLLFWNIYYL
NCAS0C00390        NLNVGDISAIYELRGRIISMSQQLRLHRCPSAVLS-GSSLTMNKLDQSNRRILFWTIYSL
ZYRO0G14278g       FLNIGNVSAIYELRGRVVSMAQQLRLHRCPSAVLG-GAGSTMNKREQGDRRVLFWGIYYL
TDEL0B00530        FVNTGNVSAIYELRGRVVSMAQQLRLHRCPSAVLG-GSGSTMNKREQGDRRVLFWGIYYL
KLLA0D01452g       MLNVGDISSIYELRGKVVSMSQQLRLHRCPSAVLG-GDGSTVSKVQQGERRILFWSIYYL
ABL121C            FLNVGDVSNVYELRGKVVSLTQQLRLHRCPSAVLG-SDGSTVGKIQQGERRVLFWGVYYL
Ecym_4616          FLNVGDISNIYELRGKVVSFAQQLRLHRCPSAVLG-GDGCTVSRIQQGERRVLFWGVYYL
SAKL0D01342g       FLNIGEVSSVYDLRGKVVSMSQQLRLHRCPSAVLG-GNGSAVSKAQQGERRILFWGIYYL
KLTH0C03762g       FLNVGEVSSVYELRGTIVSMAQQLRLHRCPSAVLG-TEGSTMSKSEQGDRRLLFWGIYYL
Kwal_27.10232      YLNVGEVSSVYEIRGTVVSMAQQLRLHRCPSAVLG-TEGSTMSKSEQGDRRLLFWGIYYL
KNAG0J00250        HLNTGDIIQIYDLRGMIISMAQQLRLHRCPSAVLT-GSGSKMDRLEQGNRRTLFWCIYYL
KAFR0B03950        HLNMGNIEQIYELRGNIISMAHQLRLHRCPSAVLT-GSGSTMQKLEQSNRRLLFWTIYYL
                    :: *::  :* :*. ::*:::************       : . :*.:** *** :* :

CAGL0M03025g       DVFYSLQLGVPRLIKDHEIECALPVSEEEDS---------------------QLEGRVSD
Suva_13.468        DVFASLQLGVPRLLKDFDIECALPISDVEFEDQLASENE----KTKNKTKKIQLQGQVSS
Skud_13.452        DVFASLQLGVPRLLKDFDIECALPISDVEYKDQLSMENE----KMKNKAKKIQLQGQVSS
Smik_13.493        DVFASLQLGVPRLLKDFDIECALPISDVEYKDQLFMENK----KTNKKAKKIQLQGQVSS
YMR280C            DVFASLQLGVPRLLKDFDIECALPISDVEYKDQLSMENE----KADKKAKKIQLQGQVSS
NDAI0K00390        DIFASLQLGVPRLLKDHEIECALPIPMDTDSKSDNQSQRSAATNAENDDNKIKLEGCVSH
NCAS0C00390        DALSSLQLGVPRLLKDYEIECALPITMEDKE---------------RDKTKIKLEGTVSP
ZYRO0G14278g       DVFSALQLGVPRLIKDFEIECALPVADNDDR------------TVNLAGQQIRLEGQVTN
TDEL0B00530        DVFSALQLGVPRLIKDFEIECALPVAENDDR------------EVSLAGQMIRLEGRVSQ
KLLA0D01452g       DVFSALQLGVPRLLKDFEIECALPVTSDDDR------------QVNLAGQMIALEGKVSQ
ABL121C            DVFSSLQLGVPRLMKDHEIECALPVSSDDDN------------HVNLAGQMIALEGKMSP
Ecym_4616          DVFASLQLGVPRLLKDHEIECALPVSSDSDR------------QVNLAGQMISLEGKMSP
SAKL0D01342g       DVFSALQLGVPRLLKDHEIECALPVADNDDQ------------KVNLAGQMIALEGRVSM
KLTH0C03762g       DVFSALQLGVPRLLKDHEIECALPISENGHP------------GVSLADQVIRLEGQVSE
Kwal_27.10232      DVFGALQLGVPRLLKDHEIECALPISEHAHA------------GVSLADQVIKLEGQVSE
KNAG0J00250        DVFCSLQLGVPRLIKDHEIECALPLSSEIHN------------TDKMDG--VQLEGTMSE
KAFR0B03950        DVFSSLQLGVPRLLKDYEIECALPVDNTTT-------------MDAIDGTSIKLEGTVSQ
                   * : :********:**.:******:                            *:* :: 

CAGL0M03025g       FSLAVIRYAKVLGNILDSIFKRNMMSEAATESMAFVHEKALDIWKNRLPEKYGFRLEANG
Suva_13.468        FSLQIIRFAKILGNILDSIFKRGMMDERVTSEVALVHENALDNWRNQLPEMYYFQITVNG
Skud_13.452        FSLQIIRFAKILGNILDSIFKRGMMDERISSEVALVHENALDNWRNQLPEMYYFKITVNG
Smik_13.493        FSLQIIRFAKILGNILDSIFKRGMMDERITSEVALVHENALDNWRSQLPKMYYFQITVNG
YMR280C            FSLQIIRFAKILGNILDSIFKRGMMDERITSEVALVHENALDNWRNQLPEMYYFQITVNG
NDAI0K00390        LSLVIIRYSQIVGNILDMIFKRN-MTESMTKSIALIHIHALDDWRNTLPSNLKFDLNVNG
NCAS0C00390        FSLAIFRFSKILGNILDMIFKRN-MTESMTKSVSLIHENALDQWRYDLPEDLTFKLNIQG
ZYRO0G14278g       YSLAIIRFSKVLGNILDSIFKRG-MTESITKQVSLIHENALDNWRHGLPKELIFELDVNG
TDEL0B00530        FSLAIIRFAKVLGNILDTVFKRG-MTESVSKKLALIHENALDNWRRGLPAELIFEIEVNG
KLLA0D01452g       FSLSVIRFAKVMGNILDSTFKRG-MTTSLTKQAALVHENALDNWRHGLQKDLFFQLDVNG
ABL121C            FSLSIIRFSKVLGNVLDSIFKRG-MTESMTKQVALVHENALDNWRHALPDNLRFQLDVNG
Ecym_4616          FSLSVIRFSKVLGNVLDSIFKRG-MTISITKEVALVHENALDNWRHGLPDGLRFQLDVNG
SAKL0D01342g       LSLSVIRFAKVLGNILDSIFKRG-MSASLTKQISLVHENALDNWRRGLPQQLKFELDVNG
KLTH0C03762g       FSLSLLRFSKILGNILDSIFKRG-MTSSIAQQVALIHENALDSWRRGLPKNLTFELDVNG
Kwal_27.10232      LSLSLLRFSKILGNILDSIFKRG-MTSSAAQQVALIHENALDNWRRGLPKNLTFELDVNG
KNAG0J00250        FSLSVVRCAKVLGNILDSIFKRN-MSESITEQVYTIHENALDSWRTKLPKKYQFKLNANG
KAFR0B03950        ISLTLFRFAKVLGNIVDSIFKRN-MSTSISRQVALIHENALDNWRSRLPEQFQFKLDVNG
                    ** :.* ::::**::*  ***. *    : .   :* :*** *.  *     * :  :*

CAGL0M03025g       LFNFDELTVVKN------------SEKDLI--EKSSILLFYFLAKCMIHLPVIATRSASL
Suva_13.468        TVNLDDIRANNSRNTEAK-----FDRKDIICFEKNVLLLFYFLAKSMIHLPVIATKPLPK
Skud_13.452        TVNLDEIRANNSRDIETP-----FETKDIILFEKKILLLFYFLAKSMIHLPVIATKPLSK
Smik_13.493        TVNLDEIRVNDSKNIETR-----FEKKDIILFEKKILLLFYFLAKSMIHLPVIATKPLPK
YMR280C            TVNLDEIRATNQRNTETK-----FDKKDIILFEKKILLLFYFLAKSMIHLPVIATKPLPK
NDAI0K00390        SIDLSSFIDQQNLNEEEQ----RTQQQKLL------VIFLYFFGVNMIHMPVVASRPLPL
NCAS0C00390        SIDLNVMHQGNST----------PGKKNLI------LMFFYFFAVSMIHLPVVAARPLDV
ZYRO0G14278g       TINIDEFNRLKQMNVTVE------RSENMT------LLVMYFLAKCMIHLPVVATRPLPT
TDEL0B00530        TINMDKFNEMKQNNATVE------NVEQMV------LLVSYFLAKCMIHLPVVATRPLPS
KLLA0D01452g       TINMDEFNQQKQYSKSLSPRTAAFTHNSLV------LMTLYFMAKCMIHLPVVATKPLVA
ABL121C            TINMEDLNQLKRDYLNKD--TA-LKLNNAI------FMALYFLAKIMIHLPVVATKPIID
Ecym_4616          TINMDEFNQLKHEYLNND--NSKFNKENFI------FMTLYFLAKSMIHIPVVAGKPPVD
SAKL0D01342g       TINMDEFNHLKQLDTSGN----MYSKENKS------LMVLYFMAKCMIHLPVVAKRPLVN
KLTH0C03762g       TINMEELNSGSHWKKDYS--TA-PSCDNRT------LMVLYFLVKCLVHLPVLAAKPLLG
Kwal_27.10232      TIKIEELTGSAQNNQDFT--KN-ASSDKKI------LMLLYFLVKCLVHLPVLAAKPLLG
KNAG0J00250        MVDLEHL-----------------NHENLI------LVLLFFLVKSMIYMPLSSAITELA
KAFR0B03950        TINLNDLDTE--------------NSDTIF------LIVFYFLAKCMIHLPVCSTKVDLE
                    ..:. :                   .         .:  :*:   ::::*: :      

CAGL0M03025g       E-QQLQP-----------GTSSDTSETPKESQNKTPTRVCPSYILMQKAASTMLQVMHYT
Suva_13.468        TVDNSTKKKHSMFNNDTKSINNQDHSVVDVDMTSPAIRTSSSYIILQQATNATLTLFQSI
Skud_13.452        NVDNVMKKKQSMFNNDSKGTNNHDHMAVDVDMTSPAIRTSSSYIILQQATNATLTIFQSI
Smik_13.493        NIDNGTKKKQSVFSNDSKGSNDQDHMIVDVDMTSPAIRTSSSYIILQQATNATLMIFQTI
YMR280C            NVDNATKKKQSMFNNDSKGATNQDHMILDVDMTSPAIRTSSSYIILQQATNATLTIFQAI
NDAI0K00390        V-ENDSL-------------------------NQIPDRSSSSYIALQHATNTMLNVLDLL
NCAS0C00390        K-------------------------------NAMPDRSSSSYIALQHAINTMLNVLELL
ZYRO0G14278g       N-DSNDTGETSNATSNGNNVRARDPSTERN--QAAADRSSSSYVLLQQATNTMLNVLESL
TDEL0B00530        S-DDPNS-----------DIKEEEEVNDKNGESNFAIRSSSSYVLLQQATNTMLNVLESL
KLLA0D01452g       E-AIQTP---------------TDNQT----ENGSVDRSLSSYVLLQQATNTLLNVLTAL
ABL121C            K-PQPVV---------------DTNIP-----GSQIDRSSSSYVLLQQATNTFLNVLSSV
Ecym_4616          T-SVQEK---------------NDPAI-----SRQADRSSSSYILLQQATNTFLNVLTSM
SAKL0D01342g       D-PEQSP---------------ESSTP----SNNCGDRSSSSYVLLQQATNTLLNVFTSL
KLTH0C03762g       G-ASEVD---------------TDATLAFDDASSGADRSSSSYVLLQQATNTFLSVQSSL
Kwal_27.10232      G-SSEPD---------------KDATPAFDDASSGADRSSSSYVLLQQATNTFLSVQSCF
KNAG0J00250        N-NPKVK-------------------------NDYYMNHKVSHTSLQQSINALLSVFKNI
KAFR0B03950        D-KVTET---------------GNDVI-------YNDRFSTSYVSLQQSTNTMLNALRMI
                                                        .   *:  :*:: .: *      

