MUSCLE (3.8) multiple sequence alignment

KLLA0D01595g       --MSLETN--VKVTSDLPYPITVAQLYVKPGDHVEKGQRLFAYEYWDFQDVLVK---YE-
SAKL0D01496g       ----MTTA--LKLPDNLPYPITIAQLCASTGDPIKKGQRLFAYKYWEFQDVVTS---PN-
KLTH0C03894g       ----MTTP--IRLPSNLPFPVTIAKLCVSTGDSVKKGQRLFVYKYWELQDIITA---PN-
Kwal_27.10263      ----MTTP--IRLPPNLPFPITIAKLYVSKGESVTKGQRLFVYKYWELQDVITA---PN-
ABL127W            ----MSTP--IRLPDSLPYPITIAQLGVSTGDTVEKGQRLLAYKYWDLVDVITA---PG-
Ecym_4610          ----MSTP--IRLPDNLPYPITVAQLAVSAGDMVERGQRLFAYKYWDFEQIVTS---PG-
KNAG0J00280        MDLVAPTP--VVSGAGLPYPVTVDELIPQVGDRVSRGDRLFAYKFWYVVELAGV---DA-
Suva_13.465        ----MTTQ--IRSPEGLPYPIQIDKLIPSVGSFLQEGDRLLVYKFWYLVERPSD-AGDD-
Skud_13.449        ----MTTQ--IRSPEGLPYPIQIDKLVPSVGSYLHEGDRLIVYKFWYLVERASDTTGDD-
Smik_13.490        ----MTTQ--IRSPEGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASE-TGVD-
YMR277W            ----MTTQ--IRSPQGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASD-TGDD-
Kpol_1068.9        ----MSTP--VSAPLGLPYPITISKLIASIGSHVEKGQRLFAYKFWYIVEIAKS---PD-
TPHA0I00240        ----MATP--VKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKS---PD-
KAFR0B03910        ----MTTP--VLAPEGLPYPITIDELICPIGTYIEKGIRLFAYKFWYMVEIASS---PD-
NDAI0K00420        ----MATPTVIRAPLGLPYPITIDELMKPIGTEMNKDDRLLAYKFWYVVEIATS---PDE
NCAS0C00420        ----MSTQ--ILAPIGLPYPITIDQLITHVGDEVQKGDRLLAYKFWFVVDVASS---PD-
TBLA0D03260        ----MSTP--VLSPADLPFPITIDQLITPIGSHVEKGQRLFAYKFWYMVEIAQS---PD-
CAGL0M02959g       ----MSTP--VLTPMGLPYPITVDELMVPIGSYVEKGQRLFAYKFWYMVEIANS---PD-
ZYRO0G14168g       ----MATP--VIAPESLPYPITIDQLIAPIGSTVKKGQRLFAYKFWYMVEIASS---PD-
TDEL0B00580        ----MTTP--VFSPEVLPYPITIDQLIAPIGSHVEKGQRLFAFKFWYMVEIASS---PD-
                         *   :     :*:*: : :*    *  :  . **:.:::* . :          

KLLA0D01595g       --------------------------------------------------EKTKKQRVDR
SAKL0D01496g       -----DTS------------------------------------------TKPKKQRVDL
KLTH0C03894g       -----EE-------------------------------------------APKKKRRVDL
Kwal_27.10263      -----EE-------------------------------------------ASKKKRRVDL
ABL127W            -----EEEA-----------------------------------------GKARKQRVDL
Ecym_4610          -----DESAG----------------------------------------GKSKRQRIDL
KNAG0J00280        -----AAEGDSD-GTG----------------------------------TTAKKSVRES
Suva_13.465        -----DNDHDSS-PGGGGG-GSV---------------------------SPPTKQLRES
Skud_13.449        -----DNEHDAT-PGGGAGSGSV---------------------------SPPTKQLRES
Smik_13.490        -----DNEHDAS-PGGGAGSNGV---------------------------SPPTKQLRES
YMR277W            -----DNEHDVS-PGGSAGSNGV---------------------------SPPTKQLRES
Kpol_1068.9        -----ENDDGVND-------------------------------------EHSKKSIRES
TPHA0I00240        -----ELDVNGN-VQDG---------------------------------EQSKKTIRES
KAFR0B03910        -----DNDPANT-DTQA---------------------------------SHPKKKIRES
NDAI0K00420        LEDDNDNDNDND-PDGDVDKNTINGNNVTNLTNRPSIEPISRNTITHAHKKKKKKTVRES
NCAS0C00420        -----DNDVSSP-PTAG------------------------------------KKSIRES
TBLA0D03260        -----NNDPTSENSSDLSGNNSDSNENGNNA-------------------SHQKKSIRES
CAGL0M02959g       -----DNDIDYE-GPEI---------------------------------EKSKRKVRES
ZYRO0G14168g       -----END---G-NGGA---------------------------------QHSKKTVRES
TDEL0B00580        -----ENEG-----------------------------------------GHRKKTVRES
                                                                         .   : 

KLLA0D01595g       VATFDSPVSGTVKEWHCSVKDEFASANHEVITIRQDCNHDITYGGLCVQCGNTVDEEDNS
SAKL0D01496g       IGTFDSPVEGALVSFNLSLGDEFVNSNHVVAEIKQACTHDVTYGGLCVICGKSVEEYSSN
KLTH0C03894g       IGTFDSPVEGTLVSLNIGLGDEFVNDANVIAEVNQLCSHEVTYGGLCVVCGKTVEEDDQN
Kwal_27.10263      IGTFDSPIEGTLVSLKVRVGDEFVNDSNIIAELRQPCSHEVTYGALCVVCGKAVDEDDSN
ABL127W            VGTFDSPVAGTVVSLDVRVGDEFVNSQRPVVEIRQACPHDVTYGGLCVQCGQAVEDEAGA
Ecym_4610          VGTFDSPVSGQVVSLNITLGDEFVNSQCTVAEIKQPCTHDVTYGGLCVQCGQTVEDEQTS
KNAG0J00280        VEFFESPFEGTVVSWDVDAGDEIPGPGAPLCLLRRPCNHDVVYNGLCTLCGREVDEYEIQ
Suva_13.465        IEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHDIVYGGLCTQCGKEVSADAFD
Skud_13.449        IEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHDIVYGGLCTQCGKEVSADAFD
Smik_13.490        IEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDIVYGGLCTQCGKEVSADAFD
YMR277W            IEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDIVYGGLCTQCGKEVSADAFD
Kpol_1068.9        IEFFDSPFEGDLVSWNVDVGDEIVEPNQTICEIVRPCNHDIVYAGICTMCGKEVDESDQV
TPHA0I00240        IDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIVYAGICTMCGKEVDERDQV
KAFR0B03910        IEFFDAPFEGTLISWNIDVGDELSSASQVICEIKRPCNHDIVYGGLCTQCGKEVDESEQS
NDAI0K00420        IEFFDCPYDGILTSWLVEKGDQIVGPNQPLCEIQRPCNHDVIYGGLCTLCGKEVDENDID
NCAS0C00420        IEFFESPYKGQLISWNVDIGDEIASPNQVLAEIIRPCNHDVVYGGLCTLCGEEVDEDDND
TBLA0D03260        IEFFESPFEGDLIGWNVDKGDEIISENQLLCDIKRPCNHDIVYAGICTQCGKEVDDSDIM
CAGL0M02959g       IEFYEAPFEGDLLSWNVDEKDEIAGPNMAVCEIKRPCNHDIVYGGLCTMCGKEVDEYDQV
ZYRO0G14168g       IEFFESPFEGDLVSWEVDRGDEVASARQVICEIMRPCNHDVVYGGLCTMCGKEVDENDQM
TDEL0B00580        IEFFEAPFEGDLMSWNVDVGDEVVAPNQAICEISRPCNHDIVYGGLCTLCGKEVDESEQF
                   :  ::.*  * :        *:.      :  : . * *:: * .:*. **  *.     

