MUSCLE (3.8) multiple sequence alignment

ABL126W            ---------MKENTDAVPSSLKDSLMEWLTFDKNSETQHEICELVSNHQWDELRKRLLPR
Ecym_4611          ----MPKTQVRDMNELIPDDLRDKIDKWFKYDKNPQTTAEIRSLVDSQNWNELRGRLCQR
KAFR0B03920        --MSSQSNILSLIDEYVPERLKVSCDRWLRYDQNEETRSEILTIIGRKDWKELGNRLEGR
TBLA0B03250        ---MSDEQQFNALIKDYPEDLQKKVLLWLEQDKDDSTRKEIIDLCKSANVKELHERFDSR
CAGL0M02981g       -----------MSTTDIPVELRTAIESWLQLDKNEETRNEVIKLCNDQNWDELHKRFDSR
Kpol_1068.8        --MVSSNSEFDSVLETLPVDLRDKVGTWLAQDKNPETINEVIRLCKANSLNELHKRFDNR
KNAG0J00270        -----MDKGTLHILQNAPEGLQHRILEWLRLDKNEETRREVLDLCQRQDWSELNSRFSQR
TPHA0I00250        --MTLSDQEIENLLSSIPEDLKEKIRVWFRYDDNQETVDEVKELCVNKSLDELHKRFDQR
NDAI0K00410        -----MSSIPSIICDDCPANLRENIDLWLRQDKCEETRNEVIQLCKDSNWIELHKRFDSR
NCAS0C00410        ------MDATQSSLSNCPENLREPINLWLRLDQNEETRKEVLQLCENKNWPELHQRFDTR
KLLA0D01573g       -------MSETEVIESLPSDLQGKVRNWLKYDKVEETRNEILQLCLKGDITELHKRLDTM
SAKL0D01474g       ---------MSDSYTTVPDDLKESVNLWLTYDKNPETRSELLNLVEGKHWEELHGRLDER
KLTH0C03872g       --------MMSLTNAEVPEDLKLGVEAWLKYDKNEQTRDQIIKLVEDKSWTELRNRLNFR
Kwal_27.10258      ---------MESIKVEIPADLKSSVESWFEHDKNEETRNEILQLVTEQNWNELHKRLDQR
TDEL0B00570        MTGRIIQSDEKEVINSVPTDLSQLVASWLSQDGNKQTRLEILNLCKAKDWLELHKRLDTR
ZYRO0G14190g       ------------MSSNIPENLKQPISLWLAQDRNEKTCKEIAELCDAENWSELHERLNSR
Skud_13.450        --------MSQQFLGTIPSDLKGPISLWFDQDRDPETIEEVTALCKKSDWDELHKRFDTR
Suva_13.466        --------MYQQLLETVPSDLKGPISLWFDQDRNPETIEEVTTLCKNSDWDELHKRFDTR
Smik_13.491        --------MSLQFLEAVPSNLKEAISLWFEQDQNPETIEEVTALCKKSDWNELHRRFDSR
YMR278W            --------MLQGILETVPSDLKDPISLWFKQDRNPKTIEEVTALCKKSDWNELHKRFDSR
                                    *  *      *:  *   .*  ::  :       **  *:   

ABL126W            ITFGTAGLRARMEAGFSRMNTLTVIQASQGLARYIKSQFPD---DLKVVIGHDHRFHSRE
Ecym_4611          ISFGTAGLRARMEAGFARMNTLTVIQASQGLATYIKSQFPN---NLKVVVGHDHRYNSKS
KAFR0B03920        IPFGTAGLRGRMEAGFTRMNSLVILQTSQGLAQYIMEKFPQ---NLSVVVGHDHRYHSKE
TBLA0B03250        ITFGTAGLRSTMEAGFSRMNTLTVLQASQGLATYMKNDAKNTGQKLIAVIGHDHRYHSKE
CAGL0M02981g       IVFGTAGLRARMEAGTNRLNKLVILQASQGLATYIKDKFPQ---NLTAVVGHDHRYHSQE
Kpol_1068.8        ILFGTAGLRSKMEAGFSRMNTLVVLQATQGLATYIKQQFPS---NLKAVIGHDHRYHSKE
KNAG0J00270        ILFGTAGLRSRMEAGTNRLNSLVILQATQGLARYIASQFPK---NKVAVVGHDHRFHSKE
TPHA0I00250        IVFGTAGLRSRMEAGFNRMNALTVLQSTQGLASYIKSQFPS---NLTAVVGHDHRYHSKE
NDAI0K00410        IVFGTAGLRSRMEAGFSRMNPLVILQASQGLAKYIKAQFPT---NLTAVVGHDHRFHSKQ
NCAS0C00410        IVFGTAGLRSRMEAGFSRMNSLIILQSTQGLANYIKEQFPN---NLTAVVGHDHRFHSKE
KLLA0D01573g       IAFGTAGLRGRMEAGFNRMNALTVKQASQGLAKYIKKQFPE---NLTVVVGHDHRHNSRL
SAKL0D01474g       ISFGTAGLRSRMEAGFSRMNTLTVLQASQGLASYIKSQFPE---NLSVIVGHDHRYHSNE
KLTH0C03872g       ITFGTAGLRSRMEAGFNRMNTLTVLQASQGLAKYIASNFPD---NLSVVVGHDHRFNSKD
Kwal_27.10258      ISFGTAGLRSKMEAGFSRMNTLTVLQASQGLAKYIAEKFPE---NKTVAVGHDHRFNSRD
TDEL0B00570        ILFGTAGLRSRMEAGFSRMNTLVVLQATQGLAQHIKKQFPD---ALTAVVGHDHRFNSQE
ZYRO0G14190g       LQFGTAGLRARMEAGFSRMNTLVVIQATQGLAQYIKKQFPD---HLVAVVGHDHRFNSMD
Skud_13.450        IQFGTAGLRSQMQAGFSRMNNLVIIQASQGLATYIRQQFPN---NLVAVVGHDHRFHSKK
Suva_13.466        IQFGTAGLRSEMQAGFSRMNTLVIIQATQGLATYIKQQFPD---NLVVVVGHDHRFHSKE
Smik_13.491        IQFGTAGLRSQMQAGFNRMNTLVIIQASQGLATYAKQQFPN---NLVAVVGHDHRFHSKE
YMR278W            IQFGTAGLRSQMQAGFSRMNTLVVIQASQGLATYVRQQFPD---NLVAVVGHDHRFHSKE
                   : *******. *:**  *:* * : *::**** :   .         . :*****.:*  

ABL126W            FAEATIAAFLQLDYDIYYLNYVPPGSD-EDVFVHTPMVPFAINNVEGGPTSCGVMITASH
Ecym_4611          FAEVAIAAFLQLGFEVYYLNYVPSNKD-VESYVHTPMVPFTVSNIEGG-ASCGIMITASH
KAFR0B03920        FADITVATFLNAGFKVFYLN------T-ENEFVHTPLVPYSVDKLR---SACGVMITASH
TBLA0B03250        FAKIAATVFLIAGFKVYYLNDDSLEDPRDNKFVHTPMVPFTVKNLK---ASVGVMVTASH
CAGL0M02981g       FAQVTAATFIRAGFKVYYLN------P-HDEFVHTPMVPYSVDHLN---ASVGVMITASH
Kpol_1068.8        FAEIATSVFLSAGFTVYNLN------P-PGTFVHTPLVPFTVDQIG---ASVGVMITASH
KNAG0J00270        FATVTAAVFLRAGFKVLYLN------P-GDTLVHTPLVPFTVDHLN---ASVGVMITASH
TPHA0I00250        FAQITAAVFLNAGFKVYYLN------P-NDEFVHTPMVPFGINLYS---ASIGVMITASH
NDAI0K00410        FAMITASVFLRVGFKVYYLN------P-EDSFVHTPLVPFSVNHLN---ASIGVMITASH