CAGL0M03025g       SEY----YLPSPINISRTKARFALLTACSAVEYLKGGSLYVETKNLLENLIIKLELERKL
Suva_13.468        NSV----YLPLPLNVSRTLIRFSLLCARGSLEYTKGGALFLDNKNLLLDTIKDIENDRLL
Skud_13.452        NWM----YLPLPLNVSRTLVRFSLLCARGSLEYTKGGALFLDNKNLLLDTIKDIENDRLL
Smik_13.493        NWM----YIPLPLNVSRTLIRFSLLCARGSLEYTKGGALFLDNKNLLLDTIKDIENDRLL
YMR280C            NSM----YLPLPLNVSRTLIRFSLLCARGSLEYTKGGALFLDNKNLLLDTIKDIENDRLL
NDAI0K00390        SPT----YVPLPINMSRTMVRFSMISACGMLDFIKGGSLFLENKALLAQVVKNIETDRFL
NCAS0C00390        NNQPKNYYLPVPINMSRLQIRSALISSRGMLDYIKGGALFLDNKTLLLQVIKNLERDRTL
ZYRO0G14278g       KTL----FLPLPLNISRTKARFALLSARGSLEYTKGGALFLDNKSLLLDVIKDLEEDRKL
TDEL0B00530        KSI----YLPLPFNVARTKARFALLSARGSLEYIKGGALFLDNKALLLDVVKSIEEDRKL
KLLA0D01452g       NSI----YLPLPINLARTKTRFGLFSARGSLEYTKGGALFQDNKALLLDLVKELETDKKL
ABL121C            SSL----YLPLPLNITRTKTRFGLVSARGSLEYTKGGALFQDNKNLLLDLLKDLEADKKL
Ecym_4616          RTA----YLPLPINISRAKTRFGLFSARGSLEYTKGGALFQDNKSLLLNLIKELEVDRKL
SAKL0D01342g       RNV----YPPIPINVSRTKTRFSLLSARGSLEYTKGGALFQDNKALLLDLVKELEVDKKL
KLTH0C03762g       KSR----HLPLALNLPRIKARFALLSARGILEYTKGGALFQGNKALLLDVVKELETTKRL
Kwal_27.10232      KTR----HLPLAIDLPRIKARFALLSARGILEYTKGGALFQDNKALLLEVVKELEASKKL
KNAG0J00250        NNQ----YLPLPLNSSRTMTRFALVSAKGSLEYKKGGLLFEDNKVLLLSVIQEIEKDRKL
KAFR0B03950        RDK----YLPMPFNVSRTLTRFTLISAKGSLDYIKGGSLFIDNKKLLLDCVQDIEANRKL
                          . * .:: .*   *  :. : . ::: *** *:  .* ** . : .:*  . *

CAGL0M03025g       DLPGIISWHSLKLLDMALMLLLQSPTTKMEKLDKLVQKKINHYNRQMGIPAM--------
Suva_13.468        DLPGVASWHTLKLFDMTINLLLKAPNVKVERLDKFLEKKLNYYNRLMGLPPTTTTSSEPL
Skud_13.452        ELPGIASWHTLKLFDMTINLLLKAPNVKVERLDKFLEKKLNYYNRLMGLPLATTTSLKPL
Smik_13.493        DLPGTASWHTLKLYDMTINLLLKAPNVKVERLDKFLEKKLNYYNRLMGLPLATTTSIKPI
YMR280C            DLPGIASWHTLKLFDMSINLLLKAPNVKVERLDKFLEKKLNYYNRLMGLPPATTTSLKPL
NDAI0K00390        DLPGVISWHSLKLFDLTLTLFFQNTNIKLEKLDKLLEKKSNYYNRLMGKPIVRNPAEKNS
NCAS0C00390        DLPGVVSWHSLKLFDLTITLFIQNSNIKLEKLDKILEKKSNYYNKLMGKPTS--------
ZYRO0G14278g       DLPGVISWNSLKLLDMSINLLLQPPNTEVGKLDRLLKKKLNYYNRLMGRPTV--------
TDEL0B00530        EIPGVISWHGLKLLDMTISLLLQPPNTKVEKLDRLLKKKLNYYSRVMGRPILKTSSLRQE
KLLA0D01452g       ELPGNTSWHSLKLFDLSINLILQPVNSNPEKTEKMIQKKINYYNKLMGQPTV--------
ABL121C            NMPGTISWHSLKLLDMAVNLILQPPNTKPEKQEKLLQKKINYYNKLIDSHLG------PT
Ecym_4616          GIPGTISWHSLKLFDMAINLILQPPNTKPEKEEKLLQKKISYYNKLIDHSVGMHASVITS
SAKL0D01342g       ELPGTLSWHSLKLLDMSISLILQPANTKPEKLEKMLQRKLNYYNKLTNRRSN-------L
KLTH0C03762g       EIPGSLSWHSLILLDMAVSLIMQPPHTKAGKLDKLLEAKLSYYNKLMGRSANVAST----
Kwal_27.10232      ELPGSLSWHSLILLDMATLLIMQPPQTKTDKLDKLLETRLNYYNKLMGRSTL-------T
KNAG0J00250        ELPGIIPWHSLKLLDLAVNLFLLGPTINSDKLEKFLQKKINYYNKIMGKPLI--------
KAFR0B03950        DLPGIISWHSLKLLDLTLNLFLQNSNTKPEKIEKLLQKKLNYYNKLMGKPLV--------
                    :**  .*: * * *::  *::     :  . :.::: . .:*..  .            

CAGL0M03025g       --------------------------------------------KLSNSR-KNNKKIKLE
Suva_13.468        FSSQSKNTPANGSRSSIVKRENPENEYLYGDGINNGNTDMDKPSTEDARN--VNKRLKHE
Skud_13.452        FGFQSKNSPETKPRKSTVKRETPDNDYLYGNDTNNNNNPETDQPRTANVG-NTNKRLKYA
Smik_13.493        LGSQSKDSPETRPRKSIVKRENPEYEYLYGKDDNKKNNSGPDQSPIENTS-NGSKRLKYE
YMR280C            FGSQSKNSLENRQRTPNVKRENPEHEYLYGNDSNNNNNSEAGHSPMTNTT-NGNKRLKYE
NDAI0K00390        TTVPASMSAVDETDLPRADKKKKDIVDTENEYVSSVPDTNNIVVKQTPEEWDTSTKTNVK
NCAS0C00390        ---------------------------------------NNTNNNISSKK-RKQETIEIS
ZYRO0G14278g       ----------------------------KQEPASKGHDLTPASSKDEEDT-PAAKRIKIE
TDEL0B00530        ANGKRRNSSDDKLSRS------------GTEENFRATNLTPISSKSDGSP--VEKKIKLE
KLLA0D01452g       ---------------------------------AVKRKRDPKATENT------SKKVKVE
ABL121C            ASLPTPGQTAPRKPEPAHARPIPE----KEKPPSSKRHRGDDNAAASMPP-LLEKKVKLE
Ecym_4616          AAIQHQRQQQQQQQQQQQQQQLH-----YKENKGNGAKRKPEIGSSTTTNMSLNKRVKME
SAKL0D01342g       GGGRSASSPGGNSKRKLD----------ENQGSAEPPKLTPASSKGDTPP---DKKIKLE
KLTH0C03762g       ------------------KRKKEE----DNTSLSNATKLTPLSSDSSSPS---EKRVKLE
Kwal_27.10232      SNGKRKNE--------------------ENDATSKVSKLTPLSSEYNTPS---DKRIKVE
KNAG0J00250        ----------------------------TSLPSSKTKRKQSKEDLFTANK-KRKQQVKTE
KAFR0B03950        -----------------------------KNLPIQKRTNQNKGNNNDEPS-RKKVKKELE
                                                                            :  

CAGL0M03025g       NESSQLS--STSNPIAKGELKSDS---VV---------------CEEDDNVNDNEVTTTA
Suva_13.468        KSISQSIDDDNMSRNQNGSKFQQD---SKKNMSTSNLFPFSFSNTDLTALF-TNPEGLNF
Skud_13.452        KDTRQSVDKDGIAKAQDASNFHHD---NKKTMSASNLFPFSFSNTDLTALF-AHPEEPNC
Smik_13.493        TDTKRGVDTGSIFKSQNAENFQHN---NKKTMSTSNLFPFSFSNTDLTALF-THPEGANG
YMR280C            KDAKRNAKDGGISKGENAHNFQND---TKKNMSTSNLFPFSFSNTDLTALF-THPEGPNC
NDAI0K00390        DSTLAHKLTTIELPSTDKKKRKQEQISPVNKKAKKAEQEVSQTQVGVPRSSTSSTAQNSN
NCAS0C00390        TPS------PTSPPLKKMSKKSKS---PI-----------------LQSTILPSQTLQNY
ZYRO0G14278g       ETSI-----PLAVPQQQQHMQAPA---PVMVQEKQQPQPQPQPQPQPQPQLQPQPQQLQL
TDEL0B00530        DES------SDTSNALVDKSYTDD--------------------------LSSSANQPQV
KLLA0D01452g       DDHSQDNLHNITTGETTDTVHSEE-------------------------LVKDVPKELNV
ABL121C            APAS-----NMPTPPAPISALHED---VPRVLDGHLG-----ANSSLAVLAAKHEPEGSL
Ecym_4616          EPSV-----KIPTSNGPLSALHED---DSEMLGKSLRSNTIVSDVPTGQKM---ESEIPV
SAKL0D01342g       D--------TGFVPVRAVSQHSQS---DS-----------------------EKFENFQP
KLTH0C03762g       HTDK-----VGETPVGVENTGQPN---GN-----------------TQEHYAATWSNQNQ
Kwal_27.10232      SIGS-----SGNVPSNSESVHHFD---DI-----------------QNDKFSTNWPSNNP
KNAG0J00250        LSTL-----EVKREPQQVQLLKRE-------------------------------GQGNT
KAFR0B03950        NDIN-----SLHPILIDNEGVTPS---DA-----------------APLINKTNSNTNNP
                                                                               

CAGL0M03025g       KLEENNEFINPNKIE-QGVTSNTLAFSFSSTDLSALFNA---------------PE----
Suva_13.468        ADTNDYDKNDGNKTSTDTADTNT--GNLSFLNMAPFLQA---------------GN----
Skud_13.452        ADSNSNNLNDCNKSSTDAADANI--GNLSFLNMAPFLQA---------------DN----
Smik_13.493        ANNNNSNFNGCDRFSTDAADANI--ENLGFLNAAPFLQA---------------GN----
YMR280C            TNTNNGNVDVCNRASTDATDANI--ENLSFLNMAPFLQT---------------GN----
NDAI0K00390        YANIQNQFADALQFD-PILNSNS--FNFSNLDLSSLFKTVDKDSQKTNNLQVPTQNSDQP
NCAS0C00390        NNNIQNQLADALQFD-PILNSNS--YNFSNFDLSNYFQP---------------NE----
ZYRO0G14278g       P---QTAFAEALQLD-PVLNSNV---SFQNAPPTTLYDG---------------------
TDEL0B00530        PASTQTAIAEALHLD-PVLNNNI----LSVADLAAFFGG---------------------
KLLA0D01452g       YPENYTTIEEAFQMD-PVLNTNL----FSNTDLKTLFNSGIFENAGSIHNNINDNNNNNN
ABL121C            HSSAGNAITEAFQLD-PILQPTP----FSNTDLPSFFGV---------------------
Ecym_4616          SMSATNAIAEAFQLD-PVLHATP----FSSTDLTSFLNG---------------------
SAKL0D01342g       PVAPQNSIAEAFHLD-PVLNNNP----FSNTDLNAFFNT---------------------
KLTH0C03762g       P---HSTVAEAFHLD-PVLNNNP----FSNGDLTAFFST---------------------
Kwal_27.10232      QP---NAIAEAFHLD-PVLNGNP----FSNGDLTAFFNS---------------------
KNAG0J00250        TESTQSAFVEALQLD-PILNANI--YNFSGTDLSNFFIS---------------NQ----
KAFR0B03950        VVTTQNEFAEALQVD-PILNSDY--YQFSNLDLATLFNS---------------DK----
                               . .            :                                