KLLA0D01595g       K----------NLTISHVNTNIKVSEQQAETLERSSLTRLREEKKLVLVVDLDQTVIHCG
SAKL0D01496g       SA---SDPSQNKLTMSHTNTNIKISERQAAAIEETAQKQLRKLKKLVLVVDLDQTVIHCG
KLTH0C03894g       VS--DNGISNSKLTVAHNNTNIKVSERQAATIEKTAQKHLREHKKLVLVVDLDQTVIHCG
Kwal_27.10263      MS--GSGVSNGKLTVAHNNTNIKVSERQAASIEKTAQKELRERKKLVLVVDLDQTVIHCG
ABL127W            AD----GVEQAKLTVSHTNTHIRVSERQAASLGQSAQLKLREARKLVLVVDLDQTVIHCG
Ecym_4610          GS---LLDNQAKLTMSHTNMNIRISEKQAYTLEKSAQKQLREARKLVLVVDLDQTVIHCG
KNAG0J00280        AAAAASGGVGPNLTVSHRDTNLQISRVEAQQLDLQLQQRLRAAQKLVLVVDLDQTVVHCG
Suva_13.465        GV---------PLDVV-GDMDLQISETEAIRTGRALKEHLRRDKKLILVVDLDQTIIHCG
Skud_13.449        GV---------PLDVV-GDMDLQISETEAIRSGEALKEHLRRDKKLILVVDLDQTIIHCG
Smik_13.490        GV---------PLDVV-GDMDLQISETEAIRTGKALKEHLRRDKKLILVVDLDQTIIHCG
YMR277W            GV---------PLDVV-GDVDLQISETEAIRTGKALKEHLRRDKKLILVVDLDQTIIHCG
Kpol_1068.9        SA---------NLTISHTDTNLKVSRREANDIGQGIKKRLIREKKLILVVDLDQTVIHCG
TPHA0I00240        SA---------NLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLILVVDLDQTVIHCG
KAFR0B03910        QF-------GSNFTVSHTDTNLKISRKEALDIGEDFKKRLRNEKKLVLVVDLDQTVIHCG
NDAI0K00420        DL------SGPNLTISHTDTNLKISTREAVDIGQSVKKRLRDDKKLILVVDLDQTVIHCG
NCAS0C00420        AS-----GSGANLTISHTDTNLKISTREALDIGLNVRTRLRKEKKLVLVVDLDQTVIHCG
TBLA0D03260        DA---------SLSISHTDTNLKISRKEARDIDQSSMSRLKKIKKLILVVDLDQTVIHCG
CAGL0M02959g       DA---------NLTISHTDTNLRVSRKEAIDLDKQITTRLKNEKKLVLVVDLDQTVIHCG
ZYRO0G14168g       EA---------NLAISHTDTNLKVSRKEAEDMEHFLKQRLRQSKKLVLVVDLDQTVIHCG
TDEL0B00580        NG---------NLAISHTDVNLKVSRKEATDIENNLKTRLRESKKLVLVVDLDQTVIHCG
                               : :   :  :.:*  :*          *   .**:********::***

KLLA0D01595g       VDPTIGEWMRDPKNPNYKALQDVKSFTLEDEPIIPSFYFG-----PK-PPARKSWYYVKL
SAKL0D01496g       VDPTIGEWSRDPKNPNYEALKDIKSFALVEEPILPPFYMG-----PK-PPARKCWYYVKL
KLTH0C03894g       VDPTIHEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMG-----PR-PPPRKCQYYVKL
Kwal_27.10263      VDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMG-----PR-PPPRRCQYYVKL
ABL127W            VDPTIGEWSKDPNNPNYEALKDVQSFSLDEEPVLPPFYMG-----PK-PPTRKCWYYVKL
Ecym_4610          VDPTIGEWSKDPDNPNYESLKDVRSFSLHEEPVLPPFYMG-----PK-PPTRKCWYYVKL
KNAG0J00280        VDPTIGEWKRDPRNPNYEALRDVQSFALEEEPILPFLYVG-----GKRPAPRKCWYYVKV
Suva_13.465        VDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAEDGSVPKPPPVRKCWYYVKV
Skud_13.449        VDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSVLKPPPVRKCWYYVKV
Smik_13.490        VDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSVLRPPPVRKCWYYVKV
YMR277W            VDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNDDGSMLRPPPVRKCWYYVKV
Kpol_1068.9        VDPTIAEWKNDPTNPNFETLRDVKSFVLEEEPILPPMYMG-----PK-PPTHKCWYYVKI
TPHA0I00240        VDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMG-----PK-PPVHKCSYYVKV
KAFR0B03910        VDPTIGEWKSDPNNPNYDTLKDVQMFALEEEPVLPFMYMG-----PK-PTPRKCWYYVKV
NDAI0K00420        VDPTIGEWKRDPTNPNFETLKDVKEFALEEEPILPLMYMG-----PK-PPARKCWYYVKV
NCAS0C00420        VDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPTLYMG-----PK-PPLRKCWYYVKV
TBLA0D03260        VDPTIGEWKNDPKNPNYETLKDVRSFSLDEEPILPPSYMG-----PR-PPVRKCWYYVKV
CAGL0M02959g       VDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYMG-----PK-PPVRTCWYYVKI
ZYRO0G14168g       VDPTIGEWKKDPSNPNYETLKDVQMFSLEEEPIVPPMYMG-----PR-LPERKCWYFVKV
TDEL0B00580        VDPTIGEWKRDSSNPNYEALKDVQSFALDEEPILPLLYMG-----PK-PPVRKCWYYVKV
                   ***** **  *. ***:.:*.::. * * :: ::*  *.       .  . . . *:**:

KLLA0D01595g       RPGLKEFFEAVSPHFEMHIYTMATRSYAHEIAKIIDPTGELFGDRILSRDENGSLTTKSL
SAKL0D01496g       RPGLKEFFEKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSITHKSL
KLTH0C03894g       RPGLQEFFDKIAPHFELHIYTMATRAYALEIAKIIDPKGELFGDRILSRDENGSLTHKSL
Kwal_27.10263      RPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSALFGDRILSRDENGSLTHKSL
ABL127W            RPGLKEFFAKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSLTQKSL
Ecym_4610          RPGLQDFFSNIAPHFELHIYTMATRTYALEIAKIIDPDGTLFGDRILSRDENGSLTQKSL
KNAG0J00280        RPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLTHKSL
Suva_13.465        RPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILSRDENGSLTTKSL
Skud_13.449        RPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDPTGELFGDRILSRDENGSLTTKSL
Smik_13.490        RPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGKLFGDRILSRDENGSLTTKSL
YMR277W            RPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILSRDENGSLTTKSL
Kpol_1068.9        RPGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTLFADRILSRNENGSLTHKSL
TPHA0I00240        RPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSRDENGSLTHKSL
KAFR0B03910        RPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGELFGNRILSRDENGSLTSKSL
NDAI0K00420        RPGLKDFFQKVAPLFEMHIYTMATRAYASEIAKIIDPTGDLFGNRILSRDENGSLTTKSL
NCAS0C00420        RPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPNGDLFGDRILSRDENGSMTTKSL
TBLA0D03260        RPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGSLFGSRILSRDENGSLTQKSL
CAGL0M02959g       RPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLTQKSL
ZYRO0G14168g       RPGLREFFAQLAPLYEMHIYTMATRTYALEIAKIIDPDGSLFGDRILSRDENGSLTQKSL
TDEL0B00580        RPGLKEFFDKVAPLFEMHIYTMATRAYALEIAKIIDPDGSLFGDRILSRDENGSITQKSL
                   ****.:*:  ::  :*:********:** :*:**:**   **..*****:****:* ***