NCAS0C00410        FAIVTASIFLRAGFKVFYLT------P-DDQFVHTPLVPFSVLNLK---ASVGVMITASH
KLLA0D01573g       FGKVTVDTFLQLGFKVFHLNHE----N-EKSLVHTPLVPFTVNATG---ASVGIMITASH
SAKL0D01474g       FARVTVTAFLQLGFKVYYLNLSSKD-S-TETFVHTPMVPFTINQLN---ASAGIMITASH
KLTH0C03872g       FAEVTIVAFLQLGFKVYDLGFTEDA-S-QDVVVHTPMVPFGIDHLR---ASGGIMITASH
Kwal_27.10258      FAEVTSVAFLQLRFKVYSLGFNAD--PKKDAFVHTPMVPFAIDRLG---ASAGVMITASH
TDEL0B00570        FALATVATFLQAGFKVIFLN------D-GDKFVHTPIVPFTVNEVG---ASVGVMITASH
ZYRO0G14190g       FAKATATVLLKAGFEVHYLN------Q-GDSYVHTPMVPFTVDRVK---ASVGVMITASH
Skud_13.450        FARATATAFLLKGFKVHYLN------P-GQEFVHTPLVPFAVDELN---ASVGVMITASH
Suva_13.466        FARATATAFLLKGFKVHYLN------P-DHEFVHTPLVPFAVDKLK---ASVGVMITASH
Smik_13.491        FARATATAFLLKGFKVHYLN------P-DHEFVHTPLVPFAVDKLK---ASVGVMVTASH
YMR278W            FARATAAAFLLKGFKVHYLN------P-DHEFVHTPLVPFAVDKLK---ASVGVMITASH
                   *.  :   ::   : :  *             ****:**: :       :: *:*:****

ABL126W            NPKMDNGYKVYYANGCQIIPPHDELIGRHIDANLEPWTRAWDSKALIEEAIKSGKLHDVR
Ecym_4611          NPKMDNGYKVYYSNGCQITPPHDKKIASEIDANLVPWDQAWDAQKLIEDARNNNRLHDVK
KAFR0B03920        NPKDDNGYKVYYSNGCQIIPPHDKNIALTIEKNLTPWSKDWNWKDLFSTEERNGNLEFNG
TBLA0B03250        NPKMDNGYKVYYSNGCQIIPPHDSGISQCIDANLEPWENSWNYKEIMANAESKGDLIYHR
CAGL0M02981g       NPKMDNGYKVYYTNGCQIIPPHDHGIAETINNNLEPWSTDWNFTKILSNAETDGKIEYVR
Kpol_1068.8        NPKMDNGYKVYYSNGCQIIPPVDASIAKCIDENLEPWSNSWDSSKAIEAGLSNKKLIYLR
KNAG0J00270        NPKMDNGYKVYFANGCQIIPPHDLNIARSIDQNLEPWEPSWDWPTVIQAAEKEDRIVYVK
TPHA0I00250        NPEMDNGYKVYYNNGCQIIPPHDKNIAECIEKNLEPLSDNWNTEAVISKAIENVKLIYSK
NDAI0K00410        NPKMDNGYKVYYSNGCQIIPPHDKNIAATIDENLEPWSSDWNWDSTFEKNLKEKKLVYVR
NCAS0C00410        NPKMDNGYKVYYDNACQIIPPHDKNIAEMIQKNLEPWSTSWDWDATFKKGLETNKLVFIK
KLLA0D01573g       NPKMDNGYKVYYTNGCQIIPPHDKLIAESIIHNLEPFSSP-----------QTGTIIDCK
SAKL0D01474g       NPKMDNGYKVYYSNGCQIIPPHDRLISETIDQNLVPWNKAWDCDEVIKTAIESGFLFDVK
KLTH0C03872g       NPKMDNGYKVYYSNGCQIIPPHDQRISQSILANLEPWDRAWDCAAVKAEAVQSEMLIDAK
Kwal_27.10258      NPKMDNGYKVYYSNGCQIIPPHDRLIAQSILDNLNPWERAWDCKAVIAEATEKGYFVDMK
TDEL0B00570        NPKMDNGYKVYYSNGCQIIPPHDSEIAQSIEENLTLWPKAWKWDELLKEGLDTKCLVYAG
ZYRO0G14190g       NPKLDNGYKVYYANGCQIIPPHDSAIARSIESNLEPGNGVWDWDQTMQQAADEGKLIYGR
Skud_13.450        NPKMDNGYKVYYSNGCQIIPPHDQAISNAIDMNLEPWANAWNFDDILSKNLKQGKLMYSR
Suva_13.466        NPKMDNGYKVYYSNGCQIIPPHDHAISDSIDMNLEPWANVWKFSDVLNKALKQGKLMYSR
Smik_13.491        NPKMDNGYKVYYSNGCQIIPPHDHAISDSIDMNLEPWANVWNFDDVLNKGLKQGKLMYSR
YMR278W            NPKMDNGYKVYYSNGCQIIPPHDHAISDSIDANLEPWANVWDFDDVLNKALKQGKLMYSR
                   **: *******: *.*** ** *  *.  *  **                     :    

ABL126W            KEMLQKYKDSIQTMLVKQSNLKF------AGGPWFVYTPMHGVGYEFFKEAVASVLGIEE
Ecym_4611          QELIKNYVQRIQSSLVTTNSLAD------CGKNWFVYTPMHGVGYEIFNNIVTNTLHLKE
KAFR0B03920        NKMFLAYVQDITRYVFTNGSPMLK-----TGKPWFVYTPMHGVGHKIFGQIAKQVLGLSE
TBLA0B03250        DVMLNDYITQLEEKLTSKDIIHLSKKIDVKSKPWFVYTPMHGVGYEIFTKISNEILHMKE
CAGL0M02981g       KRMLTSYLNSVVNQLIQRDFAAP------DEKPWFVYTPMHGVGHQIFSTILNESLNLKD
Kpol_1068.8        NEMLLAYSDKVDNNIIDKKTIREFD---EHRKPWFVYTPMHGVGYEIFTSLVLEKVNLKE
KNAG0J00270        DQMTQLYTKTAELQLIGGRKVLRNP----GSGPWFVYTPMHGVGSEIFSRISEDVLGIKE
TPHA0I00250        EDVLQQYMLNLDKYIIPKNISLGTTI--KGKKPWFVYTPMHGVGYQIFHRISSTCLNLVE
NDAI0K00410        EEMTNKYLQAMKDILVSSSISRPNN---NGKKPWFVYTPMHGVGYNIFTKISKNILHYEE
NCAS0C00410        DLMTEKYLMQMKRVLIHSSHLSLKD----VKTPFFVYTPMHGVGAEIFAKVSSELLNLHE
KLLA0D01573g       EKMTKKYIDAIGSTLIDGAVNKK------TNEPWFVYTPMHGVGFEIFESISKQLLSLEE
SAKL0D01474g       EKVTSKYIKTVSDELVRVPMLD-------CDKPWFVYTPMHGVGFEIFEQIALLALGLKE
KLTH0C03872g       KVLVDQYVDTVRRSLVITNVNH-------TKAPWFVYTPLHGVGFEIFEKILSSAWRLGQ
Kwal_27.10258      KPMVDHYVKEISDKLVSSDIGD-------RSKPWFVYTPLHGVGFEIFERIASEVLGLVE
TDEL0B00570        EEMIERYTKKMGQSLVDRTTISAEK----EGKPWFVYTPIHGVGYDIFRQIAEETMNLIN
ZYRO0G14190g       DKMLEQYISCVKDSFVTELDSLP------KGKPWFVYTPMHGVGYQVFDQIASKILQLEV
Skud_13.450        EEMLKLYLEKISDNLVETTPLKLEV----RSKPWFVYTPMHGVGFDIFSTIVKKSMCLVE
Suva_13.466        EEMLNLYSKEVSKTLVETNPLKLEI----KAKPWFVYTPMHGVGFNIFSTIVKKTMSLVE