CAGL0M03025g       -------------------SLFKVPNENT----------QY-------------------
Suva_13.468        -----TNQGIDDNKVVDKNSIFSLPSNLDLMKDSLDSKLEI-------------------
Skud_13.452        ---VTTNQNAVCDKTIHKDAIFSLPSNLDLMKNNMDSKPEK-------------------
Smik_13.493        ---SKTDPNMTNNKPMHMDALFSLPSNLDLMKDNMGSKSER-------------------
YMR280C            ---SNIGQNTIENKPMHMDAIFSLPSNLDLMKDNMDSKPEQ-------------------
NDAI0K00390        VAANGISTTVPTTSIQSFPTPKSLIQNDQILLSKIPSFNDFFKDYSYDRTSSLLGLSGLN
NCAS0C00390        ----NEKTVQLPKLTTNNNVTNEDPTKYK----------EL-------------------
ZYRO0G14278g       ----------------------------------PHDQPHQ-------------------
TDEL0B00530        ----------------------NMPAAGGNQHSSYTNQNDF-------------------
KLLA0D01452g       NTNNTNNNNGSSRNIHNLGAGIEDIDHGMSLRSNDASLLNL-------------------
ABL121C            -------------------DQYAAPPELQPFPAGYAA-----------------------
Ecym_4616          --------EVVTNASMFADTMHTTGIGGGLTDVSGHNGLPS-------------------
SAKL0D01342g       --------------------------NNGNVPAALRSGGSL-------------------
KLTH0C03762g       --------------------DNGMPNLSGGASMLNMVGVDQ-------------------
Kwal_27.10232      --------------------DNGIPQIGGGSSVLNLAGIGA-------------------
KNAG0J00250        -------NGDVPRESREPAVQQPIPDRTSLPATNTSVVTGF-------------------
KAFR0B03950        LNKINSHHGSSINLIDQKPFNDSLIPKFSQVNTASNSTLNM-------------------
                                                                               

CAGL0M03025g       --------------NQQHEMHNNSISSSHSKEPVNKERDSDKQELNAIFNETQNRS----
Suva_13.468        --------------SNSASKQNSEFLANDQLQL--TGRDTSMEKSSPIFNNKSNYS--LT
Skud_13.452        --------------KNSIIKQNPKSSSNSQLQH--RDKDVNIESNNPPFNSKSNYS--LT
Smik_13.493        --------------LEPVIKQNTESLASSKLHE--KNKDSIMENNNLAFNNKSNYS--LT
YMR280C            --------------LEPVIKQNPENSKNNQFHQ--KGKSTNMEKNNLSFNNKSNYS--LT
NDAI0K00390        NNNNNNTNINNINNSTSNEIQKQNSSDTGNPSRNTQAQMNDFNGKYQLLSSPSQLLPKQA
NCAS0C00390        --------------FNPTAVTGTSLLNLSTLAS--PGTSTGLTTTSDNNNILTKGN----
ZYRO0G14278g       --------------YQHHAQTQPQDPHLDTRSS---------DKLHGLFKVPSTAD----
TDEL0B00530        --------------APKHMRKEKEPAAFSDLAH----KKSSVTGVDGLFRVPSNAD----
KLLA0D01452g       --------------SNALGNHGNSAEGMKDGTS--VSNLLNLSTSDSLFKVPSNGD----
ABL121C            --------------PDKVPQAAAQGPSATAGPP--------LSSKDSLFKVPSNGD----
Ecym_4616          --------------NNSLLNMSSIGFGIGSGPS-----LANLSSKDGLFKVPSNGD----
SAKL0D01342g       --------------FNIAATAAASGNNANSTAP-------SNTLNEGLFKVPSNGD----
KLTH0C03762g       --------------AHSTAGNDAQNTVNANSQQ-------STLFNDGLFRVPSNGD----
Kwal_27.10232      --------------ANSNELNNNNNEAAGGGPR-----KVATTVNDGLFRVPSNGD----
KNAG0J00250        --------------DSLPKPENSKPAKDAIGPS--------LKKGYPSFIGTKSHNNSVS
KAFR0B03950        --------------EQLLRNQGKFNISPNIFSP------NFQSKENLLGNSKVNNN----
                                                                               

CAGL0M03025g       ----------------TSFAKLMLLLNNE--------HKSLSSSLENDVRNVGNKLSSEN
Suva_13.468        KLMRLLNNDN----SFSNISINNFLYQND---------SSRHDPAIKAAANVSSNFNPAS
Skud_13.452        KLMRLLNSDN----SFSSISINNFLYQND-----QNSAAQDTGTNNRAGSNTGSNFKPAS
Smik_13.493        KLMRLLNNDN----SFSNISINNFLYQND-----QSSISRDPGADNKTATNTGSIFKPPS
YMR280C            KLMRLLNNDN----SFSNISINNFLYQND-----QNSASADPGTNKKAVTNAGANFKPPS
NDAI0K00390        TNTVFLNKDKANKNDIGSLSTMMMLINNEIPFSSVNLSELLKPSESKTSNDNASNGISAN
NCAS0C00390        --------------NNNNNNTNTVFLNNR--------DNNSTDNLSTMMMLVNNEIPFSN
ZYRO0G14278g       ----FLMD------DSANSQLNFLLGTTE--LGVLDPSQPSYTNNPGSGSAIGINNMPSG
TDEL0B00530        ----FLMDEYY---PSGTSHINLTLFNNN-----ANNHDDTFGLSDGHGKDTGVNTNFNV
KLLA0D01452g       ----FLKDYYIN--NMSNTGLSNLHTSSV--------------NKGPSLSQLGSLFMSSG
ABL121C            ----FLKDYYS---GMSSAQLNSLFTAPD-----------------------RRDVRPRA
Ecym_4616          ----FLKDYYS---GMSSAQLASLFVNGN------TENALQKPTDHRRYQPSQSQGQQLH
SAKL0D01342g       ----FLKDYYNVP-GASSSQLNLLFLNNN-----------------------ASNGKPQL
KLTH0C03762g       ----FLKDYYRVP-GASSSQLNLMLMGSG-------------------------------
Kwal_27.10232      ----FLKDYYRIP-GASSSQLNLMFMGPG-------------------------------
KNAG0J00250        TMMMFLNNDY----PFSSMNLNALYAPDG-------------------------------
KAFR0B03950        ----LLYSNLKNNSNNQSLTTMMMLLNNE----------IPFSSINSNTGESGVNKQNAN
                                    .                                          

CAGL0M03025g       AGQLPSHGATSGLNSKGNEFLSMNTLY-G------------------GDNDFIIDASLGL
Suva_13.468        TASNTSRSSITGNKKNGMDNCDINDFG-NFNNFMTNVNYSG------VDYDYIVDASLGL
Skud_13.452        SASNESQSSITGNAKHGMDNCDFNDFG-NFNNFMTNVNYSG------VDYDYIVDASLGL
Smik_13.493        TAGHRSQSSSIGNTNHGVDNCDFNDLG-NFNNFMTNVNYSG------VDYDYIVDASLGL
YMR280C            TGSNTSQGSILGSTKHGMDNCDFNDLG-NFNNFMTNVNYSG------VDYDYIVDASLGL
NDAI0K00390        SHNSLEFGNTLKLNQNGNSNVTTNGTSMNQVEIPSTLIADSLTDTPIPDYNYFVDASLGL
NCAS0C00390        LNLSELWNNKLSTEDKDKQGQEQNQPR-NTNDDVGMTN---------SNYGYFVDASLGL
ZYRO0G14278g       LNLSNLFD-LEGSTDQPPTNTNATQAT-QANS---------------GGFNFAVDASLGL
TDEL0B00530        KGGHQSTNHSHLTNFNDRLQGNQLGFT-NSGNMNSG-----------SDFNFAVDASLGL
KLLA0D01452g       SGTNLPYSNVRGESKHP-SGVNLNKQR-AQPAM--------------DGFSFAADASLGL
ABL121C            PQPDRAPSDGLQQQ---------------------------------PGYGFVVDASLGL
Ecym_4616          LQPHPEPQRQRQQQQQQHPDHQRYPLE-DEPGICEQSKIRTEKKNQQQGYGFVVDASLGL
SAKL0D01342g       NGSSAHSGTQAQNNDN-------------------------------NGFGFAVDASWGL
KLTH0C03762g       ---------SSGSNQRQAKQQQTNTTD--------------------PGFGFTVDASLGL
Kwal_27.10232      ---------NTGANQNAPNNQKNNFTV--------------------PGFGFTVDASLGL
KNAG0J00250        ---YKESSAQPGKQFTLNTGEPHST----------------------YDFGMIVDASLGL
KAFR0B03950        ATENDNVETINFKQDLTNKNESGNMLS-TENYL--------------SDFSYIIDGSLGL
                                                                   . .   *.* **

CAGL0M03025g       APLLS--ENNEIHRQHEGTQVQAGNNDILSTRIGFNGKDDYSNSR--------SFTNEMF
Suva_13.468        APLLV--DTPDISNTNTTSTTSNR--SKNSIILDPTFNDDSDRSH--------SNAREVL
Skud_13.452        APLLV--DTPDISNTNTTSTTSNR--SKNSIILDSTFNDDLDRSH--------TNAREVL
Smik_13.493        APLLV--DTPDISNTNTTSTTSNR--SKNSIILDPTFNDDMDQSR--------RNAKEVL
YMR280C            APLLV--DTPDISNTNTTSTTSNR--SKNSIILDTTFNDDLDRSR--------MNAREVL
NDAI0K00390        APLLE--TQR----------------RHNSFP---------------------ETSQPLV
NCAS0C00390        APLLE--LANN---------------DNNNFILD-------------------DESKTIS
ZYRO0G14278g       APLLA--WTP----------------DHNGIVLDVVED---------------EEGSNLQ
TDEL0B00530        APLLD--WSP-EMHTHGKTVSHAS--DRSGIILDSSIPQSEDAL---------STLADRV
KLLA0D01452g       APLLA--WSPDAKPQLNSNNGNDGLNPATGIVLESGDNDSTNASVVQLQQHQQQTHHPPS
ABL121C            APLLA--WSP-------------R--PADDLLL-----DDKGAKL--------ASARSFT
Ecym_4616          ASLLG--WSP-----------KPG--NDDAIILGSDPKDDSEPKL--------NTARSFT
SAKL0D01342g       APLLE--WSP--AGKPVDPGTCNA--NENSIILDTSAANMESEMATGGRLH--SNTRSYT
KLTH0C03762g       APLLA--WSP----------EAAQ--EPIAETSDHDTRNDSGLRR--------KSGAETA
Kwal_27.10232      APLLA--WSP----------EAPQ--PSMPEIAQNADRRDSDPLS--------RTRLPSA
KNAG0J00250        APLLN--EAPEI-----------------------------------------PGQPEFF
KAFR0B03950        APLLANPFKP-------------------------------------------TGENNLV
                   *.**                                                        

CAGL0M03025g       GGSDTKRTRSDTTALLTANSELTHDSQDGNVNFGSTNSELHERLNNNHFDAATSYLPEQK
Suva_13.468        NPTDSILSQ---SVISSISPRTTSN-QRSLSSGNYSKSNGNSRKNSKNAK----------
Skud_13.452        NHADSILSQ---GIMSSISTRTADI-QRSSSSGNDSKSNGYSQKNPKNAN----------
Smik_13.493        NPTDSILSQ---GILSSMSTRATSN-QKSLSSGNNPKGDGSYLENPQSTK----------
YMR280C            NPTDSILSQ---GMVSSVSTRNTSN-QRSLSSGNDSKGDSSSQENSKSAT----------
NDAI0K00390        NTSNAMNLGNA-SLSSTANNNNTMP---------SIANNVGYNNPPLL------------
NCAS0C00390        HSSKTPE-----SILKDEDPVIHHN---------------NLLFNQLN------------
ZYRO0G14278g       QGQQSQEQN---QQQHQLDHNLMQP-----------HMDMDVDIDQDL------------
TDEL0B00530        NKTQSVPVP---TLASHGYKNLPAT----------QSEQLAHGIDSND------------
KLLA0D01452g       HNSSSIPMG---KQSSTSDRQNSHH-----QDNVGSFHSMHSPTIPEQTSAQGLHQHQML
ABL121C            HVNKLSSIP---TLMSTQPPPASAP-----------HAKLGQPAPPDQ------------
Ecym_4616          TVNKLDMIP---TLMSTTKSTTTAPSDAGLPSSIRPNQNPASIKLVQNPLPLSTRKQFAQ
SAKL0D01342g       DAKNLDIVP---TLPSSKQQQQQQH---RLQKGASQQPRSASIPTRKQSL----------
KLTH0C03762g       GVLVAGHSQ---LADSSTDPASQQQ---------RRVGSYDHTYAQDQSV----------
Kwal_27.10232      TIPASDPTH---VISQDSNNVHLRE--------QYRSNSFNQLYAQDQSL----------
KNAG0J00250        NSDEMSPSQ---LTGKLMPMAVNKP--------MDQNSNFTYNYKSSVEN----------
KAFR0B03950        NVSSIETTG---QCINPKVLSSQSS----------DANKDDTDLNLEN------------
                                                                               

CAGL0M03025g       SEYGSSFGNKNTVKSLSPSTSFLDDDTLSLSFGDYSTQRRPRRYPNYNN-----------
Suva_13.468        ---GEQLD--------TPSTLFKMKRTSSSS-S--TSHRGPRRPPKHR------------
Skud_13.452        ---NGQLD--------APSTLFQMRRTSSGP-S--TSHRGPRRPQKHR------------
Smik_13.493        ---SDKLD--------MPSTLFQMRRTSSGP-S--ASHRGPRRPQKSR------------
YMR280C            ---GNQLD--------TPSTLFQMRRTSSGP-S--ASHRGPRRPQKNR------------
NDAI0K00390        --------------------------------S--SSKQKPRHLPTNDTG--------DI
NCAS0C00390        -----------------------------------TSNEKPRHLQTEPNY----------
ZYRO0G14278g       -----------------------------------SIRRRPDRS----------------
TDEL0B00530        -----------------------DNGPAMLT-L--GSRRGPRRR----------------
KLLA0D01452g       GMPNSTLN--------SDTNTGGANVTNSIS-S--TNRRGPRRRWNNA------------
ABL121C            -----------------------DDGILTIP-P--RDQRGPRRLWNSA------------
Ecym_4616          AGNPSRYP--------FSPDLLQEDGMLTIN-T--RSPRGPRRYWNNTA--------SST
SAKL0D01342g       ---CESNP--------TTATGSRDDGVLTMG-T--RNHRGPRRRWNSTTGQNTRTQLATM
KLTH0C03762g       -----------------------EDSAITMP-T--RPHRGPRRRWNSTTG-------AAA
Kwal_27.10232      -----------------------DDTAITIP-T--RSHRGPRRRWNSSNG-------TTV
KNAG0J00250        -----------------------NEGLTLEAIR--GGETSTQRVSNGH------------
KAFR0B03950        --------------------------------G--AVQR-RPRRYNGNFGLGGTGMNSNF
                                                             .                 