KLLA0D01595g       ERLFPMDQSMVVVIDDRGDVWNWFENLIKVVPYSFFVGIGDINSNFLPRQQNSVLHLGRH
SAKL0D01496g       ERLFPMDQSMVVIIDDRGDVWNWCENLIKVVPYSFFVGVGDINSNFLPRQQNSMLHLGRR
KLTH0C03894g       ERLFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHLGRR
Kwal_27.10263      ERLFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHMGRR
ABL127W            ERLFPMDQSMVVVIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPIQQNSMLHLGRR
Ecym_4610          ERLFPMDQSMVVIIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPRQQNSMLHLGRR
KNAG0J00280        ERLFPTDQSMVTVIDDRGDVWNWCANLIKVVPYNFFVGVGDINSNFLPKQQPTMLQMGRR
Suva_13.465        AKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQSTGMLQLGRK
Skud_13.449        AKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQSTGMLQLGRK
Smik_13.490        AKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQSTGMLQLGRK
YMR277W            AKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQSTGMLQLGRK
Kpol_1068.9        ERLFPTDQSMVVVIDDRGDVWNWCPNLIKVTPYNFFVGIGDINSNFLPRQQTTMLQLGRR
TPHA0I00240        ERLFPTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPRQQATMLQMGRR
KAFR0B03910        ERLFPTDQSMVIIIDDRGDVWNWSPNLIKVVPYSFFVGVGDINSNFLPKQQTTMLQLGRR
NDAI0K00420        ERLFPTDQSMVIIIDDRGDVWNWSPNLIKVIPYNFFVGVGDINSNFLPKQQATMLQLGRR
NCAS0C00420        ERLFPTDQSMVIVIDDRGDVWNWSPNLIKVVPYNFFVGVGDINSNFLPKQQATMLQLGRR
TBLA0D03260        ERLFPTDQSMVIIIDDRGDVWNWCNNLIKVIPYNFFVGIGDINSNFLPRQQSTMLQLGIR
CAGL0M02959g       TRLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQQTTMLQLGRR
ZYRO0G14168g       ERLFPTDQSMVIVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQSGLLQLGRR
TDEL0B00580        ERLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQNTMLQLGRG
                    .*** ***** :********.*  ***** **.****:********* *.  :*::*  

KLLA0D01595g       -----HR--RKQ-----------------------EEEKLISDIIDNEKKLKEKIDEEVK
SAKL0D01496g       -----HR--KKA-----------------------EEEELLTDILDTEKKLQEKIDEEVK
KLTH0C03894g       -----NR--KKA-----------------------EEEELLTDIMDTEKKLQEKIDQEVK
Kwal_27.10263      -----HR--KKA-----------------------EEEELLTDIMDTEKKLQEKIDQEVK
ABL127W            -----NR--KKPK----------------------QEEELLTDILDTEKKLKEKINEEVK
Ecym_4610          -----NR--KKLK----------------------QDEELLTDILDTEKKLKVKISEEVK
KNAG0J00280        -----SKLNERGHESKQQQDDV-------------KDDLLLTDIMNTEKQLQEKIDQEVK
Suva_13.465        -----TR--QKSQ----------------------ESQELITDIMDNEKKLQEKIDIEVK
Skud_13.449        -----TR--QKSQ----------------------ESQELLTDIMDNEKKLQEKIDKEVK
Smik_13.490        -----TR--QKSQ----------------------ESQELLTDIMDNEKKLQEKIDKEVK
YMR277W            -----TR--QKSQ----------------------ESQELLTDIMDNEKKLQEKIDKEVK
Kpol_1068.9        -----NH--KKTE----------------------DTDELLTDIMDTEKKLQEKIDEEVK
TPHA0I00240        -----NHNAEKEK----------------------ESEELLTDIIDTEKKLQEKIDKEVK
KAFR0B03910        -----SR--EKAK----------------------EADELLTDIMDTEKKLQEKIDEEVK
NDAI0K00420        SSRGESK--VSTK----------------------ENDDLLTDIMDTEKVLQRKINEEVK
NCAS0C00420        -----SR--EKSK----------------------DTEDLLIDIMDSEKKLKEKIDQEVK
TBLA0D03260        -----SH--KKKNTNETLNSEDDKSDSTLSVHEKDKTEELLTDIMDTEKKLQKKIDEEVR
CAGL0M02959g       -----TR--QKIK----------------------ESEELLTDIMDTEKKLQEKIDEEVK
ZYRO0G14168g       -----TH--KKPQ----------------------ESDELLTDIMDTEKRLQEKIDEEVK
TDEL0B00580        -----AR--KKTQ----------------------ESDELITDIMDTEKKLQEKIDEEVK
                         .                            . : *: **::.** *: **. **.

KLLA0D01595g       RQEEII--SHIGDDNTRKEGGPPNKEDISKKLEHSASLEVQQQNRPLAELQKHLHNQTLL
SAKL0D01496g       RQEEKL--SKMTEEKQ--PEDTNSKEDLAKKLEHSASLEVQQQNRPLAELQKHLHNQKLL
KLTH0C03894g       KQEEKF--NKINEENQ--PERPISKEDLTKKLEHNASLEVQQQNRPLAELQKHMNNQKLL
Kwal_27.10263      KQEEKF--NKISEENQ--PDRSMSKEDLTKKLEHNASLEVQQQNRPLAELQKHMNNQKLL
ABL127W            RQEDQM--HRLTDEKL--PDTR----DIAKKLEHNASLEVQQQNRPLAELQKHMRNERLL
Ecym_4610          RQEEEM--QKLSEEKI--PDHTTSKEDIAKKLEHNASLEVQQQNRPLAELQKHLHNERLL
KNAG0J00280        RQEHKLNKGNAAGDEQ--QTPGQSKEEWTKKLEFSASVEVQQKNRPLATLQKHLHNQKLL
Suva_13.465        RQEEQL-NHQLATAEE--PSANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLL
Skud_13.449        RQEEKL-NHQLATAEE--PSANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLL
Smik_13.490        RQEEKL-NHQLATAEE--PPANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLL
YMR277W            RQEEKL-NHQLATAEE--PPANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLL
Kpol_1068.9        RQEENLSHQSAALGEE--ISSQVRKEDITKKIEFSASLEVQQQNRPLAELQKHMHNQQLL
TPHA0I00240        RQEADLTHKSAALGEE--AVAQVRNGDITKKIEFSASLEVQQQNRPLAELQKHMHNQQLL
KAFR0B03910        RQEKNL-SHQVVPTEE--SVSNETKEEWTKKLEHSASVEVQQQNRPLAALQEHLHNQRLL
NDAI0K00420        RQEEKL-NHQLATIEEPPTTAGENKEEISKKIEYSASLEVQQKNRPLATLQKHFHDQRLL
NCAS0C00420        RQEEEL-SHQSATTEEPPTSAGENKEEISKKIEYSASLEVQQQNRPLAALQKHFHDQRLL
TBLA0D03260        RQEKKLIKDEMPKRKS--ISDESSNNELSKKIEFSASLEVQQQNRPLATLQRHRQNQRLL
CAGL0M02959g       RQEEKL-NHQMATAEE--STDQESKEKIAKKLEFSASLEVQQQNRPLAKLQKHLHDQRLL
ZYRO0G14168g       RQEEKL-SHQLTTNDE--PVQGESKEQLTKKLEYSASLEVQQQNRPLATLQKHMHNQRLL
TDEL0B00580        RQEEKL-NHQMASGEE--VPAPESKDQLAKKLEYSASLEVQQQNRPLATLQKHMHNQRLL
                   .**  :        .           . :**:*..**:****:***** ** * .:: **