Smik_13.491        EEILKLYLGEVSKNLVGTDPLKFEV----KAKPWFVYTPMHGVGFDIFSTIVKKTMSLVE
YMR278W            EEMLKLYLEEVSKNLVEINPLKLEV----KAKPWFVYTPMHGVGFDIFSTIVKKTLCLVE
                   . :   *       .                  :*****:**** ..*            

ABL126W            DKDYIVVPEQKYPDPEFPTVSFPNPEERGALDMAMKVADANG-ITVVLANDPDADRFSVA
Ecym_4611          DEHYLVVGAQKFPDPEFTTVSFPNPEEEGALNLAIELAARSG-AELVLANDPDADRFSAA
KAFR0B03920        NVDYFSVPEQIKPDPSFPTVSFPNPEEKGALDMAIQLAEREG-LTLIIANDPDADRFSAA
TBLA0B03250        GEDFIVVEEQKHPDPGFPTVSFPNPEEKGAIDMGIKLAEDNG-ISLVIANDPDADRFSIA
CAGL0M02981g       NIDYITVPEQKDPDPSFRTVSFPNPEEKGALNLAITLAEANG-IKLVLANDPNADRFSVA
Kpol_1068.8        NRDYLTVKEQIVPDPAFPTISFPNPEEKGALDMAIALAKEND-ISLVIANDPDADRFSAA
KNAG0J00270        NEDYLCVPEQKHPDPSFPTVSFPNPEEKGALDKAIELASQNG-INLVIANDPDADRFSLA
TPHA0I00250        DIDYVCVKEQIVPDPSFPTVSFPNPEEKGALDLGIKYAKKHN-IDLVVANDPDADRFSVA
NDAI0K00410        NMDYFVVKEQMYPDPAFPTVSFPNPEEKGALSLATKLAEENN-ISLVIANDPDADRFSVA
NCAS0C00410        NVDYLVVSEQRLPDPSFPTVSFPNPEEKGALSLAIKLAQENG-LSLVIANDPDADRFSAA
KLLA0D01573g       GKDYLVVEEQKYPDADFPTVSFPNPEEKGALDLAVEYGRKNDTVDLIIANDPDADRFSVA
SAKL0D01474g       GKHYVCVPEQRCPDPAFPTVSFPNPEEKGALDLSIALAEEQD-IRLVIANDPDADRFSVA
KLTH0C03872g       GRDYLCVEEQKYPDPNFPTVSFPNPEEKGALDKAIELAEKHD-ITFVLGNDPDADRFSVA
Kwal_27.10258      GRDYWCVSEHKQPDPAFPTVSFPNPEEAGALDLAIALADKNG-ISFVLGNDPDADRFSAA
TDEL0B00570        GRDYLCVKEQQLPDPSFPTVPFPNPEEKGALDMAISVADKNG-ISLVLANDPDADRFSAA
ZYRO0G14190g       NRDFLVVSEQLNPDPEFPTVQFPNPEEKGALDLAIKLAENHG-IKLVIASDPDADRFSVA
Skud_13.450        GKDYLCVPEQQNPDPSFPTVGFPNPEEKGALNIGMRLAEKHD-ISLLIANDPDADRFSVA
Suva_13.466        GEDYLCVPEQQNPDPSFPTVGFPNPEEKGALDIGMRLAEEHD-INLLVANDPDADRFSIA
Smik_13.491        GKDYLCVPEQQEPDPSFPTVAFPNPEEKGALDLGINLAENHG-INLLIANDPDADRFSVA
YMR278W            GKDYLCVPEQQNPDPSFPTVGFPNPEEKGALDIGINLAEKHD-IDLLVANDPDADRFSVA
                   .  :  *  :  **. * *: ****** **:. .   .   .   .::..**:***** *

ABL126W            VK---YHGE---WNQLTGNQIGILFAQAEMQSYFKEPKL--DRKQLAMLTSAVSSQLLRK
Ecym_4611          VK---DGNK---WKQLTGNQLGYLFAVGQLEKFSNQNEN---KKPLAMLGSTVSSQMIAK
KAFR0B03920        VKDK-RSHE---WRQLSGNEIGSLFAIFKLQEHKEKAAS---RKPLAMLNSTVSSQMLKK
TBLA0B03250        VKSKGSQGT---WHQFTGNEIGYLFAYFEFQKYKISKQDL---HRLYMVNSTVSSQMIKK
CAGL0M02981g       VRDD-SKNE---WKQLTGNEIGLLFAFYEFKMYQKAADKGIKNKPLAMLNSTVSAQVIKR
Kpol_1068.8        IYNS-HSGE---WQQLTGNEIGFLFGYYLFNKYTNMDPEFKKNHPLAMLNSTVSSRMLKS
KNAG0J00270        VFDS-KTAN---WRQLTGNEIGFLFAYQQFEMYKAMDDIFQKEHPLVLLNSTVSSQMIKK
TPHA0I00250        VRNP-LTDE---FQQLTGNEIGFLFAYFLWEQYSMLPADFKDKFPLAMINSTVSSQMIKK
NDAI0K00410        SKNE-KTGQ---WQQLSGNEIGFLFASFELEKYMSQDIEWRRTHPLAMINSTVSSQMIKK
NCAS0C00410        VLNK-KTGK---WRQLTGNEIGFLLGYYEFQLYEQQDVAFRKTHPLAMINSTVSSQMIKR
KLLA0D01573g       VRDN-DQNTTTAWRQLTGNEIGFLFAYYEWERYKHSPID----EPLAMLNSTVSSQMIKR
SAKL0D01474g       VK---NGDR---WSQLTGNEIGFLFAYYQWQDYQKLGESFKKQHPLAMINSTVSSQMIKS
KLTH0C03872g       AK---HNGQ---WRQLTGNEIGFLFAQYKWETYRLESDKFKGTNPLAMINSTVSSQMIKK
Kwal_27.10258      VK---HQGK---WRQLTGNEIGFLFAQFVWEKYQKESSEFKLENPLALINSTVSSQMIKK
TDEL0B00570        VKDN-KTGT---WRQLTGNEIGALFAFYEFQKYQKKNEEYKEKHPLAMLNSTVSSQLIMK
ZYRO0G14190g       FKGP-HG-----WQQLSGNDIGFLFAYYELQKYRGFDAEYQKSHPLAMLNSTVSSQMINS
Skud_13.450        IKDM-QSGM---WQQLTGNEIGFLFAFFEFEKFKSMDEQFQQTHPLAMLSSTVSSQMIKR
Suva_13.466        VKDT-QSSK---WRQLTGNEIGFLFAFFEFQRYKNKDEEFQRSHPLAMLSSTVSSQMIKK
Smik_13.491        IKDI-RSGE---WRQLTGNEIGFLFAIFEFQKFKSMEKQFQHAHPLAMLSSTVSSQMIKK
YMR278W            VKDM-QSGE---WRQLTGNEIGFLFAFYEYQKYKSMDKEFQHVHPLAMLNSTVSSQMIKK
                               : *::**::* *:.    : .            * :: *:**:.::  

ABL126W            MAEEEGFLAVETLTGFKWLGNRARELELEGYYVPFAYEEAIGYMFSQVVHDKDGIAAAAV
Ecym_4611          MADVEGFTFVETLTGFKWLANRAIDLENDGFYVPFAYEEAIGYMFSSVTHDKDGVSAATE
KAFR0B03920        MAQVEGFHYEETLTGFKWIGNRALQLEQQGYDVCFGYEEAIGYMFPCMEHDKDGIIASVV
TBLA0B03250        MAEIEGFNYEETLTGFKWIGNRAIDLINKGNIVPFGYEEAIGYMFPTMEIDKDGIAATVI
CAGL0M02981g       MAEKEGFLYKDTLTGFKWIGNEAAKLEEKGYFVPFGYEEAIGYMFPAMEHDKDGVSAAIV
Kpol_1068.8        MADTENFKFIDTLTGFKWIGNKAIDLKKEGYHVVFGYEEAIGYMFPAMEHDKDGITASVV