CAGL0M03025g       -TLGKDSLAMKTEINGGRNQGNLHDLFQWQNSK-
Suva_13.468        --YGTDHPKSPSDVG--SNTDNLPDLFQWQNAR-
Skud_13.452        --YSTDQSKGFSGGS--SNADNLPDLFQWQNAK-
Smik_13.493        --YNTDRSKSSSDGS--SNTDNVPDLFQWQNAT-
YMR280C            --YNTDRSKSSGGGS--SNTDNVSDLFQWQNAK-
NDAI0K00390        LNFNGDLSNLNFRRDVRRKRENLEDLFSWQNSR-
NCAS0C00390        --PPKGKLNQKTPFA--RKKENIDELFNWHNTK-
ZYRO0G14278g       --RGRGRPR--------KHEENLHDLFCWQNSK-
TDEL0B00530        --RQMDYNSTSNTSNRVPQEANLSNLFHWQNSK-
KLLA0D01452g       --ASSSDPNS-------AGDSSVSDLLRWQNGN-
ABL121C            --LNQARPAA-------ALDDSISDLFRWQNSG-
Ecym_4616          DQPQIHKNNTQQQSQ--QLDDNINDLFKWQNSG-
SAKL0D01342g       NTPQSERSKSQNIGEPGSTEDSLHDLFRWQNSGL
KLTH0C03762g       ITPNSDRPRNAPAS---ETDENLQDLFRWQNSGF
Kwal_27.10232      ITPNSDRPRNPPSSE--SENENYKDLFRWQNSGF
KNAG0J00250        --IRVNRQ---------RQSDAVDDLFSWQNST-
KAFR0B03950        SVSDLLRPDDQKK----REKETLNDLFNWQNSD-
                                           :*: *:*   