KLLA0D01595g       IDDDDELPHLSQILLRVHKEYFNQYTEAPK----NPPDIKYLLPQMKYKVFQGCHFVFSG
SAKL0D01496g       IDDDDELPHLSRILLQVHGKYYEDLSKHSS-----PPNIKNLMPQLKKRVFCKCSFVFSG
KLTH0C03894g       TDDDDELPHLSNILLNVHKTYYDKLAEQGQ-----PPDIKTLMPQMKSQVFKRCHFVFSG
Kwal_27.10263      IDDDDELPHLSEILLNVHRTYYEELAKTEV-----FPDIKLLMPQMKAKVFAQCHFVFSG
ABL127W            FDDDDELPHLGNILLKVHSAYYDQLQRYNS-GEDPIPDIKILMPKLKETVFEGCRFVFSG
Ecym_4610          IDDDDELPHLTDILLRVHSAYYDQLEKNKHGATELSPDIKHLIPSLKEIVFKGCNFVFSG
KNAG0J00280        VDNDDELFYLKDRLADLHKRYYSTLKENPQ-----DTNIQSIMTQLKTRVFQDCHFVFSG
Suva_13.465        VDDDDELHYLMSTLLNIHKTYYQMLSQPGE----IEPNLMEIIPSLKQKVFQNCYFVFSG
Skud_13.449        VDDDDELYYLMGTLSNIHNTYYQMISQSNE----PEPNLMEIIPSLKQKVFQNCHFVFSG
Smik_13.490        VDDDDELYYLMGTLSNIHMTYYQMLSQENE----PEPNLMEIIPSLKQKVFQNCFFVFSG
YMR277W            VDDDDELYYLMGTLSNIHKTYYDMLSQQNE----PEPNLMEIIPSLKQKVFQNCYFVFSG
Kpol_1068.9        TDDDDELFYLKDILKNVQQKYYEELKTDKE------IQIQTLMPKLKKKVLEGCNFVFSG
TPHA0I00240        RDDDDELSYLKEILATVQSEFYKALELKNG--NSDDTSIQELMPKLKRSVFKDCNFVFSG
KAFR0B03910        IDDDDELYFLKDTLAKVHNEYYSILENKSL--DESGADIKLIMPKLKQSVFEGCHFVFSG
NDAI0K00420        IDDDEELYHLKDTLSKIHSKYYEMLQKANENKDSIEPDIKYIMPQMKQTVLQDCHFVFSG
NCAS0C00420        IDDDDELYHLKDTLVRIHDKYYNVLKKDGE----LKADIKLIMPAMKQNVLDNCRFVFSG
TBLA0D03260        IDDDDELFYLKDILTEVHDTFYEQLDEDKN----ESVSIQTLMPRLKFSVFSGYNFVFSG
CAGL0M02959g       IDDDDELFYLKDTLAYIHKEFYHLLEDASD---QNEADITMLLPKLKKKVFKECHFVFSG
ZYRO0G14168g       VDDDDELYYLKDTLAKIHRKYYKLLDEGNE----NSADIQSLVPTMKGQVFKDCYFVFSG
TDEL0B00580        VDDDDELNYLREILAKVHDEYYKTLGQDSE----KKADIKTLLPLMKSKVFEDCHFVFSG
                    *:*:** .*   *  ::  ::               .:  ::. :*  *:    *****

KLLA0D01595g       LIPLETDVRKADIVLWTDMFGATTSSDINYKTTHIITTTSRTFKARLAKSFNPDIKIVHP
SAKL0D01496g       LIPLGTDVRKADIALWTSMFGAKTTADIDEATTHIITKTPGTFKARLAKAFNPEIKVVHP
KLTH0C03894g       LIPLGTNVRQADIVLWTSMFGATTSVDVDEATTHVITKTPGTFKARLAKTYNPNIKVIHP
Kwal_27.10263      LIPLGTNIRHADIVLWTNMFGAQTSSDIDENTTHVITKTPGTFKARLAKSYNPDIKIVHP
ABL127W            LIPLHTNIERADIVLWTNMFGASTTANLDYNTTHLITRTPGTMKARLAKSFNPAIKIVHP
Ecym_4610          LIPLHTNIDRADIVLWTNTFGAKTTINIDYNTTHLITKTPGTMKARLASSFNRDIKIVHP
KNAG0J00280        LIPLNTNVQAADIVIWTNKFGATTTNDLDETTTHLITKTPGTNKARLAKAFNPDIKIVHP
Suva_13.465        LIPLGTDIQRSDIVIWTSTFGATSTSDINYLTTHLITKNPGTYKARLAKKFNPEIKVVHP
Skud_13.449        LIPLGTDIQRSDIVIWTSTFGATSTSDIDYLTTHLITKNPSTYKARLAKKFNPEIKIIHP
Smik_13.490        LIPLGTDIQRSDIVIWTSTFGATSTSDIDFLTTHLITKNPSTYKARLAKKFNPEIKIVHP
YMR277W            LIPLGTDIQRSDIVIWTSTFGATSTPDIDYLTTHLITKNPSTYKARLAKKFNPQIKIVHP
Kpol_1068.9        LIPLGTNIQKADIVLWTNMFGAQSSADITEDTTHVITKTPHTYKAKIAKAFKSDIKVLHP
TPHA0I00240        LIPLGTDIQKADIVLWTKMFGASSTSNITENTTHVITKTPGTLKARIAKSFNPSIKVVHP
KAFR0B03910        LIPLHTDIRRADIVVWTSMFGAESSSEINEVTTHVITKTPGTFKARLAKSFNSDIKIVHP
NDAI0K00420        LIPLGTNIQKSDIVIWTNMFGARSTADIDENTTHVITKTPGTYKARLAKSYDPDIKIVHP
NCAS0C00420        LIPLGTDIQRADIVIWTNTFGAISTSDIDEKTTHVITKTPGTYKARLAKSFNPKIKILHP
TBLA0D03260        LIPLGTDIRRADIVLWTNMFGANSTADIDENTTHVITKTAGTYKARLAKAFNPEIKVVHP
CAGL0M02959g       LIPLGTDIKRADIVIWTSLFGAESTSDIDEHTTHVVTKTPGTYKARLAKAFNPDIKVVHP
ZYRO0G14168g       LIPLGTNIRRADIVLWTGMFGAITSSEIDENTTHVITKTPGTYKARIAKGFNENVKVVHP
TDEL0B00580        LIPLGTNINRADIVLWTNMFGAQSSPEIDDSTTHVITRTPGTYKARIAKAFNENIKVVHP
                   **** *::  :**.:**  *** :: ::   ***::* .. * **.:*. :.  :*::**