KNAG0J00270        MAEVEGFHYEDTLTGFKWIGNRARDLEKKGFFAPFGYEEAIGYMFTQMEHDKDGISASLM
TPHA0I00250        MAEVEGFYYEDTLTGFKWIGNKARELEKEGYYVPFGFEEAIGYMFPKMECDKDGITATVV
NDAI0K00410        MAQVESFHYEDTLTGFKWIGNRALDLQGQGYYVPFGFEEAIGYMFPTMVTDKDGVSAAVV
NCAS0C00410        MADMNGFHYEDTLTGFKWIGNKAIDLRQEGYYVPFGFEEAIGYMFPDMECDKDGISAATV
KLLA0D01573g       MAEIEGFHYEDTLTGFKWLGNRALELEQEGYYTPFAYEEAIGYMFSSVVHDKDGISAAIV
SAKL0D01474g       LAEAEKFHYEDTLTGFKWLGNRAFELETQGYYVPFAYEEAIGYMFPEVEHDKDGISAAVV
KLTH0C03872g       MAEVEGFHYEDTLTGFKWLGNRARELENAGYFVPFAYEEAIGYMFSDVVHDKDGISAAVV
Kwal_27.10258      LAGVEKFHYEDTLTGFKWLGNRARQLESSGYYVPFAYEEAIGFMFSDIVHDKDGVSAAVV
TDEL0B00570        MAEIEQFHYIDTLTGFKWIGNRTLDLEAMNYYVPFGFEEAIGYMFPVMEHDKDGISAASV
ZYRO0G14190g       MAALEGFHHEDTLTGFKWIGNRALELEARGYYVPFGFEEAIGYMFPATEHDKDGISAAVV
Skud_13.450        MAEVEGFHYEDTLTGFKWIGNRAIILEKEGYYVPFGFEEAIGYMFPAMEHDKDGISASVV
Suva_13.466        MAEVEGFLYEDTLTGFKWIGNRAIILEKEGYYVPFGFEEAIGYMFPAMEHDKDGISAAVV
Smik_13.491        MAEVEGFHYEETLTGFKWIGNRAILLEKEGYYVPFGFEEAIGYMFPAMEHDKDGLSASIV
YMR278W            MAEIEGFHYEDTLTGFKWIGNRAILLEKKGYYVPFGFEEAIGYMFPAMEHDKDGISASIV
                   :*  : *   :*******:.* :  *   .  . *.:*****:**.    ****: *:  

ABL126W            FLQMCYEW-KKVAKSSQEVLQECYEKYGYFVDYNGYYISSAPAVTKEVFDYFRNEY----
Ecym_4611          FLQMAARW-KKEGKTPLDVLNAGYEKYGNFVEYNGYYSVQDLSIIGDVFKYIRNAC----
KAFR0B03920        FLHMYSKWLELEGLGPLDVLDLCFEKYGVFSEYNGYYTVEEPALIESVFSYIRDEY----
TBLA0B03250        FIQAFMYWNQIDKMDPYEIIQLGFKKYGVFIEYNGYYRYTDLGITKKIFDYVRYDYDKGV
CAGL0M02981g       FLQAYANW-LQSSSNPIDIIHECYDKYGVSAEYNGYYIVSDPSKTDKVFESIRSSY----
Kpol_1068.8        FLQAYFEWDNLSKVTVIDILEQGIEKYGAFKEYNGYYVVSNPQVTNDIFHYIRNEY----
KNAG0J00270        FLLSYYHWVYDAHKFPLDILEDGYKKYGVFKEYNGYYIVDNPKIMKETFDYIRNDR----
TPHA0I00250        FLQAYYGWCMNNKQSLFDIIETGFKKYGVFKEYNGYYIVNDLSLTKIIFDNIREN-----
NDAI0K00410        FLLAYSYWLNNDGSYPFDILEKGFKKFGFFKEYNGYYIYDDPKTTKQIFDFVRYQY----
NCAS0C00410        FLQAYCHWMNQYQMSPFDIMEEGFGKFGVFKEYNGYYILKDLSITKTVFDFIRHEY----
KLLA0D01573g       FLQAYSKW-RASGQTVLDILATASLKYGHFKEFNGYYIVPDLAITKQVFDAIRSIE----
SAKL0D01474g       FLQMYCEWLSKDRMTPLQVLDEGFGKYGVFKEYNGYYIVPRLSLTKEVFDYIREDY----
KLTH0C03872g       FLQMLWSW-KAQALTPFDVLQRAYQKYGVFKEYNGYYIVPDLSLTDKVFSGIRSGF----
Kwal_27.10258      FLQMLWSW-KKQALSPIDVLQSAFGKYGVFKEYNGYYTVPDLSLTDRIFSDIRSSY----
TDEL0B00570        FLQMYRKWLVGSKKTLLTVLEDIFEKYGVFKEYNGYYSVNDPKVIKEVFDFIRNDY----
ZYRO0G14190g       FLQAYHSW-ISQGKSPLDILDEASAKYGVFREYNGYYLVDEPSLTNKTFAYIREDY----
Skud_13.450        FLQAYCKWKLANNLDPINVLENGFKKYGVFKEYNGYYIVPNPIVTKEIFKYIRDVY----
Suva_13.466        LLQAYCKWKIDSNLDPIDILENGFQKYGVFKEYNGYYVVPSPLVTTEIFEYIRNVY----
Smik_13.491        FLQAYCQWKIDHNLDPISILEDGFKKYGVFKEYNGYYIVSSPIVTNEIFDYIRNAY----
YMR278W            FLQAYCKWKIDHNLDPLNVLENGFKKYGVFKEYNGYYVVPNPTVTKDIFDYIRNVY----
                   ::     *          ::     *:*   ::****           *  .*       

ABL126W            TPAGKPYPSHIGCEFEVEYLRDLTVGYQSDTATNIPDLPVDHNSQMITCVLKP---VKME
Ecym_4611          NGNDVPYPSTIGNEFAVASFRDLTVGYQSDTGNHIPNLPVSPGSHMITCVLKPLIKETAQ
KAFR0B03920        CPKARPYPEKLGREFFLTSFRDLTLGYQSDTIDFKPTLPVDASSQMITATLKP----ERT
TBLA0B03250        SEGNKKYPDHIGEEFKIIKYRDLTTGYQSDTPDNKPLLPVDPSSQMITVEMIP----TDN
CAGL0M02981g       TSMGLSFPESIGEHFRVTEFRDLTIGFDSTTADKKPLLPVDKNSQMITITAVP---SGAS
Kpol_1068.8        PKNGNQYPKMIGTLLEVCSFRDLTTGFQSDTVDNIPSLPVDPSSQMITITAKI-CDDEYQ
KNAG0J00270        KP-GTQYPEAIGSEFQVVSFRDLTLGFQSDTSDHIPTLPVDPNSQMITVCAKP---THDN
TPHA0I00250        KNDKEKYVSHIGTEFKVITFRDLTLGYQSDTIGNVPTLPVDPSSQMITMTIIP----TSL
NDAI0K00410        DTSGNPYPKNIGKEFKIEVFRDLTTGYQSNTIDNLPNLPVDPHSEMITIEAVP----KQD
NCAS0C00410        PSTNKKYPSEIGNELIVTVFRDLTVGYQSNTKDNIPNLPVDPTSQMITVEAKP---SEFS
KLLA0D01573g       S----PYPKKLGSSFEIIKFRDLTNGYQSDTPDHIPELASDPSSQMITCEMLL-----VE
SAKL0D01474g       TPSGHAYPPAIGSEFSVISFRDLTTGYQSDTIDNVPNLPVDASSQMITATLRP-SNGKES
KLTH0C03872g       SLQ----PTHIGQEFRVESYTDLTTGYQSNTPDSEPRLPVDPSSQMITATLTPTSSTGRQ
Kwal_27.10258      D----SYPKHIGNQFDVVSFTDLTKGFQSDTADNTPRLPVDPSSQMIQATLVPSTSGGSG
TDEL0B00570        SETHDPYPSRIGEELKVNKFRDLTLGYQSDTVNQRPDLPVDPNSQMITAWTKV----NGA