FASTA FORMAT for MUSCLE Version 3.6

>CAGL0M03025g
--------------------MVSNADETF----------VAPRLIRVAG-----------
-------------------------------------------GGDDDVHGSG-------
---------------------------------SGAGPANGNSVSGS------NTGSRG-
--------------------STPTY--RVAQACDRCRLKKTKCDGKIPQCSQCALVGFEC
KISDRLNRKSFPRGYTETLEERVRELETENKRLMALCNSDL-------------------
---------------------------------------------------GSNTRSDGL
EKQSPSKRKRSPSMERDSERGFTENMELQLQQSCSS------------------------
---------CGNSDP-----------------------NHRC--------------VHLK
-----PVV-----------------SNIIVDSNTDVSFEQNVAPGLPAVKALNSMAEREE
SAQLAMLVSLALPRSTEEILFIPQLMANIQKTFGFSSKQSLYTVSLLSSLKKNLP-----
-----------------TPNSNSSDENLSPNYYVSEDFRPFFYEVLKFDILGETETENGS
NRNESPDSTIPNSRSD--------------------------------------------
----------------------------------DLLSWMEIQRLVDVYFECWSNTIPIF
SRKLFIKQMKAFKTEV---DKFGDR---LFEVYKTEQIKINFLKIFATVLAVMCQMALLS
RLK---QLEATTQELECKRTQNLIAHYNQLIEKIHLDSFFQDMSTTTVQSLQLLSFISFY
FLNVGDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKFEQGERRLLFWAIYYL
DVFYSLQLGVPRLIKDHEIECALPVSEEEDS---------------------QLEGRVSD
FSLAVIRYAKVLGNILDSIFKRNMMSEAATESMAFVHEKALDIWKNRLPEKYGFRLEANG
LFNFDELTVVKN------------SEKDLI--EKSSILLFYFLAKCMIHLPVIATRSASL
E-QQLQP-----------GTSSDTSETPKESQNKTPTRVCPSYILMQKAASTMLQVMHYT
SEY----YLPSPINISRTKARFALLTACSAVEYLKGGSLYVETKNLLENLIIKLELERKL
DLPGIISWHSLKLLDMALMLLLQSPTTKMEKLDKLVQKKINHYNRQMGIPAM--------
--------------------------------------------KLSNSR-KNNKKIKLE
NESSQLS--STSNPIAKGELKSDS---VV---------------CEEDDNVNDNEVTTTA
KLEENNEFINPNKIE-QGVTSNTLAFSFSSTDLSALFNA---------------PE----
-------------------SLFKVPNENT----------QY-------------------
--------------NQQHEMHNNSISSSHSKEPVNKERDSDKQELNAIFNETQNRS----
----------------TSFAKLMLLLNNE--------HKSLSSSLENDVRNVGNKLSSEN
AGQLPSHGATSGLNSKGNEFLSMNTLY-G------------------GDNDFIIDASLGL
APLLS--ENNEIHRQHEGTQVQAGNNDILSTRIGFNGKDDYSNSR--------SFTNEMF
GGSDTKRTRSDTTALLTANSELTHDSQDGNVNFGSTNSELHERLNNNHFDAATSYLPEQK
SEYGSSFGNKNTVKSLSPSTSFLDDDTLSLSFGDYSTQRRPRRYPNYNN-----------
-TLGKDSLAMKTEINGGRNQGNLHDLFQWQNSK-
>Suva_13.468
--------------------MANSSDRQG----------LEPRIIRTLGSQTLGT-----
------------------------------TN-----------APHKALNTEA-------
------------------------------------NPNFSENIKEALIKT--NSPTPL-
--------------------STPIY--RIAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC
RISDKLLRKAYPKGYTESLEERVRELEAENKRLLALCDIKEQQINLVSQSRPPT------
---------------------------------------------------SLDNTVSDN
FKQDLKDA----PLNLSSTNIYLLNQTVNKQLQNGK------------------------
---------IDTNRSDSTMGLLATSPPLPQK-------DHVCDGVSCTNN------LHAK
-----PTS-----------------TSL--NDPTAISFEQNEAPGLPAVKALKSMTTHQR
STQLATLVSLSIPRSTEEILFIPQLLTRIRQIFGFNSKQCLYTVSLLSSLKNRLPAPKLL
LSSTSTKIKE-------NDDSKFLNTFETTSLAEFGDLKKFLIS-LKFDINSFSNQQ---
-------PEVQNNKSDN-------------------------------------------
----------------------------------DLLSLNEIKELLHLFFKFWSNQVSIL
NNDHFLLYFNNFVEVIKALPLE------LKKTNGTKTHATTNHQIFALKLLIMLQMGLLI
KVK-REKIKDTVPGNQNSKFAKLMVYYHQVSSIIPKNPYFLNMSTTSLPSLQLLSLTSFY
FLNVGDIPAIYGLRGRIVSMSQQLRLHRCPSAVLSVHSNPVLQRFEQSERRLLFWAVYYI
DVFASLQLGVPRLLKDFDIECALPISDVEFEDQLASENE----KTKNKTKKIQLQGQVSS
FSLQIIRFAKILGNILDSIFKRGMMDERVTSEVALVHENALDNWRNQLPEMYYFQITVNG
TVNLDDIRANNSRNTEAK-----FDRKDIICFEKNVLLLFYFLAKSMIHLPVIATKPLPK
TVDNSTKKKHSMFNNDTKSINNQDHSVVDVDMTSPAIRTSSSYIILQQATNATLTLFQSI
NSV----YLPLPLNVSRTLIRFSLLCARGSLEYTKGGALFLDNKNLLLDTIKDIENDRLL
DLPGVASWHTLKLFDMTINLLLKAPNVKVERLDKFLEKKLNYYNRLMGLPPTTTTSSEPL
FSSQSKNTPANGSRSSIVKRENPENEYLYGDGINNGNTDMDKPSTEDARN--VNKRLKHE
KSISQSIDDDNMSRNQNGSKFQQD---SKKNMSTSNLFPFSFSNTDLTALF-TNPEGLNF
ADTNDYDKNDGNKTSTDTADTNT--GNLSFLNMAPFLQA---------------GN----
-----TNQGIDDNKVVDKNSIFSLPSNLDLMKDSLDSKLEI-------------------
--------------SNSASKQNSEFLANDQLQL--TGRDTSMEKSSPIFNNKSNYS--LT
KLMRLLNNDN----SFSNISINNFLYQND---------SSRHDPAIKAAANVSSNFNPAS
TASNTSRSSITGNKKNGMDNCDINDFG-NFNNFMTNVNYSG------VDYDYIVDASLGL
APLLV--DTPDISNTNTTSTTSNR--SKNSIILDPTFNDDSDRSH--------SNAREVL
NPTDSILSQ---SVISSISPRTTSN-QRSLSSGNYSKSNGNSRKNSKNAK----------
---GEQLD--------TPSTLFKMKRTSSSS-S--TSHRGPRRPPKHR------------
--YGTDHPKSPSDVG--SNTDNLPDLFQWQNAR-
>Skud_13.452
--------------------MANNSDRQG----------LEPRIIRTLGSQTLSG-----
------------------------------ST-----------VPNRTLSSEA-------
------------------------------------NPHFSENIKEATVNT--TSPTPL-
--------------------STPIY--RIAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC
RISDKLLRKAYPKGYTESLEERVRELEAENKRLLALCDIKEQQISLVSQSRPST------
---------------------------------------------------SLDSNVDGN
CKKELKDA----PLNLSSTNIYLLNQTVNKQLQSGK------------------------
---------MDNDNSDAAIDSLAASPSPPPK-------DHVCDGVSCTNR------LHVK
-----PTS-----------------TSL--SDPTAISFEQNEAPGLPAVKALKSMTTHQR
STQLATLVSLSIPRSTEEILFIPQLLTRIRQIFGFNSKQCLYTVSLLSSLKNRLPAPSIL
LPSTSTNSKEKNEDKTPNDDSAFLKTFQSTSLSEFVDLKKFLIS-LKFDIDSFSKQP---
-------EKQANGHDS--------------------------------------------
----------------------------------DLLSLTEIKELLHLFFKFWSNQVPIL
NNDHFLLYFNNFVEIIKDFSLIS-----TKANSTTKNNVTTNHEIFTLKLLMMLQMGLLI
KIK-KDKIKDTVPRNSNAKYIRLMSYYHQISLIIPKNPYFLNMSTTSLPSLQLLSLASFY
YLNVGDISAIYGIRGRIVSMAQQLRLHRCPSAVLSVHSNPVLQKFEQSERRLLFWAIYYV
DVFASLQLGVPRLLKDFDIECALPISDVEYKDQLSMENE----KMKNKAKKIQLQGQVSS
FSLQIIRFAKILGNILDSIFKRGMMDERISSEVALVHENALDNWRNQLPEMYYFKITVNG
TVNLDEIRANNSRDIETP-----FETKDIILFEKKILLLFYFLAKSMIHLPVIATKPLSK
NVDNVMKKKQSMFNNDSKGTNNHDHMAVDVDMTSPAIRTSSSYIILQQATNATLTIFQSI
NWM----YLPLPLNVSRTLVRFSLLCARGSLEYTKGGALFLDNKNLLLDTIKDIENDRLL
ELPGIASWHTLKLFDMTINLLLKAPNVKVERLDKFLEKKLNYYNRLMGLPLATTTSLKPL
FGFQSKNSPETKPRKSTVKRETPDNDYLYGNDTNNNNNPETDQPRTANVG-NTNKRLKYA
KDTRQSVDKDGIAKAQDASNFHHD---NKKTMSASNLFPFSFSNTDLTALF-AHPEEPNC
ADSNSNNLNDCNKSSTDAADANI--GNLSFLNMAPFLQA---------------DN----
---VTTNQNAVCDKTIHKDAIFSLPSNLDLMKNNMDSKPEK-------------------
--------------KNSIIKQNPKSSSNSQLQH--RDKDVNIESNNPPFNSKSNYS--LT
KLMRLLNSDN----SFSSISINNFLYQND-----QNSAAQDTGTNNRAGSNTGSNFKPAS
SASNESQSSITGNAKHGMDNCDFNDFG-NFNNFMTNVNYSG------VDYDYIVDASLGL
APLLV--DTPDISNTNTTSTTSNR--SKNSIILDSTFNDDLDRSH--------TNAREVL
NHADSILSQ---GIMSSISTRTADI-QRSSSSGNDSKSNGYSQKNPKNAN----------
---NGQLD--------APSTLFQMRRTSSGP-S--TSHRGPRRPQKHR------------
--YSTDQSKGFSGGS--SNADNLPDLFQWQNAK-
>Smik_13.493
-------------------MANNNSDRQG----------LEPRVIRTLGSQALSG-----
------------------------------PN-----------ISNRTLSSEA-------
------------------------------------NSHSSENTKDAMIKT--TSPTPL-
--------------------STPIY--RIAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC
RISDKLLRKAYPKGYTESLEERVRELEAENKRLLALCDIKEQQISLVSQSRPPT------
---------------------------------------------------SMDNTANGS
FKQELKDA----PLNLSSTNIYLLNQTVNKQLQNGK------------------------
---------MDSDNSNTVMNSLAAAPLPPQK-------DHVCDGISCTNH------LHVK
-----PTS-----------------TSL--NDPTAISFEQDEAPGLPAVKALKLMTTHQR
STQLATLVSLSIPRSTEEILFIPQLLTRIRQIFGFNSKQCLYTVSLLSSLKNRLPAPRLL
PPSTSTKLKEKGEDKILDDDSAFFKKFQTTNLSEFVDLKGFLVS-LKFDIDSFSKQS---
-------ENLPNDHDN--------------------------------------------
----------------------------------ELLSLTEIKELLHLFFKFWSNQVPIL
NNDHFLLYFNNFVEVVKDLSSAN-----LKTNVTNTSIVTTNHELFALKLSMMLLMGLLV
KIK-MEKIKYTVPKNPNSKYARLMAYYHQLSLIIPKNPYFLNMSTTSLPSLQLLSLASFY
YLNVGDISAIYGVRGRIVSMAQQLRLHRCPSAVLSVHSNPVLQKFEQSERRLLFWAIYYV
DVFASLQLGVPRLLKDFDIECALPISDVEYKDQLFMENK----KTNKKAKKIQLQGQVSS
FSLQIIRFAKILGNILDSIFKRGMMDERITSEVALVHENALDNWRSQLPKMYYFQITVNG
TVNLDEIRVNDSKNIETR-----FEKKDIILFEKKILLLFYFLAKSMIHLPVIATKPLPK
NIDNGTKKKQSVFSNDSKGSNDQDHMIVDVDMTSPAIRTSSSYIILQQATNATLMIFQTI
NWM----YIPLPLNVSRTLIRFSLLCARGSLEYTKGGALFLDNKNLLLDTIKDIENDRLL
DLPGTASWHTLKLYDMTINLLLKAPNVKVERLDKFLEKKLNYYNRLMGLPLATTTSIKPI
LGSQSKDSPETRPRKSIVKRENPEYEYLYGKDDNKKNNSGPDQSPIENTS-NGSKRLKYE
TDTKRGVDTGSIFKSQNAENFQHN---NKKTMSTSNLFPFSFSNTDLTALF-THPEGANG
ANNNNSNFNGCDRFSTDAADANI--ENLGFLNAAPFLQA---------------GN----
---SKTDPNMTNNKPMHMDALFSLPSNLDLMKDNMGSKSER-------------------
--------------LEPVIKQNTESLASSKLHE--KNKDSIMENNNLAFNNKSNYS--LT
KLMRLLNNDN----SFSNISINNFLYQND-----QSSISRDPGADNKTATNTGSIFKPPS
TAGHRSQSSSIGNTNHGVDNCDFNDLG-NFNNFMTNVNYSG------VDYDYIVDASLGL
APLLV--DTPDISNTNTTSTTSNR--SKNSIILDPTFNDDMDQSR--------RNAKEVL
NPTDSILSQ---GILSSMSTRATSN-QKSLSSGNNPKGDGSYLENPQSTK----------
---SDKLD--------MPSTLFQMRRTSSGP-S--ASHRGPRRPQKSR------------
--YNTDRSKSSSDGS--SNTDNVPDLFQWQNAT-
>YMR280C
-------------------MANNNSDRQG----------LEPRVIRTLGSQALSG-----
------------------------------PS-----------ISNRTSSSEA-------
------------------------------------NPHFSKNVKEAMIKT--ASPTPL-
--------------------STPIY--RIAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC
RISDKLLRKAYPKGYTESLEERVRELEAENKRLLALCDIKEQQISLVSQSRPQT------
---------------------------------------------------STDNTINGN
FKHDLKDA----PLNLSSTNIYLLNQTVNKQLQNGK------------------------