KLLA0D01595g       DWLFECLVQWERVKESPYELLIQDPVDEDKVKEFKEKLDKKISNPSSSVNPFEDGNEDEE
SAKL0D01496g       DWIFECLVNWKRVDEKAYELLIEQPVSEEELDDFKKKLENEKKDAQIQEEVDRVS-----
KLTH0C03894g       DWIFECLVKWVRVNEKPYELTTEQDVSPEELEEFKKRLDKKKQSEKALSESIQQEA----
Kwal_27.10263      DWIFECLVKWVRADEKPYELIIEQEVSSDELEEFQRNLKKRQMAEKAARESLQQET----
ABL127W            DWIFECLVGWERVEESPYELIVEEPVGEEYLENFKRDLAEAQKKVDPPAQDS--------
Ecym_4610          DWIFECIVNWKRVDEKPYELIVEEPVSKEYLENFKKELEETEKSKNSVDANISSQKYETF
KNAG0J00280        DWIFECLIKWERVDVKPYLLIVEDPVSEAQVREFKEKLTRQKERAERQTSRTALLPANKP
Suva_13.465        DWIFECLVNWKKVDEKPYTLIVDSPISDDELQSFQKQLQKKQEYLDEHHEQQHMLMP---
Skud_13.449        DWIFECLVNWKKVDEKPYTLIVDSPISDEELQNFQKQLQKRQEYLEENQQQQHMLTP---
Smik_13.490        DWIFECLVNWKKVDEKPYTLIVDSPISDEELQNFQSQLQKRQEYLEENQEQQHMLTS---
YMR277W            DWIFECLVNWKKVDEKPYTLIVDSPISDEELQNFQTQLQKRQEYLEETQEQQHMLTS---
Kpol_1068.9        DWVFECLLNWKYMPEFPYEYNIIPTATDKELNEFKEALERRKKKETKTKITVSEESLEGD
TPHA0I00240        DWVFECLSTWKHVDEKSFELKVDQVASERELEEFKKNLEKRNKNKLTDAVNFSGDLNNGT
KAFR0B03910        DWVFECLIRWTHVDEKPYTLIVEEPISDRELKKFREDLNNRKLTERNNEQNSGDITGTIV
NDAI0K00420        DWVFECLMRWKHVEEKPYELLVEQLVSDKELADFNRKLERRIQLSELKDEGLYNKLPDGN
NCAS0C00420        DWVFECLTSWKHVDEKPYELIVEQPVSETELEEFKKKLAKRQLLATANENLSPANGTN--
TBLA0D03260        DWIFECLVSWKRMPEKPYELIIEQPASEEELEEFKKKLELKNELLEKREMETEAQFEALN
CAGL0M02959g       DWIFECLASWKRIDEKPYLLIVEQPVSEDELIEFKKKLEQKKKKLEELEIEEEEELNERA
ZYRO0G14168g       DWVFECLVTWTHVDEKPYELIIQDPATEEEIQDFKRKIEQRHLIEEQRREQFESEALMKT
TDEL0B00580        DWVFECLVSWKHVDEKPYELIVEQTATDEELGDYKQKLARRSSALAEQEMELAMESAK--
                   **:***:  *      .:            : .:.  :                      

KLLA0D01595g       VL-----GDEFHLLAGNDSWLDNDDDEMDELLNDEDDDAQNDEENEGD------------
SAKL0D01496g       -------SDEINLLAGNDSWLDNDDDEMDEFLNDDDEDDEKEVSN---------------
KLTH0C03894g       -------TQELNLLTGNDLWLDNDDDEMDEFLNDEDANDDNEDGGEDL------------
Kwal_27.10263      -------GEELNLLAGNDMWLDNDDDEMDEFLNDENGNDEEEDDDEED------------
ABL127W            -------RSSLLLLDGNGSWLDYDDDEMDEFLNEESDNEEDTEQMAPA------------
Ecym_4610          -------NDAMILLGGSDSWLDNDDE-MDEFLNDSDSEDHRNEGENGG------------
KNAG0J00280        A------EPDIDLFAGGISWLNDEDD--EEIPKEDEESEDDEDENDEN------------
Suva_13.465        -------QENINLFAAGTSWLNDDDD--EDIPDTASDDDDDNDDNSES------------
Skud_13.449        -------QENLNLFAAGTSWLNNDDD--EDIPDTASDEDEDDDHNDES------------
Smik_13.490        -------QENLNLFATGTSWLNNDDD--DDIPDTASDDDEDDEHNDES------------
YMR277W            -------QENLNLFAAGTSWLNNDDD--EDIPDTASDDDEDDDHDDES------------
Kpol_1068.9        SNSPSSQGASVDLFASGASWLIDDDD--DEIIDSEEEESKEPEYDEFA------------
TPHA0I00240        ATMSST-DNVVDLFAGGSSWLVDDEL--EDVLDSEDDNEDDSDEDEDE------------
KAFR0B03910        ENF----DNTVDLFATGTSWLNDEDE--DEIPSSDEDDESSSDEEEIK------------
NDAI0K00420        ID-----INEVNLFAGGTSWLDEDE---EIFEGDDDDDDDDDDDDDDD------------
NCAS0C00420        -------SAELELFSGGMSWLDDDEG--DILDSDEEEEEDAEEEDEEQ------------
TBLA0D03260        TR-----DPAIDLFASGTSWLNDDD---DDIPISDSDSSIESDTEKNE------------
CAGL0M02959g       NQM----EPTMPLFGGDTSWLNDDED--EVEFGSDDDNSDEDSLISED------------
ZYRO0G14168g       AQ-----DSTLNLFAGGTSWLNDEDE--EISEDEEDDNDDEEEEEEEDVADGGYGANDIP
TDEL0B00580        -------NGTINLFAGGTSWLNDDDD--DEMPDGLDDSDDEDDDDEQE------------
                             . *:  .  **  ::   :      . .                      