ZYRO0G14190g       TPKGENYPRTIG-DLQVKTFRDLTTGYQSDTPNNIPNLHVDPSSQMITIVAQP----KGG
Skud_13.450        TPRNVPYPPYIGEEIRVLCYRDLTTGYQSDTLDHKPTLPVDPTSQMITVFARP----NDS
Suva_13.466        TPTGVPYPPSIGEEIEVVYYRDLTTGYQSDTPDHKPVLPVDPTSQMITLSGKP----SDG
Smik_13.491        TPKGVSYPSSIGKEIEVLNYRDLTIGYQSDTSNHKPTLPIDPSSQMITVSAKP----SDG
YMR278W            TPEGASYPSSIGEEIEVLYYRDLTTGYQSDTINHKPTLPVDPTSQMITVSARP----SNG
                             :*  : :    *** *::* *    * *  .  * **             

ABL126W            TDCESVRFTARGSGTEPKLKVYIESCAANHQRASHLSHLAWDVLKREWFRPTETGLQTNF
Ecym_4611          TSSDYVRFTIRGSGTEPKLKVYIESNALDKEYATKLAKLTWDVLKREWFRPEVTGLQTKF
KAFR0B03920        VGHEEIRFTIRGSGTEPKLKVYIESHAANKEAAANLAHLTWNVLRREWFRPEITGLKTSF
TBLA0B03250        ESDGSIRLTIRGSGTEPKLKVYIEACSRSATEASFLAKQAWNVLKREWMRPEQTGITTAF
CAGL0M02981g       NTGESVRFTIRGSGTEPKLKVYIEGISSTEGRARILAKSLWETLKHEWFKPSSNGLSTDF
Kpol_1068.8        KSDSIVRFTMRGSGTEPKLKLYIEGHSKDPIAASKIAKLTWDVLKKEWIRPEVTGVTTSY
KNAG0J00270        VERDHVRFTIRGSGTEPKLKVYIEACSGSETGAQQLAKQMWDTLQEVWFRPQTTGLVTDF
TPHA0I00250        PENGSVRFTIRGSGTEPKLKVYIEANAKTEAEANRLAKLTWDVLKREWFSSEKTGLTTNF
NDAI0K00410        IGKSKVRFTMRGSGTEPKLKLYIEAVADNEKCAIDLAYEMWNVLKKEWIRPDVTGLTTTF
NCAS0C00410        NLEGTVRLTMRGSGTEPKLKVYIEACSKSEESATNLARSTWDILKREWFRPEVTGLTTSF
KLLA0D01573g       QPTSRVRFTIRGSGTEPKLKVYIEARTNTEPNSIALAKFTWDVLRQEWFKPELTGLLTPF
SAKL0D01474g       TSGEQVRFTIRGSGTEPKLKVYIEAKSTDEKRAQHLARETWQVLRREWFRPERTGLETKF
KLTH0C03872g       GFSESVRFTARGSGTEPKLKVYIEAVSSSEELASALAKKAWDVLRREWFKPEQTGLATNF
Kwal_27.10258      APLEIVRFTARGSGTEPKLKVYIEATSVEETRASDLARTTWNVLRDEWFKPKETGLSTKF
TDEL0B00570        KPYESVRFTIRGSGTEPKLKVYIEACSKSEERASELAQLTWRVLKREWFRPDVTGLTTTF
ZYRO0G14190g       GSGEHVRFTLRGSGTEPKLKVYIEAGAQSDPRARELARQTWDILREEWF--NRPGLTTKF
Skud_13.450        NGNEHIRFTIRGSGTEPKLKVYIETRANEERRASFLAKLTWDVLRREWFRPEKTNITTNF
Suva_13.466        NGNEHIRFTIRGSGTEPKLKVYIEACADNEKRASYLAKLTWDVLRRGWFRPEIMNITTDF
Smik_13.491        NEGEHIRFTIRGSGTEPKIKVYIEACADEEQRATFLAKLTWNVLKREWFRPEKMDIVTHF
YMR278W            SENEHIRFTIRGSGTEPKLKVYIEACANEEQRASFLAKLTWNVLRREWFRPDEMNIVTKF
                        :*:* ********:*:***  :     :  ::   *  *.  *:     .: * :

ABL126W            -
Ecym_4611          -
KAFR0B03920        -
TBLA0B03250        -
CAGL0M02981g       -
Kpol_1068.8        -
KNAG0J00270        -
TPHA0I00250        -
NDAI0K00410        -
NCAS0C00410        -
KLLA0D01573g       Q
SAKL0D01474g       -
KLTH0C03872g       -
Kwal_27.10258      -
TDEL0B00570        -
ZYRO0G14190g       -
Skud_13.450        -
Suva_13.466        -
Smik_13.491        -
YMR278W            -
                    

FASTA FORMAT for MUSCLE Version 3.6

>ABL126W
---------MKENTDAVPSSLKDSLMEWLTFDKNSETQHEICELVSNHQWDELRKRLLPR
ITFGTAGLRARMEAGFSRMNTLTVIQASQGLARYIKSQFPD---DLKVVIGHDHRFHSRE
FAEATIAAFLQLDYDIYYLNYVPPGSD-EDVFVHTPMVPFAINNVEGGPTSCGVMITASH
NPKMDNGYKVYYANGCQIIPPHDELIGRHIDANLEPWTRAWDSKALIEEAIKSGKLHDVR
KEMLQKYKDSIQTMLVKQSNLKF------AGGPWFVYTPMHGVGYEFFKEAVASVLGIEE
DKDYIVVPEQKYPDPEFPTVSFPNPEERGALDMAMKVADANG-ITVVLANDPDADRFSVA
VK---YHGE---WNQLTGNQIGILFAQAEMQSYFKEPKL--DRKQLAMLTSAVSSQLLRK
MAEEEGFLAVETLTGFKWLGNRARELELEGYYVPFAYEEAIGYMFSQVVHDKDGIAAAAV
FLQMCYEW-KKVAKSSQEVLQECYEKYGYFVDYNGYYISSAPAVTKEVFDYFRNEY----
TPAGKPYPSHIGCEFEVEYLRDLTVGYQSDTATNIPDLPVDHNSQMITCVLKP---VKME
TDCESVRFTARGSGTEPKLKVYIESCAANHQRASHLSHLAWDVLKREWFRPTETGLQTNF
-
>Ecym_4611
----MPKTQVRDMNELIPDDLRDKIDKWFKYDKNPQTTAEIRSLVDSQNWNELRGRLCQR
ISFGTAGLRARMEAGFARMNTLTVIQASQGLATYIKSQFPN---NLKVVVGHDHRYNSKS
FAEVAIAAFLQLGFEVYYLNYVPSNKD-VESYVHTPMVPFTVSNIEGG-ASCGIMITASH
NPKMDNGYKVYYSNGCQITPPHDKKIASEIDANLVPWDQAWDAQKLIEDARNNNRLHDVK
QELIKNYVQRIQSSLVTTNSLAD------CGKNWFVYTPMHGVGYEIFNNIVTNTLHLKE
DEHYLVVGAQKFPDPEFTTVSFPNPEEEGALNLAIELAARSG-AELVLANDPDADRFSAA
VK---DGNK---WKQLTGNQLGYLFAVGQLEKFSNQNEN---KKPLAMLGSTVSSQMIAK
MADVEGFTFVETLTGFKWLANRAIDLENDGFYVPFAYEEAIGYMFSSVTHDKDGVSAATE
FLQMAARW-KKEGKTPLDVLNAGYEKYGNFVEYNGYYSVQDLSIIGDVFKYIRNAC----
NGNDVPYPSTIGNEFAVASFRDLTVGYQSDTGNHIPNLPVSPGSHMITCVLKPLIKETAQ
TSSDYVRFTIRGSGTEPKLKVYIESNALDKEYATKLAKLTWDVLKREWFRPEVTGLQTKF
-
>KAFR0B03920
--MSSQSNILSLIDEYVPERLKVSCDRWLRYDQNEETRSEILTIIGRKDWKELGNRLEGR