---------MDGDNSGSAMSPLGAPPPPPHK-------DHLCDGVSCTNH------LHVK
-----PTS-----------------TSL--NDPTAISFEQDEAPGLPAVKALKSMTTHQR
STQLATLVSLSIPRSTEEILFIPQLLTRIRQIFGFNSKQCLYTVSLLSSLKNRLPAPRLL
APSTSTKLKEKDEDKKLDDDSAFVKRFQSTNLSEFVDLKKFLIS-LKFNINSFSKQS---
-------EKPANDQDD--------------------------------------------
----------------------------------ELLSLTEIKELLHLFFKFWSNQVPIL
NNDHFLIYFNNFVEVVKHLSTEN-----LETNNTTKSTVTTNHEIFALKLLMMLQMGLLV
KIK-MEKIKYTVPKNPKAKYARLMAYYHQLSLIIPKNPYFLNMSTTSLPSLQLLSLASFY
YLNVGDISAIYGVRGRIVSMAQQLRLHRCPSAVLSVHSNPVLQKFEQSERRLLFWAIYYV
DVFASLQLGVPRLLKDFDIECALPISDVEYKDQLSMENE----KADKKAKKIQLQGQVSS
FSLQIIRFAKILGNILDSIFKRGMMDERITSEVALVHENALDNWRNQLPEMYYFQITVNG
TVNLDEIRATNQRNTETK-----FDKKDIILFEKKILLLFYFLAKSMIHLPVIATKPLPK
NVDNATKKKQSMFNNDSKGATNQDHMILDVDMTSPAIRTSSSYIILQQATNATLTIFQAI
NSM----YLPLPLNVSRTLIRFSLLCARGSLEYTKGGALFLDNKNLLLDTIKDIENDRLL
DLPGIASWHTLKLFDMSINLLLKAPNVKVERLDKFLEKKLNYYNRLMGLPPATTTSLKPL
FGSQSKNSLENRQRTPNVKRENPEHEYLYGNDSNNNNNSEAGHSPMTNTT-NGNKRLKYE
KDAKRNAKDGGISKGENAHNFQND---TKKNMSTSNLFPFSFSNTDLTALF-THPEGPNC
TNTNNGNVDVCNRASTDATDANI--ENLSFLNMAPFLQT---------------GN----
---SNIGQNTIENKPMHMDAIFSLPSNLDLMKDNMDSKPEQ-------------------
--------------LEPVIKQNPENSKNNQFHQ--KGKSTNMEKNNLSFNNKSNYS--LT
KLMRLLNNDN----SFSNISINNFLYQND-----QNSASADPGTNKKAVTNAGANFKPPS
TGSNTSQGSILGSTKHGMDNCDFNDLG-NFNNFMTNVNYSG------VDYDYIVDASLGL
APLLV--DTPDISNTNTTSTTSNR--SKNSIILDTTFNDDLDRSR--------MNAREVL
NPTDSILSQ---GMVSSVSTRNTSN-QRSLSSGNDSKGDSSSQENSKSAT----------
---GNQLD--------TPSTLFQMRRTSSGP-S--ASHRGPRRPQKNR------------
--YNTDRSKSSGGGS--SNTDNVSDLFQWQNAK-
>NDAI0K00390
-------------------MPSNVEEKTS----------LTVKDEEECNNHSDNNIAFET
DGSDDRTKNILSI-----------------IP-----------IQNTSLTNPR-------
----------------RKGRGNSNMAVSKRKLDSISNSSSTDTKDDSVS----ISITDS-
--------------------TSGNYSKRISQACDRCRSKKTRCDGKRPQCSQCAIVGFEC
KVSDKLQRKSYPRGYTETLEEKIRELQTENKRLLAIYNLKQNQLSVSS-SSSSTSPN---
---------------------------------------------------KKGNGNDCA
VQSNSTSTSAINDTNENGSNETAMKEIIQSQLIPLTNINSVHDP----------------
---------IQNNDDNTHTDCCNHTIKTINPDNNNNYSTHTTNGKLHRDT--NDHHLHPK
-----PVS-----------------TNS--NGLNSISFEQNEAPGLSTVKALKSMVNDEK
NTQLATLVSLAIPRSTEEILFIPQILAKVRQNFGFTSKHCLYTVSLLSSLKSFLSNSNNS
ISAA-------------SADNKNLETLKNTNLWKFNALFQFFTAFLKLDFLDSSLEKQNK
GKKNGKVNNNNNNSANQDGI----------------------------------------
----------------------------------SPLSSSEIDELLKLFFQNWSDFVLMI
NEKEFYQYYSVFKSDL--------Q---NNNISKMSLSTLMNYKIFGLIILLFCQMGLLS
KIKLSSNNTKSKNFKQQYHLKKVMNYYHNLINKLMWNEFF-KISNVTLQSLKLLSLILFY
NLHMGNISNIYELRSKVISMSQQLRLHRCPSAVLC-GSTLKIHKLEQSNRRLLFWNIYYL
DIFASLQLGVPRLLKDHEIECALPIPMDTDSKSDNQSQRSAATNAENDDNKIKLEGCVSH
LSLVIIRYSQIVGNILDMIFKRN-MTESMTKSIALIHIHALDDWRNTLPSNLKFDLNVNG
SIDLSSFIDQQNLNEEEQ----RTQQQKLL------VIFLYFFGVNMIHMPVVASRPLPL
V-ENDSL-------------------------NQIPDRSSSSYIALQHATNTMLNVLDLL
SPT----YVPLPINMSRTMVRFSMISACGMLDFIKGGSLFLENKALLAQVVKNIETDRFL
DLPGVISWHSLKLFDLTLTLFFQNTNIKLEKLDKLLEKKSNYYNRLMGKPIVRNPAEKNS
TTVPASMSAVDETDLPRADKKKKDIVDTENEYVSSVPDTNNIVVKQTPEEWDTSTKTNVK
DSTLAHKLTTIELPSTDKKKRKQEQISPVNKKAKKAEQEVSQTQVGVPRSSTSSTAQNSN
YANIQNQFADALQFD-PILNSNS--FNFSNLDLSSLFKTVDKDSQKTNNLQVPTQNSDQP
VAANGISTTVPTTSIQSFPTPKSLIQNDQILLSKIPSFNDFFKDYSYDRTSSLLGLSGLN
NNNNNNTNINNINNSTSNEIQKQNSSDTGNPSRNTQAQMNDFNGKYQLLSSPSQLLPKQA
TNTVFLNKDKANKNDIGSLSTMMMLINNEIPFSSVNLSELLKPSESKTSNDNASNGISAN
SHNSLEFGNTLKLNQNGNSNVTTNGTSMNQVEIPSTLIADSLTDTPIPDYNYFVDASLGL
APLLE--TQR----------------RHNSFP---------------------ETSQPLV
NTSNAMNLGNA-SLSSTANNNNTMP---------SIANNVGYNNPPLL------------
--------------------------------S--SSKQKPRHLPTNDTG--------DI
LNFNGDLSNLNFRRDVRRKRENLEDLFSWQNSR-
>NCAS0C00390
-----------------MPTNNSNVKVEG----------HSARHTDRLIPIQMQS-----
----AKVIDPI--------------------R-----------SRTASLPVNA-------
---------------------------------TTAASSPSVQPPPPSSTS--SSVAPN-
--------------------EDSNL--RIAQACDRCRSKKTRCDGKRPQCSQCAIVGFEC
KISDKLQRKSFPRGYTETLEEKVRELENENRRLLAICQFNKLQSQ---------------
---------------------------------------------------KNDTIDNST
TQEEVY------SIRSNSASSTAIETDSN-------------------------------
--------------------------------------ITTCLDTNCNND--THNHLHMK
-----PVS-----------------TK---PPQNIISFEQNEAPGLSAVKALKSMANHEQ
STQLATLVALAIPRSTDEILFIPQLLSKIRQNFGFTSKHCLYTVSLLSSLKPNLPPPKMI
ANNL-------------EMTKKLLNQLKITNLWKFDDLSQFINQYLKLDPLN--------
-------QKNSN------------------------------------------------
----------------------------------DLLNQIEMDELINFFFQDWNDIIPII
NKEEFLSNYNAFKLDL--------K---NSERDKLSSNLKMNYKIFGCILVLMCQMGLLT
KIK-ATNGKS----SPNIHLKSIMAYYHQLIANLPINNFF-QIATISIPQLKLYVLILFY
NLNVGDISAIYELRGRIISMSQQLRLHRCPSAVLS-GSSLTMNKLDQSNRRILFWTIYSL
DALSSLQLGVPRLLKDYEIECALPITMEDKE---------------RDKTKIKLEGTVSP
FSLAIFRFSKILGNILDMIFKRN-MTESMTKSVSLIHENALDQWRYDLPEDLTFKLNIQG
SIDLNVMHQGNST----------PGKKNLI------LMFFYFFAVSMIHLPVVAARPLDV
K-------------------------------NAMPDRSSSSYIALQHAINTMLNVLELL
NNQPKNYYLPVPINMSRLQIRSALISSRGMLDYIKGGALFLDNKTLLLQVIKNLERDRTL
DLPGVVSWHSLKLFDLTITLFIQNSNIKLEKLDKILEKKSNYYNKLMGKPTS--------
---------------------------------------NNTNNNISSKK-RKQETIEIS
TPS------PTSPPLKKMSKKSKS---PI-----------------LQSTILPSQTLQNY
NNNIQNQLADALQFD-PILNSNS--YNFSNFDLSNYFQP---------------NE----
----NEKTVQLPKLTTNNNVTNEDPTKYK----------EL-------------------
--------------FNPTAVTGTSLLNLSTLAS--PGTSTGLTTTSDNNNILTKGN----
--------------NNNNNNTNTVFLNNR--------DNNSTDNLSTMMMLVNNEIPFSN
LNLSELWNNKLSTEDKDKQGQEQNQPR-NTNDDVGMTN---------SNYGYFVDASLGL
APLLE--LANN---------------DNNNFILD-------------------DESKTIS
HSSKTPE-----SILKDEDPVIHHN---------------NLLFNQLN------------
-----------------------------------TSNEKPRHLQTEPNY----------
--PPKGKLNQKTPFA--RKKENIDELFNWHNTK-
>ZYRO0G14278g
-----------------MKDDADTRESNGSTRVPTTGAMQGPRYIRTLGSQSLGGLA---
------------------------------GS-----------NSSRSSTSPP-------
----------------YEQDDDSKESSSVPQSASMTGSSSQNAQREGGGNG--SIASPA-
--------------------GSQNL--RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC
KISDRLSRRAFPRGYTETLEERVRELEAENRRLVALCDIKEQQIHLFSQQHSP-------
---------------------------------------------------GGRRKDDER
MLRELQSANGG-SLNISSTNLYLLNTGSHQRQGPQG------------------------
---------PQQQEQLTQQKRQ----------------PHVCDGLCCAGK------LHVK
-----PVS-----------------TNL--NDPTSVSFEQSEAPGLPAVQALTSVATREQ
SNQLATLVALSVPRSTEEILFIPQLLARIRQIYGFTSKQCLYTVSLLSSLKSSLPEPH--
-----------------LVKHEPLETLASTNLWEMDDLEQFFAEIFKFKLES--------
-------KSPSSYKGG--------------------------------------------
----------------------------------AQLNLSEIEELISIFFEHSSIHIPIL
VKDEFYHYFNQFKENVLQNLEFL-KTPLQGPALTARRGKIISYKIFGCIILMLCQLGLLS
KIK-AENL------GATSKHHRLASYYHKAISLVYMNPYF-GVLSTSLQSLQFLSLVLFY
FLNIGNVSAIYELRGRVVSMAQQLRLHRCPSAVLG-GAGSTMNKREQGDRRVLFWGIYYL
DVFSALQLGVPRLIKDFEIECALPVADNDDR------------TVNLAGQQIRLEGQVTN
YSLAIIRFSKVLGNILDSIFKRG-MTESITKQVSLIHENALDNWRHGLPKELIFELDVNG
TINIDEFNRLKQMNVTVE------RSENMT------LLVMYFLAKCMIHLPVVATRPLPT
N-DSNDTGETSNATSNGNNVRARDPSTERN--QAAADRSSSSYVLLQQATNTMLNVLESL
KTL----FLPLPLNISRTKARFALLSARGSLEYTKGGALFLDNKSLLLDVIKDLEEDRKL
DLPGVISWNSLKLLDMSINLLLQPPNTEVGKLDRLLKKKLNYYNRLMGRPTV--------
----------------------------KQEPASKGHDLTPASSKDEEDT-PAAKRIKIE
ETSI-----PLAVPQQQQHMQAPA---PVMVQEKQQPQPQPQPQPQPQPQLQPQPQQLQL
P---QTAFAEALQLD-PVLNSNV---SFQNAPPTTLYDG---------------------
----------------------------------PHDQPHQ-------------------
--------------YQHHAQTQPQDPHLDTRSS---------DKLHGLFKVPSTAD----
----FLMD------DSANSQLNFLLGTTE--LGVLDPSQPSYTNNPGSGSAIGINNMPSG
LNLSNLFD-LEGSTDQPPTNTNATQAT-QANS---------------GGFNFAVDASLGL
APLLA--WTP----------------DHNGIVLDVVED---------------EEGSNLQ
QGQQSQEQN---QQQHQLDHNLMQP-----------HMDMDVDIDQDL------------
-----------------------------------SIRRRPDRS----------------
--RGRGRPR--------KHEENLHDLFCWQNSK-
>TDEL0B00530
--------------------MKEMAAKDG-----------GPKYIRTMGSQSLSGLNPLS
S-----------------------------GG-----------SSQVSISHSP-------
-------SVLLDDNGSEDVRSAKRKSPSLLAGTPSQRPRLNTEVSEVASY---TSVNSA-
--------------------ANSNL--RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC
RISDKLSRRAFPRGYTETLEERVRELEAENRRLVALCDIKEQQIHLVS--HFPTNK----
---------------------------------------------------KKIGGNDEQ
MLQELTGANNG-RLRISSTNLFLLNKARDGKQPATI------------------------
---------SNGDDHMTKPDHEHTG-------------KHRCDELDCNNK------LHSK
-----PVS-----------------TNL--NDPTAISFEQNEAPGLPAVKALTSMATREQ
STQLATLVALSVPRSTEEILFIPQLLARIIQIHGFTSKQCLYSVSLLASLKNNLPGPQ--
-----------------LVKWDELDYLKTTNLWEVDNLDKFFHETLKFNILR--------
-------PGVSDDGES--------------------------------------------
----------------------------------LGLSIKEIDELVNLFFDSWAVHIPIL
DKEEFFSYYDKLKKDISTQPGLF-Q---EGPSNFARRNKIISYKIFACILFTVCQMGLLT
KVK-GEKIT-----SADSPYVKLTSYYHRAISLIYLNPYF-GVLTTSLQSLQFLSLLLFY
FVNTGNVSAIYELRGRVVSMAQQLRLHRCPSAVLG-GSGSTMNKREQGDRRVLFWGIYYL