KLLA0D01595g       --------------EETDEDERPSVKRR------------------KTQLDDTKDFNHSE
SAKL0D01496g       ----------------------------------------------KRTLPDGEESENKR
KLTH0C03894g       ---------DEQQEYRSPSSDSSESSTRDVHTTGLSSDSASEHNGGEPENAELDAQHQAT
Kwal_27.10263      -----------SDGKDDEKSFAAGNEEQDRDLEKYSREASHEGITYSPELDSNSREEPEV
ABL127W            ------------SKAPRPNGFPSGGERPAAVQSQDKPELPEKESNGKRPYQPDDAVSASK
Ecym_4610          ---------------DKSTTNSHESVNNIQHNKLTENLKNQHIQQNQKPLSRTVMETKDK
KNAG0J00280        ------------NTTMLDDGEPETGGTPD-----------------KRSLFENPDQPAEK
Suva_13.465        -----------------DDERDSGDIDR------------------KRSIEDGQDEAPQK
Skud_13.449        -----------------NNENNPTGIDR------------------KRSIEDNHNDASQK
Smik_13.490        -----------------DEENHPEGIDR------------------KRSIEDNHEDTSQK
YMR277W            -----------------DDENNSEGIDR------------------KRSIEDNHDDTSQK
Kpol_1068.9        -----------------DDNNDLQTVKKHPLESNEFTDEDGSNKKVHIAEEDEGQNEGQD
TPHA0I00240        ------------------YDEFADVISK------------------REEKKRSGEALEES
KAFR0B03910        ------------------ENDSGTGLPK------------------RRVSEDSAAEELLS
NDAI0K00420        -----------------EDEDEDNEGTKTSTS--------------EKPMDDSTAEKDAK
NCAS0C00420        -----------------EDGEGQNNKEENMTNGKNTRGP-------TKRLHSDYNEEAIE
TBLA0D03260        ------------------EDYEPNLSDG------------------KRSFKEESTDQMRN
CAGL0M02959g       ---------TDNGLAANGNSSESSITNKVPEATEDVLNNPSDTQNEEDQIPNGNGNHLPK
ZYRO0G14168g       DGGNEDNRNKENDSDRAPTNQQDQQDQKQDQGGEKPQEQTKDPESLKRALQNSDSQSSED
TDEL0B00580        ---------------EEKTEDQNQVVDGHTSQP-------------KRSLENDHDSLGDS
                                                                               

KLLA0D01595g       IPETDGQAEN--HGVDQSSSEPDE----DLE-DDLEAELLLELEG-----------
SAKL0D01496g       VHLDDKESHD------------------DYD-DDLEAELLQELES-----------
KLTH0C03894g       KRSFEPAEAETPPKRRNLNARDPAN---ENDDEDLEAELLLELEG-----------
Kwal_27.10263      NTNKRPIPPSVSETPKKRRQTDIEDV--NDD-DDLEAELLLELEG-----------
ABL127W            VKLQRTDAFS----------EEAE----EEDEDDLEAELLLELGQ-----------
Ecym_4610          RPLDEHVGSDEAPKVKRQHISESSIDW-EEE-DDLEAELLHELEQ-----------
KNAG0J00280        KPRIQDAEPS-------------S----ESD-SELEDELLNVLDD-----------
Suva_13.465        KTKAEHSQED-GPAQHEEEGENNE----DSD-SQLEEELMGMLDG-----------
Skud_13.449        KTKAEPPQDG-PVQHNEEEEENNE----DSD-SQLEEELMDMLDG-----------
Smik_13.490        KTKAEPLQDG--PVQQKREGDDNE----DSD-SQLEEELMDMLDG-----------
YMR277W            KTKAEPSQDG--PVQHKGEGDDNE----DSD-SQLEEELMDMLDD-----------
Kpol_1068.9        EGQDDQLSED------KTSQPKDE----ESD-SELEEEILNALDDSDDDEE-----
TPHA0I00240        NNKKQHLQDD------ADAASAKS----ESE-SDLDLELLNALDDSDSE-------
KAFR0B03910        HKKIHLQNDK------EEDDEEEE----DSE-SGLEDELMNVLDD-----------
NDAI0K00420        KNTKEAPSEG------ASDDGDDD----ESG-SEFEEELLNMLDD-----------
NCAS0C00420        AKKVRPSKEE-----------EEE----ESD-SDLEDELMNMLDS-----------
TBLA0D03260        NKKLKILDES------ESEVKKNE----EQEDTDLEEELLNALDDFDDDDEGDKNN
CAGL0M02959g       RPIDDVSENAHEMASKKQLTSKDDDRSSDVE-SDFEEDLLNALDD-----------
ZYRO0G14168g       QPSQKKVHLE------NSKGNRED----DSE-SDLEEELLNALDA-----------
TDEL0B00580        SPYKKSHVDE---------LKQDN----DSD-SEIEEELLNALDE-----------
                                               :     :: :::  *             