IPFGTAGLRGRMEAGFTRMNSLVILQTSQGLAQYIMEKFPQ---NLSVVVGHDHRYHSKE
FADITVATFLNAGFKVFYLN------T-ENEFVHTPLVPYSVDKLR---SACGVMITASH
NPKDDNGYKVYYSNGCQIIPPHDKNIALTIEKNLTPWSKDWNWKDLFSTEERNGNLEFNG
NKMFLAYVQDITRYVFTNGSPMLK-----TGKPWFVYTPMHGVGHKIFGQIAKQVLGLSE
NVDYFSVPEQIKPDPSFPTVSFPNPEEKGALDMAIQLAEREG-LTLIIANDPDADRFSAA
VKDK-RSHE---WRQLSGNEIGSLFAIFKLQEHKEKAAS---RKPLAMLNSTVSSQMLKK
MAQVEGFHYEETLTGFKWIGNRALQLEQQGYDVCFGYEEAIGYMFPCMEHDKDGIIASVV
FLHMYSKWLELEGLGPLDVLDLCFEKYGVFSEYNGYYTVEEPALIESVFSYIRDEY----
CPKARPYPEKLGREFFLTSFRDLTLGYQSDTIDFKPTLPVDASSQMITATLKP----ERT
VGHEEIRFTIRGSGTEPKLKVYIESHAANKEAAANLAHLTWNVLRREWFRPEITGLKTSF
-
>TBLA0B03250
---MSDEQQFNALIKDYPEDLQKKVLLWLEQDKDDSTRKEIIDLCKSANVKELHERFDSR
ITFGTAGLRSTMEAGFSRMNTLTVLQASQGLATYMKNDAKNTGQKLIAVIGHDHRYHSKE
FAKIAATVFLIAGFKVYYLNDDSLEDPRDNKFVHTPMVPFTVKNLK---ASVGVMVTASH
NPKMDNGYKVYYSNGCQIIPPHDSGISQCIDANLEPWENSWNYKEIMANAESKGDLIYHR
DVMLNDYITQLEEKLTSKDIIHLSKKIDVKSKPWFVYTPMHGVGYEIFTKISNEILHMKE
GEDFIVVEEQKHPDPGFPTVSFPNPEEKGAIDMGIKLAEDNG-ISLVIANDPDADRFSIA
VKSKGSQGT---WHQFTGNEIGYLFAYFEFQKYKISKQDL---HRLYMVNSTVSSQMIKK
MAEIEGFNYEETLTGFKWIGNRAIDLINKGNIVPFGYEEAIGYMFPTMEIDKDGIAATVI
FIQAFMYWNQIDKMDPYEIIQLGFKKYGVFIEYNGYYRYTDLGITKKIFDYVRYDYDKGV
SEGNKKYPDHIGEEFKIIKYRDLTTGYQSDTPDNKPLLPVDPSSQMITVEMIP----TDN
ESDGSIRLTIRGSGTEPKLKVYIEACSRSATEASFLAKQAWNVLKREWMRPEQTGITTAF
-
>CAGL0M02981g
-----------MSTTDIPVELRTAIESWLQLDKNEETRNEVIKLCNDQNWDELHKRFDSR
IVFGTAGLRARMEAGTNRLNKLVILQASQGLATYIKDKFPQ---NLTAVVGHDHRYHSQE
FAQVTAATFIRAGFKVYYLN------P-HDEFVHTPMVPYSVDHLN---ASVGVMITASH
NPKMDNGYKVYYTNGCQIIPPHDHGIAETINNNLEPWSTDWNFTKILSNAETDGKIEYVR
KRMLTSYLNSVVNQLIQRDFAAP------DEKPWFVYTPMHGVGHQIFSTILNESLNLKD
NIDYITVPEQKDPDPSFRTVSFPNPEEKGALNLAITLAEANG-IKLVLANDPNADRFSVA
VRDD-SKNE---WKQLTGNEIGLLFAFYEFKMYQKAADKGIKNKPLAMLNSTVSAQVIKR
MAEKEGFLYKDTLTGFKWIGNEAAKLEEKGYFVPFGYEEAIGYMFPAMEHDKDGVSAAIV
FLQAYANW-LQSSSNPIDIIHECYDKYGVSAEYNGYYIVSDPSKTDKVFESIRSSY----
TSMGLSFPESIGEHFRVTEFRDLTIGFDSTTADKKPLLPVDKNSQMITITAVP---SGAS
NTGESVRFTIRGSGTEPKLKVYIEGISSTEGRARILAKSLWETLKHEWFKPSSNGLSTDF
-
>Kpol_1068.8
--MVSSNSEFDSVLETLPVDLRDKVGTWLAQDKNPETINEVIRLCKANSLNELHKRFDNR
ILFGTAGLRSKMEAGFSRMNTLVVLQATQGLATYIKQQFPS---NLKAVIGHDHRYHSKE
FAEIATSVFLSAGFTVYNLN------P-PGTFVHTPLVPFTVDQIG---ASVGVMITASH
NPKMDNGYKVYYSNGCQIIPPVDASIAKCIDENLEPWSNSWDSSKAIEAGLSNKKLIYLR
NEMLLAYSDKVDNNIIDKKTIREFD---EHRKPWFVYTPMHGVGYEIFTSLVLEKVNLKE
NRDYLTVKEQIVPDPAFPTISFPNPEEKGALDMAIALAKEND-ISLVIANDPDADRFSAA
IYNS-HSGE---WQQLTGNEIGFLFGYYLFNKYTNMDPEFKKNHPLAMLNSTVSSRMLKS
MADTENFKFIDTLTGFKWIGNKAIDLKKEGYHVVFGYEEAIGYMFPAMEHDKDGITASVV
FLQAYFEWDNLSKVTVIDILEQGIEKYGAFKEYNGYYVVSNPQVTNDIFHYIRNEY----
PKNGNQYPKMIGTLLEVCSFRDLTTGFQSDTVDNIPSLPVDPSSQMITITAKI-CDDEYQ
KSDSIVRFTMRGSGTEPKLKLYIEGHSKDPIAASKIAKLTWDVLKKEWIRPEVTGVTTSY
-
>KNAG0J00270
-----MDKGTLHILQNAPEGLQHRILEWLRLDKNEETRREVLDLCQRQDWSELNSRFSQR
ILFGTAGLRSRMEAGTNRLNSLVILQATQGLARYIASQFPK---NKVAVVGHDHRFHSKE
FATVTAAVFLRAGFKVLYLN------P-GDTLVHTPLVPFTVDHLN---ASVGVMITASH
NPKMDNGYKVYFANGCQIIPPHDLNIARSIDQNLEPWEPSWDWPTVIQAAEKEDRIVYVK
DQMTQLYTKTAELQLIGGRKVLRNP----GSGPWFVYTPMHGVGSEIFSRISEDVLGIKE
NEDYLCVPEQKHPDPSFPTVSFPNPEEKGALDKAIELASQNG-INLVIANDPDADRFSLA
VFDS-KTAN---WRQLTGNEIGFLFAYQQFEMYKAMDDIFQKEHPLVLLNSTVSSQMIKK
MAEVEGFHYEDTLTGFKWIGNRARDLEKKGFFAPFGYEEAIGYMFTQMEHDKDGISASLM
FLLSYYHWVYDAHKFPLDILEDGYKKYGVFKEYNGYYIVDNPKIMKETFDYIRNDR----
KP-GTQYPEAIGSEFQVVSFRDLTLGFQSDTSDHIPTLPVDPNSQMITVCAKP---THDN
VERDHVRFTIRGSGTEPKLKVYIEACSGSETGAQQLAKQMWDTLQEVWFRPQTTGLVTDF
-
>TPHA0I00250
--MTLSDQEIENLLSSIPEDLKEKIRVWFRYDDNQETVDEVKELCVNKSLDELHKRFDQR
IVFGTAGLRSRMEAGFNRMNALTVLQSTQGLASYIKSQFPS---NLTAVVGHDHRYHSKE
FAQITAAVFLNAGFKVYYLN------P-NDEFVHTPMVPFGINLYS---ASIGVMITASH
NPEMDNGYKVYYNNGCQIIPPHDKNIAECIEKNLEPLSDNWNTEAVISKAIENVKLIYSK
EDVLQQYMLNLDKYIIPKNISLGTTI--KGKKPWFVYTPMHGVGYQIFHRISSTCLNLVE
DIDYVCVKEQIVPDPSFPTVSFPNPEEKGALDLGIKYAKKHN-IDLVVANDPDADRFSVA
VRNP-LTDE---FQQLTGNEIGFLFAYFLWEQYSMLPADFKDKFPLAMINSTVSSQMIKK
MAEVEGFYYEDTLTGFKWIGNKARELEKEGYYVPFGFEEAIGYMFPKMECDKDGITATVV
FLQAYYGWCMNNKQSLFDIIETGFKKYGVFKEYNGYYIVNDLSLTKIIFDNIREN-----
KNDKEKYVSHIGTEFKVITFRDLTLGYQSDTIGNVPTLPVDPSSQMITMTIIP----TSL
PENGSVRFTIRGSGTEPKLKVYIEANAKTEAEANRLAKLTWDVLKREWFSSEKTGLTTNF
-
>NDAI0K00410
-----MSSIPSIICDDCPANLRENIDLWLRQDKCEETRNEVIQLCKDSNWIELHKRFDSR