DVFSALQLGVPRLIKDFEIECALPVAENDDR------------EVSLAGQMIRLEGRVSQ
FSLAIIRFAKVLGNILDTVFKRG-MTESVSKKLALIHENALDNWRRGLPAELIFEIEVNG
TINMDKFNEMKQNNATVE------NVEQMV------LLVSYFLAKCMIHLPVVATRPLPS
S-DDPNS-----------DIKEEEEVNDKNGESNFAIRSSSSYVLLQQATNTMLNVLESL
KSI----YLPLPFNVARTKARFALLSARGSLEYIKGGALFLDNKALLLDVVKSIEEDRKL
EIPGVISWHGLKLLDMTISLLLQPPNTKVEKLDRLLKKKLNYYSRVMGRPILKTSSLRQE
ANGKRRNSSDDKLSRS------------GTEENFRATNLTPISSKSDGSP--VEKKIKLE
DES------SDTSNALVDKSYTDD--------------------------LSSSANQPQV
PASTQTAIAEALHLD-PVLNNNI----LSVADLAAFFGG---------------------
----------------------NMPAAGGNQHSSYTNQNDF-------------------
--------------APKHMRKEKEPAAFSDLAH----KKSSVTGVDGLFRVPSNAD----
----FLMDEYY---PSGTSHINLTLFNNN-----ANNHDDTFGLSDGHGKDTGVNTNFNV
KGGHQSTNHSHLTNFNDRLQGNQLGFT-NSGNMNSG-----------SDFNFAVDASLGL
APLLD--WSP-EMHTHGKTVSHAS--DRSGIILDSSIPQSEDAL---------STLADRV
NKTQSVPVP---TLASHGYKNLPAT----------QSEQLAHGIDSND------------
-----------------------DNGPAMLT-L--GSRRGPRRR----------------
--RQMDYNSTSNTSNRVPQEANLSNLFHWQNSK-
>KLLA0D01452g
--------------------MVEKKDSAG--RFNGQPSHGGPRFIRTLGSQSLSGLNPLS
NAQQGVSQQQQHLSHHSHNVTDSDSPSIQDSGIPITSALIKKESPSHAVSGIP------S
NSNSINNNSKSNSNNNPSSVFSSRNNTSIQQLQQGPSPTLSNSESPVNASLLSSITTPLL
HQTGSASHPPSNTGSSTNGTTTPSY--RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFEC
KISDKLSRRAFPRGYTETLEERVRELEAENRRLVALCDLKEEQLHLVSKYSNSKDENGV-
---------------------------------------------------EIPSTEEEQ
ILHELSKTNGG-SLRVSSTNLYLLNKKASPGDDSH-------------------------
---------IESSEPSIPVRKVAITAPSPRIMSPR---NSVADSDPSQTNTGNNDHIHSN
-----NNN--------------HNQNNS--TDPYGISFEQNEAPGLPALKALSSLSKYKQ
GTQLATLVAVSVPRTTEEILFVPQLLARIGQIHGFTSKQCIYTASVLASLKENNI-----
-----------------SSIPPELEVLKNHNLWEIDDVLHFWKNVFKLDFMT--------
-------HTAVDHSS---------------------------------------------
----------------------------------THLNFAEVEELMQLFFQDWYELIPLF
DKNEFNSYYEKFKLNV-TDPNFFVR---KDDTVFNNRTRSISYKIFSCLLIIIVQMGMLS
KIK-RDKI-------TSGKLSTLMKYYDKLMTHIWINPYF-NSRNTSIQVLQCLSMLLFY
MLNVGDISSIYELRGKVVSMSQQLRLHRCPSAVLG-GDGSTVSKVQQGERRILFWSIYYL
DVFSALQLGVPRLLKDFEIECALPVTSDDDR------------QVNLAGQMIALEGKVSQ
FSLSVIRFAKVMGNILDSTFKRG-MTTSLTKQAALVHENALDNWRHGLQKDLFFQLDVNG
TINMDEFNQQKQYSKSLSPRTAAFTHNSLV------LMTLYFMAKCMIHLPVVATKPLVA
E-AIQTP---------------TDNQT----ENGSVDRSLSSYVLLQQATNTLLNVLTAL
NSI----YLPLPINLARTKTRFGLFSARGSLEYTKGGALFQDNKALLLDLVKELETDKKL
ELPGNTSWHSLKLFDLSINLILQPVNSNPEKTEKMIQKKINYYNKLMGQPTV--------
---------------------------------AVKRKRDPKATENT------SKKVKVE
DDHSQDNLHNITTGETTDTVHSEE-------------------------LVKDVPKELNV
YPENYTTIEEAFQMD-PVLNTNL----FSNTDLKTLFNSGIFENAGSIHNNINDNNNNNN
NTNNTNNNNGSSRNIHNLGAGIEDIDHGMSLRSNDASLLNL-------------------
--------------SNALGNHGNSAEGMKDGTS--VSNLLNLSTSDSLFKVPSNGD----
----FLKDYYIN--NMSNTGLSNLHTSSV--------------NKGPSLSQLGSLFMSSG
SGTNLPYSNVRGESKHP-SGVNLNKQR-AQPAM--------------DGFSFAADASLGL
APLLA--WSPDAKPQLNSNNGNDGLNPATGIVLESGDNDSTNASVVQLQQHQQQTHHPPS
HNSSSIPMG---KQSSTSDRQNSHH-----QDNVGSFHSMHSPTIPEQTSAQGLHQHQML
GMPNSTLN--------SDTNTGGANVTNSIS-S--TNRRGPRRRWNNA------------
--ASSSDPNS-------AGDSSVSDLLRWQNGN-
>ABL121C
-------------------MAGPRKEKDG----------YGPRIIRTLGSQALGGAG---
------------------------------GS-----------SRASSVSQSP-------
--------------------------GGPEGATGGASPAAAPQSTTG------TPLSSL-
--------------------TPTNY--RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC
KISDKLSRRAFPRGYTETLEERVRELEAENRRLVALCDLKEEQLRLVSKYGCASAPATSS
SSANKKGDS------------------------------------------DHTTLEDEQ
ILQQLSNSDGG-ALRVSSTNLYLLNKKTAAFPLVQP------------------------
---------VQQNLSPTQLRSNPYTRATLSP-------SHVAEADHVTDL---RKGLPAN
-----PVAISSSVGQVPP----YPFTNL--NDPTSISFEQDQAPGLPAVKALSSLASHEE
SSQLAALVAVSIPRTTEEILFVPQLLARIGQMHGFTSKQCLYTASVLASLKEITP-----
-----------------RKTSSILEQLKAKNLWEIDNVDTFLLEGLQIDIRR--------
-------GSSGDFNLENP-------------------------------------NGYKL
ENEYHQTKDAHPELQEL-----------------TPLTFQEIEELIQLFFDDWYSLIPIF
DRSEFESYWVKFKDNV-STPGFF-T---SGDTLFDRRHKSISYKIFACLLLTVCQMGLMS
KVK-RERH------ERGDRLNNLMTYYDRAISHVIMNPYF-SSSSTSIQSLQLLSLLLFY
FLNVGDVSNVYELRGKVVSLTQQLRLHRCPSAVLG-SDGSTVGKIQQGERRVLFWGVYYL
DVFSSLQLGVPRLMKDHEIECALPVSSDDDN------------HVNLAGQMIALEGKMSP
FSLSIIRFSKVLGNVLDSIFKRG-MTESMTKQVALVHENALDNWRHALPDNLRFQLDVNG
TINMEDLNQLKRDYLNKD--TA-LKLNNAI------FMALYFLAKIMIHLPVVATKPIID
K-PQPVV---------------DTNIP-----GSQIDRSSSSYVLLQQATNTFLNVLSSV
SSL----YLPLPLNITRTKTRFGLVSARGSLEYTKGGALFQDNKNLLLDLLKDLEADKKL
NMPGTISWHSLKLLDMAVNLILQPPNTKPEKQEKLLQKKINYYNKLIDSHLG------PT
ASLPTPGQTAPRKPEPAHARPIPE----KEKPPSSKRHRGDDNAAASMPP-LLEKKVKLE
APAS-----NMPTPPAPISALHED---VPRVLDGHLG-----ANSSLAVLAAKHEPEGSL
HSSAGNAITEAFQLD-PILQPTP----FSNTDLPSFFGV---------------------
-------------------DQYAAPPELQPFPAGYAA-----------------------
--------------PDKVPQAAAQGPSATAGPP--------LSSKDSLFKVPSNGD----
----FLKDYYS---GMSSAQLNSLFTAPD-----------------------RRDVRPRA
PQPDRAPSDGLQQQ---------------------------------PGYGFVVDASLGL
APLLA--WSP-------------R--PADDLLL-----DDKGAKL--------ASARSFT
HVNKLSSIP---TLMSTQPPPASAP-----------HAKLGQPAPPDQ------------
-----------------------DDGILTIP-P--RDQRGPRRLWNSA------------
--LNQARPAA-------ALDDSISDLFRWQNSG-
>Ecym_4616
-----------------MSGNIGKKDKDT----------YGPRIIRTLGSQALGGHIRGG
HGSQGNNTRMV-------------------SG-----------SQPSSLSESPISVDVGA
LQDEAHGGSQSSQQGQQKQQLVQQLGQQLGQVRGALSPTMVQASATPGS----TPLSSM-
--------------------TPMSY--RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC
KISDKLSRRAFPRGYTETLEERVRELEAENRRLVALCDLKEEQLRLVS--KYSAGSVGVG
VGGPVTAGTTVGNRSSVNGAVNESASSTVGSIATAGSTAGLAHQNKKCAGSDSTTPEEDR
ILQQLSKSDGG-TLRVSSTNLYLLNKKTSGQQQLLL------------------------
---------PGSANKSEAFPIQPDSYKLQQRSQSTAS-SHVADSDNPAEF--QKEHLQPR
TLPNIPVA-STAIPSAPPGVTAYSLANL--NDPTSISFEQDQAPGLSAVKALSTMANHEQ
SSQLATLVAMSIPRTTEEILFVPQLLARIGQVHGFTSKQCLYTASVLASLKEIVP-----
-----------------YQTSPELELLRSKSLWEIDDVDSFLSKGLRFSFPS--------
-------ATSAENNNEEPGCGVTTRAVADNTSANTTAVSTSTTNAAETTAAVNTTGARNA
DDDGTATATTNTTNSEIDIATTKVGGSRKSTAYPSGLSFQECDEMIHLFFDEWYSLIPIF
DKSEFDNYWQKFKENV-STPEFF-T---SGDTIFAKRHKSISYKIFACLLVTVVQMGLMT
KVK-RENL------GRRHKLNILMTYYDRALSHIITNPYF-GSNSTSIQSLQLLSLLLFY
FLNVGDISNIYELRGKVVSFAQQLRLHRCPSAVLG-GDGCTVSRIQQGERRVLFWGVYYL
DVFASLQLGVPRLLKDHEIECALPVSSDSDR------------QVNLAGQMISLEGKMSP
FSLSVIRFSKVLGNVLDSIFKRG-MTISITKEVALVHENALDNWRHGLPDGLRFQLDVNG
TINMDEFNQLKHEYLNND--NSKFNKENFI------FMTLYFLAKSMIHIPVVAGKPPVD
T-SVQEK---------------NDPAI-----SRQADRSSSSYILLQQATNTFLNVLTSM
RTA----YLPLPINISRAKTRFGLFSARGSLEYTKGGALFQDNKSLLLNLIKELEVDRKL
GIPGTISWHSLKLFDMAINLILQPPNTKPEKEEKLLQKKISYYNKLIDHSVGMHASVITS
AAIQHQRQQQQQQQQQQQQQQLH-----YKENKGNGAKRKPEIGSSTTTNMSLNKRVKME
EPSV-----KIPTSNGPLSALHED---DSEMLGKSLRSNTIVSDVPTGQKM---ESEIPV
SMSATNAIAEAFQLD-PVLHATP----FSSTDLTSFLNG---------------------
--------EVVTNASMFADTMHTTGIGGGLTDVSGHNGLPS-------------------
--------------NNSLLNMSSIGFGIGSGPS-----LANLSSKDGLFKVPSNGD----
----FLKDYYS---GMSSAQLASLFVNGN------TENALQKPTDHRRYQPSQSQGQQLH
LQPHPEPQRQRQQQQQQHPDHQRYPLE-DEPGICEQSKIRTEKKNQQQGYGFVVDASLGL
ASLLG--WSP-----------KPG--NDDAIILGSDPKDDSEPKL--------NTARSFT
TVNKLDMIP---TLMSTTKSTTTAPSDAGLPSSIRPNQNPASIKLVQNPLPLSTRKQFAQ
AGNPSRYP--------FSPDLLQEDGMLTIN-T--RSPRGPRRYWNNTA--------SST
DQPQIHKNNTQQQSQ--QLDDNINDLFKWQNSG-
>SAKL0D01342g
---------------------MSKRERET----------FAPRIIRTLGSQSLSG-----
-------LNPF-------------------SS-----------SNPSSLSQSP-------
------------------ATSSTVPHVAANNTTMSPTPLNSNNMGTGTSVTS-GADTPA-
--------------------SASNY--RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC
KISDKLSRRAFPRGYTETLEERVRELEAENRRLVALCDLKEEQLHLVSKYSNKRTS----
---------------------------------------------------EISENEDEQ
ILQQLSAANGG-SLRVSSTNLYLLNKTTPGDQ----------------------------
---------QDEEDQMSSKT------------------TVDCNGVGCNHS--HQPNIHDK
-----PVS-----------------TNL--NDPTSISFEQNEAPGLPAVKALTSMANHEH
SVQLATLVALSVPRSTEEILLIPQLLARIGQVHGLTSKQSLYTASLLASLKESIP-----
-----------------LTLPTNVDMLKSTNLWEVDDVIQFFQTVFKFDIQA--------
-------ESSTTSQ----------------------------------------------
----------------------------------DHLIATEIDGLVSDFFSQWYNFIPIL
DKDEFYNYYNKFKTDL-MDPNFF-D---DEKNLFNKRNKSISYKIFGCILLIICQMGLIS
KVK-AENL------PATNKYSQLMAYYDIVVRQLMMNPYF-NLKSTSIQSLQFTSLQLFY
FLNIGEVSSVYDLRGKVVSMSQQLRLHRCPSAVLG-GNGSAVSKAQQGERRILFWGIYYL
DVFSALQLGVPRLLKDHEIECALPVADNDDQ------------KVNLAGQMIALEGRVSM
LSLSVIRFAKVLGNILDSIFKRG-MSASLTKQISLVHENALDNWRRGLPQQLKFELDVNG
TINMDEFNHLKQLDTSGN----MYSKENKS------LMVLYFMAKCMIHLPVVAKRPLVN
D-PEQSP---------------ESSTP----SNNCGDRSSSSYVLLQQATNTLLNVFTSL
RNV----YPPIPINVSRTKTRFSLLSARGSLEYTKGGALFQDNKALLLDLVKELEVDKKL
ELPGTLSWHSLKLLDMSISLILQPANTKPEKLEKMLQRKLNYYNKLTNRRSN-------L
GGGRSASSPGGNSKRKLD----------ENQGSAEPPKLTPASSKGDTPP---DKKIKLE
D--------TGFVPVRAVSQHSQS---DS-----------------------EKFENFQP