FASTA FORMAT for MUSCLE Version 3.6

>KLLA0D01595g
--MSLETN--VKVTSDLPYPITVAQLYVKPGDHVEKGQRLFAYEYWDFQDVLVK---YE-
--------------------------------------------------EKTKKQRVDR
VATFDSPVSGTVKEWHCSVKDEFASANHEVITIRQDCNHDITYGGLCVQCGNTVDEEDNS
K----------NLTISHVNTNIKVSEQQAETLERSSLTRLREEKKLVLVVDLDQTVIHCG
VDPTIGEWMRDPKNPNYKALQDVKSFTLEDEPIIPSFYFG-----PK-PPARKSWYYVKL
RPGLKEFFEAVSPHFEMHIYTMATRSYAHEIAKIIDPTGELFGDRILSRDENGSLTTKSL
ERLFPMDQSMVVVIDDRGDVWNWFENLIKVVPYSFFVGIGDINSNFLPRQQNSVLHLGRH
-----HR--RKQ-----------------------EEEKLISDIIDNEKKLKEKIDEEVK
RQEEII--SHIGDDNTRKEGGPPNKEDISKKLEHSASLEVQQQNRPLAELQKHLHNQTLL
IDDDDELPHLSQILLRVHKEYFNQYTEAPK----NPPDIKYLLPQMKYKVFQGCHFVFSG
LIPLETDVRKADIVLWTDMFGATTSSDINYKTTHIITTTSRTFKARLAKSFNPDIKIVHP
DWLFECLVQWERVKESPYELLIQDPVDEDKVKEFKEKLDKKISNPSSSVNPFEDGNEDEE
VL-----GDEFHLLAGNDSWLDNDDDEMDELLNDEDDDAQNDEENEGD------------
--------------EETDEDERPSVKRR------------------KTQLDDTKDFNHSE
IPETDGQAEN--HGVDQSSSEPDE----DLE-DDLEAELLLELEG-----------
>SAKL0D01496g
----MTTA--LKLPDNLPYPITIAQLCASTGDPIKKGQRLFAYKYWEFQDVVTS---PN-
-----DTS------------------------------------------TKPKKQRVDL
IGTFDSPVEGALVSFNLSLGDEFVNSNHVVAEIKQACTHDVTYGGLCVICGKSVEEYSSN
SA---SDPSQNKLTMSHTNTNIKISERQAAAIEETAQKQLRKLKKLVLVVDLDQTVIHCG
VDPTIGEWSRDPKNPNYEALKDIKSFALVEEPILPPFYMG-----PK-PPARKCWYYVKL
RPGLKEFFEKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSITHKSL
ERLFPMDQSMVVIIDDRGDVWNWCENLIKVVPYSFFVGVGDINSNFLPRQQNSMLHLGRR
-----HR--KKA-----------------------EEEELLTDILDTEKKLQEKIDEEVK
RQEEKL--SKMTEEKQ--PEDTNSKEDLAKKLEHSASLEVQQQNRPLAELQKHLHNQKLL
IDDDDELPHLSRILLQVHGKYYEDLSKHSS-----PPNIKNLMPQLKKRVFCKCSFVFSG
LIPLGTDVRKADIALWTSMFGAKTTADIDEATTHIITKTPGTFKARLAKAFNPEIKVVHP
DWIFECLVNWKRVDEKAYELLIEQPVSEEELDDFKKKLENEKKDAQIQEEVDRVS-----
-------SDEINLLAGNDSWLDNDDDEMDEFLNDDDEDDEKEVSN---------------
----------------------------------------------KRTLPDGEESENKR
VHLDDKESHD------------------DYD-DDLEAELLQELES-----------
>KLTH0C03894g
----MTTP--IRLPSNLPFPVTIAKLCVSTGDSVKKGQRLFVYKYWELQDIITA---PN-
-----EE-------------------------------------------APKKKRRVDL
IGTFDSPVEGTLVSLNIGLGDEFVNDANVIAEVNQLCSHEVTYGGLCVVCGKTVEEDDQN
VS--DNGISNSKLTVAHNNTNIKVSERQAATIEKTAQKHLREHKKLVLVVDLDQTVIHCG
VDPTIHEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMG-----PR-PPPRKCQYYVKL
RPGLQEFFDKIAPHFELHIYTMATRAYALEIAKIIDPKGELFGDRILSRDENGSLTHKSL
ERLFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHLGRR
-----NR--KKA-----------------------EEEELLTDIMDTEKKLQEKIDQEVK
KQEEKF--NKINEENQ--PERPISKEDLTKKLEHNASLEVQQQNRPLAELQKHMNNQKLL
TDDDDELPHLSNILLNVHKTYYDKLAEQGQ-----PPDIKTLMPQMKSQVFKRCHFVFSG
LIPLGTNVRQADIVLWTSMFGATTSVDVDEATTHVITKTPGTFKARLAKTYNPNIKVIHP
DWIFECLVKWVRVNEKPYELTTEQDVSPEELEEFKKRLDKKKQSEKALSESIQQEA----
-------TQELNLLTGNDLWLDNDDDEMDEFLNDEDANDDNEDGGEDL------------
---------DEQQEYRSPSSDSSESSTRDVHTTGLSSDSASEHNGGEPENAELDAQHQAT
KRSFEPAEAETPPKRRNLNARDPAN---ENDDEDLEAELLLELEG-----------
>Kwal_27.10263
----MTTP--IRLPPNLPFPITIAKLYVSKGESVTKGQRLFVYKYWELQDVITA---PN-
-----EE-------------------------------------------ASKKKRRVDL
IGTFDSPIEGTLVSLKVRVGDEFVNDSNIIAELRQPCSHEVTYGALCVVCGKAVDEDDSN
MS--GSGVSNGKLTVAHNNTNIKVSERQAASIEKTAQKELRERKKLVLVVDLDQTVIHCG
VDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMG-----PR-PPPRRCQYYVKL
RPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSALFGDRILSRDENGSLTHKSL
ERLFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHMGRR
-----HR--KKA-----------------------EEEELLTDIMDTEKKLQEKIDQEVK
KQEEKF--NKISEENQ--PDRSMSKEDLTKKLEHNASLEVQQQNRPLAELQKHMNNQKLL
IDDDDELPHLSEILLNVHRTYYEELAKTEV-----FPDIKLLMPQMKAKVFAQCHFVFSG
LIPLGTNIRHADIVLWTNMFGAQTSSDIDENTTHVITKTPGTFKARLAKSYNPDIKIVHP
DWIFECLVKWVRADEKPYELIIEQEVSSDELEEFQRNLKKRQMAEKAARESLQQET----
-------GEELNLLAGNDMWLDNDDDEMDEFLNDENGNDEEEDDDEED------------
-----------SDGKDDEKSFAAGNEEQDRDLEKYSREASHEGITYSPELDSNSREEPEV
NTNKRPIPPSVSETPKKRRQTDIEDV--NDD-DDLEAELLLELEG-----------
>ABL127W
----MSTP--IRLPDSLPYPITIAQLGVSTGDTVEKGQRLLAYKYWDLVDVITA---PG-
-----EEEA-----------------------------------------GKARKQRVDL
VGTFDSPVAGTVVSLDVRVGDEFVNSQRPVVEIRQACPHDVTYGGLCVQCGQAVEDEAGA
AD----GVEQAKLTVSHTNTHIRVSERQAASLGQSAQLKLREARKLVLVVDLDQTVIHCG
VDPTIGEWSKDPNNPNYEALKDVQSFSLDEEPVLPPFYMG-----PK-PPTRKCWYYVKL
RPGLKEFFAKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSLTQKSL
ERLFPMDQSMVVVIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPIQQNSMLHLGRR
-----NR--KKPK----------------------QEEELLTDILDTEKKLKEKINEEVK
RQEDQM--HRLTDEKL--PDTR----DIAKKLEHNASLEVQQQNRPLAELQKHMRNERLL
FDDDDELPHLGNILLKVHSAYYDQLQRYNS-GEDPIPDIKILMPKLKETVFEGCRFVFSG
LIPLHTNIERADIVLWTNMFGASTTANLDYNTTHLITRTPGTMKARLAKSFNPAIKIVHP
DWIFECLVGWERVEESPYELIVEEPVGEEYLENFKRDLAEAQKKVDPPAQDS--------
-------RSSLLLLDGNGSWLDYDDDEMDEFLNEESDNEEDTEQMAPA------------
------------SKAPRPNGFPSGGERPAAVQSQDKPELPEKESNGKRPYQPDDAVSASK
VKLQRTDAFS----------EEAE----EEDEDDLEAELLLELGQ-----------
>Ecym_4610
----MSTP--IRLPDNLPYPITVAQLAVSAGDMVERGQRLFAYKYWDFEQIVTS---PG-
-----DESAG----------------------------------------GKSKRQRIDL
VGTFDSPVSGQVVSLNITLGDEFVNSQCTVAEIKQPCTHDVTYGGLCVQCGQTVEDEQTS
GS---LLDNQAKLTMSHTNMNIRISEKQAYTLEKSAQKQLREARKLVLVVDLDQTVIHCG
VDPTIGEWSKDPDNPNYESLKDVRSFSLHEEPVLPPFYMG-----PK-PPTRKCWYYVKL
RPGLQDFFSNIAPHFELHIYTMATRTYALEIAKIIDPDGTLFGDRILSRDENGSLTQKSL
ERLFPMDQSMVVIIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPRQQNSMLHLGRR
-----NR--KKLK----------------------QDEELLTDILDTEKKLKVKISEEVK
RQEEEM--QKLSEEKI--PDHTTSKEDIAKKLEHNASLEVQQQNRPLAELQKHLHNERLL
IDDDDELPHLTDILLRVHSAYYDQLEKNKHGATELSPDIKHLIPSLKEIVFKGCNFVFSG