IVFGTAGLRSRMEAGFSRMNPLVILQASQGLAKYIKAQFPT---NLTAVVGHDHRFHSKQ
FAMITASVFLRVGFKVYYLN------P-EDSFVHTPLVPFSVNHLN---ASIGVMITASH
NPKMDNGYKVYYSNGCQIIPPHDKNIAATIDENLEPWSSDWNWDSTFEKNLKEKKLVYVR
EEMTNKYLQAMKDILVSSSISRPNN---NGKKPWFVYTPMHGVGYNIFTKISKNILHYEE
NMDYFVVKEQMYPDPAFPTVSFPNPEEKGALSLATKLAEENN-ISLVIANDPDADRFSVA
SKNE-KTGQ---WQQLSGNEIGFLFASFELEKYMSQDIEWRRTHPLAMINSTVSSQMIKK
MAQVESFHYEDTLTGFKWIGNRALDLQGQGYYVPFGFEEAIGYMFPTMVTDKDGVSAAVV
FLLAYSYWLNNDGSYPFDILEKGFKKFGFFKEYNGYYIYDDPKTTKQIFDFVRYQY----
DTSGNPYPKNIGKEFKIEVFRDLTTGYQSNTIDNLPNLPVDPHSEMITIEAVP----KQD
IGKSKVRFTMRGSGTEPKLKLYIEAVADNEKCAIDLAYEMWNVLKKEWIRPDVTGLTTTF
-
>NCAS0C00410
------MDATQSSLSNCPENLREPINLWLRLDQNEETRKEVLQLCENKNWPELHQRFDTR
IVFGTAGLRSRMEAGFSRMNSLIILQSTQGLANYIKEQFPN---NLTAVVGHDHRFHSKE
FAIVTASIFLRAGFKVFYLT------P-DDQFVHTPLVPFSVLNLK---ASVGVMITASH
NPKMDNGYKVYYDNACQIIPPHDKNIAEMIQKNLEPWSTSWDWDATFKKGLETNKLVFIK
DLMTEKYLMQMKRVLIHSSHLSLKD----VKTPFFVYTPMHGVGAEIFAKVSSELLNLHE
NVDYLVVSEQRLPDPSFPTVSFPNPEEKGALSLAIKLAQENG-LSLVIANDPDADRFSAA
VLNK-KTGK---WRQLTGNEIGFLLGYYEFQLYEQQDVAFRKTHPLAMINSTVSSQMIKR
MADMNGFHYEDTLTGFKWIGNKAIDLRQEGYYVPFGFEEAIGYMFPDMECDKDGISAATV
FLQAYCHWMNQYQMSPFDIMEEGFGKFGVFKEYNGYYILKDLSITKTVFDFIRHEY----
PSTNKKYPSEIGNELIVTVFRDLTVGYQSNTKDNIPNLPVDPTSQMITVEAKP---SEFS
NLEGTVRLTMRGSGTEPKLKVYIEACSKSEESATNLARSTWDILKREWFRPEVTGLTTSF
-
>KLLA0D01573g
-------MSETEVIESLPSDLQGKVRNWLKYDKVEETRNEILQLCLKGDITELHKRLDTM
IAFGTAGLRGRMEAGFNRMNALTVKQASQGLAKYIKKQFPE---NLTVVVGHDHRHNSRL
FGKVTVDTFLQLGFKVFHLNHE----N-EKSLVHTPLVPFTVNATG---ASVGIMITASH
NPKMDNGYKVYYTNGCQIIPPHDKLIAESIIHNLEPFSSP-----------QTGTIIDCK
EKMTKKYIDAIGSTLIDGAVNKK------TNEPWFVYTPMHGVGFEIFESISKQLLSLEE
GKDYLVVEEQKYPDADFPTVSFPNPEEKGALDLAVEYGRKNDTVDLIIANDPDADRFSVA
VRDN-DQNTTTAWRQLTGNEIGFLFAYYEWERYKHSPID----EPLAMLNSTVSSQMIKR
MAEIEGFHYEDTLTGFKWLGNRALELEQEGYYTPFAYEEAIGYMFSSVVHDKDGISAAIV
FLQAYSKW-RASGQTVLDILATASLKYGHFKEFNGYYIVPDLAITKQVFDAIRSIE----
S----PYPKKLGSSFEIIKFRDLTNGYQSDTPDHIPELASDPSSQMITCEMLL-----VE
QPTSRVRFTIRGSGTEPKLKVYIEARTNTEPNSIALAKFTWDVLRQEWFKPELTGLLTPF
Q
>SAKL0D01474g
---------MSDSYTTVPDDLKESVNLWLTYDKNPETRSELLNLVEGKHWEELHGRLDER
ISFGTAGLRSRMEAGFSRMNTLTVLQASQGLASYIKSQFPE---NLSVIVGHDHRYHSNE
FARVTVTAFLQLGFKVYYLNLSSKD-S-TETFVHTPMVPFTINQLN---ASAGIMITASH
NPKMDNGYKVYYSNGCQIIPPHDRLISETIDQNLVPWNKAWDCDEVIKTAIESGFLFDVK
EKVTSKYIKTVSDELVRVPMLD-------CDKPWFVYTPMHGVGFEIFEQIALLALGLKE
GKHYVCVPEQRCPDPAFPTVSFPNPEEKGALDLSIALAEEQD-IRLVIANDPDADRFSVA
VK---NGDR---WSQLTGNEIGFLFAYYQWQDYQKLGESFKKQHPLAMINSTVSSQMIKS
LAEAEKFHYEDTLTGFKWLGNRAFELETQGYYVPFAYEEAIGYMFPEVEHDKDGISAAVV
FLQMYCEWLSKDRMTPLQVLDEGFGKYGVFKEYNGYYIVPRLSLTKEVFDYIREDY----
TPSGHAYPPAIGSEFSVISFRDLTTGYQSDTIDNVPNLPVDASSQMITATLRP-SNGKES
TSGEQVRFTIRGSGTEPKLKVYIEAKSTDEKRAQHLARETWQVLRREWFRPERTGLETKF
-
>KLTH0C03872g
--------MMSLTNAEVPEDLKLGVEAWLKYDKNEQTRDQIIKLVEDKSWTELRNRLNFR
ITFGTAGLRSRMEAGFNRMNTLTVLQASQGLAKYIASNFPD---NLSVVVGHDHRFNSKD
FAEVTIVAFLQLGFKVYDLGFTEDA-S-QDVVVHTPMVPFGIDHLR---ASGGIMITASH
NPKMDNGYKVYYSNGCQIIPPHDQRISQSILANLEPWDRAWDCAAVKAEAVQSEMLIDAK
KVLVDQYVDTVRRSLVITNVNH-------TKAPWFVYTPLHGVGFEIFEKILSSAWRLGQ
GRDYLCVEEQKYPDPNFPTVSFPNPEEKGALDKAIELAEKHD-ITFVLGNDPDADRFSVA
AK---HNGQ---WRQLTGNEIGFLFAQYKWETYRLESDKFKGTNPLAMINSTVSSQMIKK
MAEVEGFHYEDTLTGFKWLGNRARELENAGYFVPFAYEEAIGYMFSDVVHDKDGISAAVV
FLQMLWSW-KAQALTPFDVLQRAYQKYGVFKEYNGYYIVPDLSLTDKVFSGIRSGF----
SLQ----PTHIGQEFRVESYTDLTTGYQSNTPDSEPRLPVDPSSQMITATLTPTSSTGRQ
GFSESVRFTARGSGTEPKLKVYIEAVSSSEELASALAKKAWDVLRREWFKPEQTGLATNF
-
>Kwal_27.10258
---------MESIKVEIPADLKSSVESWFEHDKNEETRNEILQLVTEQNWNELHKRLDQR
ISFGTAGLRSKMEAGFSRMNTLTVLQASQGLAKYIAEKFPE---NKTVAVGHDHRFNSRD
FAEVTSVAFLQLRFKVYSLGFNAD--PKKDAFVHTPMVPFAIDRLG---ASAGVMITASH
NPKMDNGYKVYYSNGCQIIPPHDRLIAQSILDNLNPWERAWDCKAVIAEATEKGYFVDMK
KPMVDHYVKEISDKLVSSDIGD-------RSKPWFVYTPLHGVGFEIFERIASEVLGLVE
GRDYWCVSEHKQPDPAFPTVSFPNPEEAGALDLAIALADKNG-ISFVLGNDPDADRFSAA
VK---HQGK---WRQLTGNEIGFLFAQFVWEKYQKESSEFKLENPLALINSTVSSQMIKK
LAGVEKFHYEDTLTGFKWLGNRARQLESSGYYVPFAYEEAIGFMFSDIVHDKDGVSAAVV
FLQMLWSW-KKQALSPIDVLQSAFGKYGVFKEYNGYYTVPDLSLTDRIFSDIRSSY----
D----SYPKHIGNQFDVVSFTDLTKGFQSDTADNTPRLPVDPSSQMIQATLVPSTSGGSG
APLEIVRFTARGSGTEPKLKVYIEATSVEETRASDLARTTWNVLRDEWFKPKETGLSTKF
-
>TDEL0B00570