PVAPQNSIAEAFHLD-PVLNNNP----FSNTDLNAFFNT---------------------
--------------------------NNGNVPAALRSGGSL-------------------
--------------FNIAATAAASGNNANSTAP-------SNTLNEGLFKVPSNGD----
----FLKDYYNVP-GASSSQLNLLFLNNN-----------------------ASNGKPQL
NGSSAHSGTQAQNNDN-------------------------------NGFGFAVDASWGL
APLLE--WSP--AGKPVDPGTCNA--NENSIILDTSAANMESEMATGGRLH--SNTRSYT
DAKNLDIVP---TLPSSKQQQQQQH---RLQKGASQQPRSASIPTRKQSL----------
---CESNP--------TTATGSRDDGVLTMG-T--RNHRGPRRRWNSTTGQNTRTQLATM
NTPQSERSKSQNIGEPGSTEDSLHDLFRWQNSGL
>KLTH0C03762g
---------------------MGERENES----------FGPRFIRTLGSQSISVINP--
------------------------------LS-----------SQPSSISQSP-------
-----------------------------------AQPKANTNTQTTATASISPTASVT-
--------------------PSSNY--RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC
KVSDKLSRRAFPRGYTETLEERVRELEAENRRLVALCDLKDEQMHLVYKYSSNKRP----
---------------------------------------------------EPSSTEEEQ
MLEQLSSSNGG-SLRVSSTNLYLLNKTSPAGHEVPE------------------------
--------------------------------------NHKCQGIDCNHT--SHPHLHEK
-----PVS-----------------TTL--SDPTTISFEQHEAPGLPAVKALSSMANHEY
STQLACLVALSVPRSTEEILFIPQLLARLGQVHGLTSKQCLYTASLLASLKEPSQAV---
-----------------VPTTDGLTELKCTSLWEIDDPMRFFKDSCKFNLGS--------
-------DNDV-------------------------------------------------
----------------------------------ELLSISEIEDLISIYFEECHALIPVL
NENEFYKYYNKFKESLTVDPNFF-G---KANSSFAHRSKSISYKIFACILLVVCQLGIMS
KVK-REQL------PAKSKFSRIMAYYNNAILALKLNPYF-SVKTTSVKTLQLMSLLLFY
FLNVGEVSSVYELRGTIVSMAQQLRLHRCPSAVLG-TEGSTMSKSEQGDRRLLFWGIYYL
DVFSALQLGVPRLLKDHEIECALPISENGHP------------GVSLADQVIRLEGQVSE
FSLSLLRFSKILGNILDSIFKRG-MTSSIAQQVALIHENALDSWRRGLPKNLTFELDVNG
TINMEELNSGSHWKKDYS--TA-PSCDNRT------LMVLYFLVKCLVHLPVLAAKPLLG
G-ASEVD---------------TDATLAFDDASSGADRSSSSYVLLQQATNTFLSVQSSL
KSR----HLPLALNLPRIKARFALLSARGILEYTKGGALFQGNKALLLDVVKELETTKRL
EIPGSLSWHSLILLDMAVSLIMQPPHTKAGKLDKLLEAKLSYYNKLMGRSANVAST----
------------------KRKKEE----DNTSLSNATKLTPLSSDSSSPS---EKRVKLE
HTDK-----VGETPVGVENTGQPN---GN-----------------TQEHYAATWSNQNQ
P---HSTVAEAFHLD-PVLNNNP----FSNGDLTAFFST---------------------
--------------------DNGMPNLSGGASMLNMVGVDQ-------------------
--------------AHSTAGNDAQNTVNANSQQ-------STLFNDGLFRVPSNGD----
----FLKDYYRVP-GASSSQLNLMLMGSG-------------------------------
---------SSGSNQRQAKQQQTNTTD--------------------PGFGFTVDASLGL
APLLA--WSP----------EAAQ--EPIAETSDHDTRNDSGLRR--------KSGAETA
GVLVAGHSQ---LADSSTDPASQQQ---------RRVGSYDHTYAQDQSV----------
-----------------------EDSAITMP-T--RPHRGPRRRWNSTTG-------AAA
ITPNSDRPRNAPAS---ETDENLQDLFRWQNSGF
>Kwal_27.10232
---------------------MGERENES----------FGPRFIRTLGSQSLSGTNP--
------------------------------LS-----------SQPSSISQSP-------
-----------------------------------AQPRTNNSAAPNAARSISPVTSAT-
--------------------PTSNY--RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC
KVSDKLSRRAFPRGYTETLEERVRELEAENRRLVALCDLKDEQMHLVS--KYSSNKRH--
---------------------------------------------------EPSSTEEGR
MLEQLSNSDGG-SLRVSSTNLYLLNKTTPAVQDGSE------------------------
--------------------------------------LHKCQGLGCNHA--SHPHLHEK
-----PVS-----------------TSL--SDPAAISFEQNEAPGLPAVKALNTMANHEY
SAQLAYLVALSVPRSTDEILFIPQLLARLGQVHGLTSKQCLYSASLLAALKESSQTS---
-----------------FQGSPDYKDLKDKSLWEIDDCMTFFKTGCKFNLTS--------
-------SKDA-------------------------------------------------
----------------------------------ECLTISEIEELISIYFGECHALIPVL
NEAEFYKYYNKFKSNLTTDPEFF-K---TSTPSFAQRSKSISYKIFACILLVICQFGLMA
KVK-REQL------PTKNKFSLLMSYYSNALLALKTNPYF-SVKNTSIQTLQLLSLLLFY
YLNVGEVSSVYEIRGTVVSMAQQLRLHRCPSAVLG-TEGSTMSKSEQGDRRLLFWGIYYL
DVFGALQLGVPRLLKDHEIECALPISEHAHA------------GVSLADQVIKLEGQVSE
LSLSLLRFSKILGNILDSIFKRG-MTSSAAQQVALIHENALDNWRRGLPKNLTFELDVNG
TIKIEELTGSAQNNQDFT--KN-ASSDKKI------LMLLYFLVKCLVHLPVLAAKPLLG
G-SSEPD---------------KDATPAFDDASSGADRSSSSYVLLQQATNTFLSVQSCF
KTR----HLPLAIDLPRIKARFALLSARGILEYTKGGALFQDNKALLLEVVKELEASKKL
ELPGSLSWHSLILLDMATLLIMQPPQTKTDKLDKLLETRLNYYNKLMGRSTL-------T
SNGKRKNE--------------------ENDATSKVSKLTPLSSEYNTPS---DKRIKVE
SIGS-----SGNVPSNSESVHHFD---DI-----------------QNDKFSTNWPSNNP
QP---NAIAEAFHLD-PVLNGNP----FSNGDLTAFFNS---------------------
--------------------DNGIPQIGGGSSVLNLAGIGA-------------------
--------------ANSNELNNNNNEAAGGGPR-----KVATTVNDGLFRVPSNGD----
----FLKDYYRIP-GASSSQLNLMFMGPG-------------------------------
---------NTGANQNAPNNQKNNFTV--------------------PGFGFTVDASLGL
APLLA--WSP----------EAPQ--PSMPEIAQNADRRDSDPLS--------RTRLPSA
TIPASDPTH---VISQDSNNVHLRE--------QYRSNSFNQLYAQDQSL----------
-----------------------DDTAITIP-T--RSHRGPRRRWNSSNG-------TTV
ITPNSDRPRNPPSSE--SENENYKDLFRWQNSGF
>KNAG0J00250
MRFLCLLFTGVFGLPVFSVQRRTKLMYAGESESWHFLAILYVGWNRSFSPGPLDGTSRSG
WCEGCLTLTHSCIRLYFTYLVVAGDNKIVMSK-----------KSGAAVNTPAASITTSD
AAGGTENTVREEVTGLLPNEGKKSLKELKDTLSPISRPSSSTTANGDGAE---PLLSSR-
--------------------PDAAG--RASQACDRCRLKKIKCDLKRPQCSSCASVGFEC
KLSDKLTRNSFPRGYTESLEERIRELESENRRLLAMNDLKEQQLFKIP------------
-----------------------------------------------------------E
DIQSVVDVDAELNSSNQTKNMYA-------------------------------------
--------------------------------------THVCDGICCQDT-----KLHSR
-----PVA-----------------TNFNLNDPTSVSFEQNEAPGLMAARAIDQISNHEQ
STQLAILVSLSIPRSTEEILFIPQLLAKIRQVFGFTSKQCLYTVSLLSSLKDDLPPPNLL
KNSKMI-----------LQNSSNFDILTSVNLWHLENLSNFFQNVLKLNILP--------
-------DDDDHLKKND-------------------------------------------
----------------------------------DHLALSEIDELVALYFKYWSDSIPIF
NEKEFNSNYRVFKADL---MKLS-K---NGPSSLEN---ILNIKIFGCLLTVICQMGILI
KYK-NFK-------NKSPKFEKLLSYYHHLMYVLPKNSYF-GVITTSIKTVQILSLILFY
HLNTGDIIQIYDLRGMIISMAQQLRLHRCPSAVLT-GSGSKMDRLEQGNRRTLFWCIYYL
DVFCSLQLGVPRLIKDHEIECALPLSSEIHN------------TDKMDG--VQLEGTMSE
FSLSVVRCAKVLGNILDSIFKRN-MSESITEQVYTIHENALDSWRTKLPKKYQFKLNANG
MVDLEHL-----------------NHENLI------LVLLFFLVKSMIYMPLSSAITELA
N-NPKVK-------------------------NDYYMNHKVSHTSLQQSINALLSVFKNI
NNQ----YLPLPLNSSRTMTRFALVSAKGSLEYKKGGLLFEDNKVLLLSVIQEIEKDRKL
ELPGIIPWHSLKLLDLAVNLFLLGPTINSDKLEKFLQKKINYYNKIMGKPLI--------
----------------------------TSLPSSKTKRKQSKEDLFTANK-KRKQQVKTE
LSTL-----EVKREPQQVQLLKRE-------------------------------GQGNT
TESTQSAFVEALQLD-PILNANI--YNFSGTDLSNFFIS---------------NQ----
-------NGDVPRESREPAVQQPIPDRTSLPATNTSVVTGF-------------------
--------------DSLPKPENSKPAKDAIGPS--------LKKGYPSFIGTKSHNNSVS
TMMMFLNNDY----PFSSMNLNALYAPDG-------------------------------
---YKESSAQPGKQFTLNTGEPHST----------------------YDFGMIVDASLGL
APLLN--EAPEI-----------------------------------------PGQPEFF
NSDEMSPSQ---LTGKLMPMAVNKP--------MDQNSNFTYNYKSSVEN----------
-----------------------NEGLTLEAIR--GGETSTQRVSNGH------------
--IRVNRQ---------RQSDAVDDLFSWQNST-
>KAFR0B03950
------------------------------------------------------------
-----------------------------------------------MVKKEP-------
---------------------------------GSSDPRKQD-----------SDVNHP-
--------------------SSSNY--RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFEC
KVSDKLIRKAYPRGYTESIEERVRELEAENRRLLALCDLKEQQISLVA--KYSSNKSNIL
PTDRCIIEL----------------------------------NSDSDCTNNIKGELNKD
RQNDVTTIPNSLPLNISQTNLYLLNQTQKKAELNNGNKMFQQNQSNVSTSSSSSPFFANK
LNSNGTIRSPESNTTVSPLESHTKNLKSNIRNNNTTTTTHVCDGICCTDK------LHPQ
-----PVA-----------------TNY--NDPTSISFEQSEAPGLVAAKALKSINNQEE
ATQLAILVSLSVPRSTEEILFIPQLLAKIRQVHGFTSKQCLYTVSLLSSLKNSLPSPKSD
FL---------------MDNSQNSLLLKNTNIWQINDLNVFFTDLLKFNISN--------
-------DSKTS------------------------------------------------
----------------------------------TLLSFDDIDDLTNLYFNHWSNLIPVL
NEEEFFNRYNNFKIQC------------QSFIQGNQSNNLRDYKFFGCFLMVMCQMGLLI
KLK-EHKS--------NNSLFKILTYYHQLTYILPKNPVY-DFATTSIKSVQLLALLLFY
HLNMGNIEQIYELRGNIISMAHQLRLHRCPSAVLT-GSGSTMQKLEQSNRRLLFWTIYYL
DVFSSLQLGVPRLLKDYEIECALPVDNTTT-------------MDAIDGTSIKLEGTVSQ
ISLTLFRFAKVLGNIVDSIFKRN-MSTSISRQVALIHENALDNWRSRLPEQFQFKLDVNG
TINLNDLDTE--------------NSDTIF------LIVFYFLAKCMIHLPVCSTKVDLE
D-KVTET---------------GNDVI-------YNDRFSTSYVSLQQSTNTMLNALRMI
RDK----YLPMPFNVSRTLTRFTLISAKGSLDYIKGGSLFIDNKKLLLDCVQDIEANRKL
DLPGIISWHSLKLLDLTLNLFLQNSNTKPEKIEKLLQKKLNYYNKLMGKPLV--------
-----------------------------KNLPIQKRTNQNKGNNNDEPS-RKKVKKELE
NDIN-----SLHPILIDNEGVTPS---DA-----------------APLINKTNSNTNNP
VVTTQNEFAEALQVD-PILNSDY--YQFSNLDLATLFNS---------------DK----
LNKINSHHGSSINLIDQKPFNDSLIPKFSQVNTASNSTLNM-------------------
--------------EQLLRNQGKFNISPNIFSP------NFQSKENLLGNSKVNNN----
----LLYSNLKNNSNNQSLTTMMMLLNNE----------IPFSSINSNTGESGVNKQNAN
ATENDNVETINFKQDLTNKNESGNMLS-TENYL--------------SDFSYIIDGSLGL
APLLANPFKP-------------------------------------------TGENNLV
NVSSIETTG---QCINPKVLSSQSS----------DANKDDTDLNLEN------------
--------------------------------G--AVQR-RPRRYNGNFGLGGTGMNSNF
SVSDLLRPDDQKK----REKETLNDLFNWQNSD-