MTGRIIQSDEKEVINSVPTDLSQLVASWLSQDGNKQTRLEILNLCKAKDWLELHKRLDTR
ILFGTAGLRSRMEAGFSRMNTLVVLQATQGLAQHIKKQFPD---ALTAVVGHDHRFNSQE
FALATVATFLQAGFKVIFLN------D-GDKFVHTPIVPFTVNEVG---ASVGVMITASH
NPKMDNGYKVYYSNGCQIIPPHDSEIAQSIEENLTLWPKAWKWDELLKEGLDTKCLVYAG
EEMIERYTKKMGQSLVDRTTISAEK----EGKPWFVYTPIHGVGYDIFRQIAEETMNLIN
GRDYLCVKEQQLPDPSFPTVPFPNPEEKGALDMAISVADKNG-ISLVLANDPDADRFSAA
VKDN-KTGT---WRQLTGNEIGALFAFYEFQKYQKKNEEYKEKHPLAMLNSTVSSQLIMK
MAEIEQFHYIDTLTGFKWIGNRTLDLEAMNYYVPFGFEEAIGYMFPVMEHDKDGISAASV
FLQMYRKWLVGSKKTLLTVLEDIFEKYGVFKEYNGYYSVNDPKVIKEVFDFIRNDY----
SETHDPYPSRIGEELKVNKFRDLTLGYQSDTVNQRPDLPVDPNSQMITAWTKV----NGA
KPYESVRFTIRGSGTEPKLKVYIEACSKSEERASELAQLTWRVLKREWFRPDVTGLTTTF
-
>ZYRO0G14190g
------------MSSNIPENLKQPISLWLAQDRNEKTCKEIAELCDAENWSELHERLNSR
LQFGTAGLRARMEAGFSRMNTLVVIQATQGLAQYIKKQFPD---HLVAVVGHDHRFNSMD
FAKATATVLLKAGFEVHYLN------Q-GDSYVHTPMVPFTVDRVK---ASVGVMITASH
NPKLDNGYKVYYANGCQIIPPHDSAIARSIESNLEPGNGVWDWDQTMQQAADEGKLIYGR
DKMLEQYISCVKDSFVTELDSLP------KGKPWFVYTPMHGVGYQVFDQIASKILQLEV
NRDFLVVSEQLNPDPEFPTVQFPNPEEKGALDLAIKLAENHG-IKLVIASDPDADRFSVA
FKGP-HG-----WQQLSGNDIGFLFAYYELQKYRGFDAEYQKSHPLAMLNSTVSSQMINS
MAALEGFHHEDTLTGFKWIGNRALELEARGYYVPFGFEEAIGYMFPATEHDKDGISAAVV
FLQAYHSW-ISQGKSPLDILDEASAKYGVFREYNGYYLVDEPSLTNKTFAYIREDY----
TPKGENYPRTIG-DLQVKTFRDLTTGYQSDTPNNIPNLHVDPSSQMITIVAQP----KGG
GSGEHVRFTLRGSGTEPKLKVYIEAGAQSDPRARELARQTWDILREEWF--NRPGLTTKF
-
>Skud_13.450
--------MSQQFLGTIPSDLKGPISLWFDQDRDPETIEEVTALCKKSDWDELHKRFDTR
IQFGTAGLRSQMQAGFSRMNNLVIIQASQGLATYIRQQFPN---NLVAVVGHDHRFHSKK
FARATATAFLLKGFKVHYLN------P-GQEFVHTPLVPFAVDELN---ASVGVMITASH
NPKMDNGYKVYYSNGCQIIPPHDQAISNAIDMNLEPWANAWNFDDILSKNLKQGKLMYSR
EEMLKLYLEKISDNLVETTPLKLEV----RSKPWFVYTPMHGVGFDIFSTIVKKSMCLVE
GKDYLCVPEQQNPDPSFPTVGFPNPEEKGALNIGMRLAEKHD-ISLLIANDPDADRFSVA
IKDM-QSGM---WQQLTGNEIGFLFAFFEFEKFKSMDEQFQQTHPLAMLSSTVSSQMIKR
MAEVEGFHYEDTLTGFKWIGNRAIILEKEGYYVPFGFEEAIGYMFPAMEHDKDGISASVV
FLQAYCKWKLANNLDPINVLENGFKKYGVFKEYNGYYIVPNPIVTKEIFKYIRDVY----
TPRNVPYPPYIGEEIRVLCYRDLTTGYQSDTLDHKPTLPVDPTSQMITVFARP----NDS
NGNEHIRFTIRGSGTEPKLKVYIETRANEERRASFLAKLTWDVLRREWFRPEKTNITTNF
-
>Suva_13.466
--------MYQQLLETVPSDLKGPISLWFDQDRNPETIEEVTTLCKNSDWDELHKRFDTR
IQFGTAGLRSEMQAGFSRMNTLVIIQATQGLATYIKQQFPD---NLVVVVGHDHRFHSKE
FARATATAFLLKGFKVHYLN------P-DHEFVHTPLVPFAVDKLK---ASVGVMITASH
NPKMDNGYKVYYSNGCQIIPPHDHAISDSIDMNLEPWANVWKFSDVLNKALKQGKLMYSR
EEMLNLYSKEVSKTLVETNPLKLEI----KAKPWFVYTPMHGVGFNIFSTIVKKTMSLVE
GEDYLCVPEQQNPDPSFPTVGFPNPEEKGALDIGMRLAEEHD-INLLVANDPDADRFSIA
VKDT-QSSK---WRQLTGNEIGFLFAFFEFQRYKNKDEEFQRSHPLAMLSSTVSSQMIKK
MAEVEGFLYEDTLTGFKWIGNRAIILEKEGYYVPFGFEEAIGYMFPAMEHDKDGISAAVV
LLQAYCKWKIDSNLDPIDILENGFQKYGVFKEYNGYYVVPSPLVTTEIFEYIRNVY----
TPTGVPYPPSIGEEIEVVYYRDLTTGYQSDTPDHKPVLPVDPTSQMITLSGKP----SDG
NGNEHIRFTIRGSGTEPKLKVYIEACADNEKRASYLAKLTWDVLRRGWFRPEIMNITTDF
-
>Smik_13.491
--------MSLQFLEAVPSNLKEAISLWFEQDQNPETIEEVTALCKKSDWNELHRRFDSR
IQFGTAGLRSQMQAGFNRMNTLVIIQASQGLATYAKQQFPN---NLVAVVGHDHRFHSKE
FARATATAFLLKGFKVHYLN------P-DHEFVHTPLVPFAVDKLK---ASVGVMVTASH
NPKMDNGYKVYYSNGCQIIPPHDHAISDSIDMNLEPWANVWNFDDVLNKGLKQGKLMYSR
EEILKLYLGEVSKNLVGTDPLKFEV----KAKPWFVYTPMHGVGFDIFSTIVKKTMSLVE
GKDYLCVPEQQEPDPSFPTVAFPNPEEKGALDLGINLAENHG-INLLIANDPDADRFSVA
IKDI-RSGE---WRQLTGNEIGFLFAIFEFQKFKSMEKQFQHAHPLAMLSSTVSSQMIKK
MAEVEGFHYEETLTGFKWIGNRAILLEKEGYYVPFGFEEAIGYMFPAMEHDKDGLSASIV
FLQAYCQWKIDHNLDPISILEDGFKKYGVFKEYNGYYIVSSPIVTNEIFDYIRNAY----
TPKGVSYPSSIGKEIEVLNYRDLTIGYQSDTSNHKPTLPIDPSSQMITVSAKP----SDG
NEGEHIRFTIRGSGTEPKIKVYIEACADEEQRATFLAKLTWNVLKREWFRPEKMDIVTHF
-
>YMR278W
--------MLQGILETVPSDLKDPISLWFKQDRNPKTIEEVTALCKKSDWNELHKRFDSR
IQFGTAGLRSQMQAGFSRMNTLVVIQASQGLATYVRQQFPD---NLVAVVGHDHRFHSKE
FARATAAAFLLKGFKVHYLN------P-DHEFVHTPLVPFAVDKLK---ASVGVMITASH
NPKMDNGYKVYYSNGCQIIPPHDHAISDSIDANLEPWANVWDFDDVLNKALKQGKLMYSR
EEMLKLYLEEVSKNLVEINPLKLEV----KAKPWFVYTPMHGVGFDIFSTIVKKTLCLVE
GKDYLCVPEQQNPDPSFPTVGFPNPEEKGALDIGINLAEKHD-IDLLVANDPDADRFSVA
VKDM-QSGE---WRQLTGNEIGFLFAFYEYQKYKSMDKEFQHVHPLAMLNSTVSSQMIKK
MAEIEGFHYEDTLTGFKWIGNRAILLEKKGYYVPFGFEEAIGYMFPAMEHDKDGISASIV
FLQAYCKWKIDHNLDPLNVLENGFKKYGVFKEYNGYYVVPNPTVTKDIFDYIRNVY----
TPEGASYPSSIGEEIEVLYYRDLTTGYQSDTINHKPTLPVDPTSQMITVSARP----SNG
SENEHIRFTIRGSGTEPKLKVYIEACANEEQRASFLAKLTWNVLRREWFRPDEMNIVTKF
-