LIPLHTNIDRADIVLWTNTFGAKTTINIDYNTTHLITKTPGTMKARLASSFNRDIKIVHP
DWIFECIVNWKRVDEKPYELIVEEPVSKEYLENFKKELEETEKSKNSVDANISSQKYETF
-------NDAMILLGGSDSWLDNDDE-MDEFLNDSDSEDHRNEGENGG------------
---------------DKSTTNSHESVNNIQHNKLTENLKNQHIQQNQKPLSRTVMETKDK
RPLDEHVGSDEAPKVKRQHISESSIDW-EEE-DDLEAELLHELEQ-----------
>KNAG0J00280
MDLVAPTP--VVSGAGLPYPVTVDELIPQVGDRVSRGDRLFAYKFWYVVELAGV---DA-
-----AAEGDSD-GTG----------------------------------TTAKKSVRES
VEFFESPFEGTVVSWDVDAGDEIPGPGAPLCLLRRPCNHDVVYNGLCTLCGREVDEYEIQ
AAAAASGGVGPNLTVSHRDTNLQISRVEAQQLDLQLQQRLRAAQKLVLVVDLDQTVVHCG
VDPTIGEWKRDPRNPNYEALRDVQSFALEEEPILPFLYVG-----GKRPAPRKCWYYVKV
RPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLTHKSL
ERLFPTDQSMVTVIDDRGDVWNWCANLIKVVPYNFFVGVGDINSNFLPKQQPTMLQMGRR
-----SKLNERGHESKQQQDDV-------------KDDLLLTDIMNTEKQLQEKIDQEVK
RQEHKLNKGNAAGDEQ--QTPGQSKEEWTKKLEFSASVEVQQKNRPLATLQKHLHNQKLL
VDNDDELFYLKDRLADLHKRYYSTLKENPQ-----DTNIQSIMTQLKTRVFQDCHFVFSG
LIPLNTNVQAADIVIWTNKFGATTTNDLDETTTHLITKTPGTNKARLAKAFNPDIKIVHP
DWIFECLIKWERVDVKPYLLIVEDPVSEAQVREFKEKLTRQKERAERQTSRTALLPANKP
A------EPDIDLFAGGISWLNDEDD--EEIPKEDEESEDDEDENDEN------------
------------NTTMLDDGEPETGGTPD-----------------KRSLFENPDQPAEK
KPRIQDAEPS-------------S----ESD-SELEDELLNVLDD-----------
>Suva_13.465
----MTTQ--IRSPEGLPYPIQIDKLIPSVGSFLQEGDRLLVYKFWYLVERPSD-AGDD-
-----DNDHDSS-PGGGGG-GSV---------------------------SPPTKQLRES
IEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHDIVYGGLCTQCGKEVSADAFD
GV---------PLDVV-GDMDLQISETEAIRTGRALKEHLRRDKKLILVVDLDQTIIHCG
VDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAEDGSVPKPPPVRKCWYYVKV
RPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILSRDENGSLTTKSL
AKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQSTGMLQLGRK
-----TR--QKSQ----------------------ESQELITDIMDNEKKLQEKIDIEVK
RQEEQL-NHQLATAEE--PSANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLL
VDDDDELHYLMSTLLNIHKTYYQMLSQPGE----IEPNLMEIIPSLKQKVFQNCYFVFSG
LIPLGTDIQRSDIVIWTSTFGATSTSDINYLTTHLITKNPGTYKARLAKKFNPEIKVVHP
DWIFECLVNWKKVDEKPYTLIVDSPISDDELQSFQKQLQKKQEYLDEHHEQQHMLMP---
-------QENINLFAAGTSWLNDDDD--EDIPDTASDDDDDNDDNSES------------
-----------------DDERDSGDIDR------------------KRSIEDGQDEAPQK
KTKAEHSQED-GPAQHEEEGENNE----DSD-SQLEEELMGMLDG-----------
>Skud_13.449
----MTTQ--IRSPEGLPYPIQIDKLVPSVGSYLHEGDRLIVYKFWYLVERASDTTGDD-
-----DNEHDAT-PGGGAGSGSV---------------------------SPPTKQLRES
IEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHDIVYGGLCTQCGKEVSADAFD
GV---------PLDVV-GDMDLQISETEAIRSGEALKEHLRRDKKLILVVDLDQTIIHCG
VDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSVLKPPPVRKCWYYVKV
RPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDPTGELFGDRILSRDENGSLTTKSL
AKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQSTGMLQLGRK
-----TR--QKSQ----------------------ESQELLTDIMDNEKKLQEKIDKEVK
RQEEKL-NHQLATAEE--PSANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLL
VDDDDELYYLMGTLSNIHNTYYQMISQSNE----PEPNLMEIIPSLKQKVFQNCHFVFSG
LIPLGTDIQRSDIVIWTSTFGATSTSDIDYLTTHLITKNPSTYKARLAKKFNPEIKIIHP
DWIFECLVNWKKVDEKPYTLIVDSPISDEELQNFQKQLQKRQEYLEENQQQQHMLTP---
-------QENLNLFAAGTSWLNNDDD--EDIPDTASDEDEDDDHNDES------------
-----------------NNENNPTGIDR------------------KRSIEDNHNDASQK
KTKAEPPQDG-PVQHNEEEEENNE----DSD-SQLEEELMDMLDG-----------
>Smik_13.490
----MTTQ--IRSPEGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASE-TGVD-
-----DNEHDAS-PGGGAGSNGV---------------------------SPPTKQLRES
IEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDIVYGGLCTQCGKEVSADAFD
GV---------PLDVV-GDMDLQISETEAIRTGKALKEHLRRDKKLILVVDLDQTIIHCG
VDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSVLRPPPVRKCWYYVKV
RPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGKLFGDRILSRDENGSLTTKSL
AKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQSTGMLQLGRK
-----TR--QKSQ----------------------ESQELLTDIMDNEKKLQEKIDKEVK
RQEEKL-NHQLATAEE--PPANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLL
VDDDDELYYLMGTLSNIHMTYYQMLSQENE----PEPNLMEIIPSLKQKVFQNCFFVFSG
LIPLGTDIQRSDIVIWTSTFGATSTSDIDFLTTHLITKNPSTYKARLAKKFNPEIKIVHP
DWIFECLVNWKKVDEKPYTLIVDSPISDEELQNFQSQLQKRQEYLEENQEQQHMLTS---
-------QENLNLFATGTSWLNNDDD--DDIPDTASDDDEDDEHNDES------------
-----------------DEENHPEGIDR------------------KRSIEDNHEDTSQK
KTKAEPLQDG--PVQQKREGDDNE----DSD-SQLEEELMDMLDG-----------
>YMR277W
----MTTQ--IRSPQGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASD-TGDD-
-----DNEHDVS-PGGSAGSNGV---------------------------SPPTKQLRES
IEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDIVYGGLCTQCGKEVSADAFD
GV---------PLDVV-GDVDLQISETEAIRTGKALKEHLRRDKKLILVVDLDQTIIHCG
VDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNDDGSMLRPPPVRKCWYYVKV
RPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILSRDENGSLTTKSL
AKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQSTGMLQLGRK
-----TR--QKSQ----------------------ESQELLTDIMDNEKKLQEKIDKEVK
RQEEKL-NHQLATAEE--PPANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLL
VDDDDELYYLMGTLSNIHKTYYDMLSQQNE----PEPNLMEIIPSLKQKVFQNCYFVFSG
LIPLGTDIQRSDIVIWTSTFGATSTPDIDYLTTHLITKNPSTYKARLAKKFNPQIKIVHP
DWIFECLVNWKKVDEKPYTLIVDSPISDEELQNFQTQLQKRQEYLEETQEQQHMLTS---
-------QENLNLFAAGTSWLNNDDD--EDIPDTASDDDEDDDHDDES------------
-----------------DDENNSEGIDR------------------KRSIEDNHDDTSQK
KTKAEPSQDG--PVQHKGEGDDNE----DSD-SQLEEELMDMLDD-----------
>Kpol_1068.9
----MSTP--VSAPLGLPYPITISKLIASIGSHVEKGQRLFAYKFWYIVEIAKS---PD-
-----ENDDGVND-------------------------------------EHSKKSIRES
IEFFDSPFEGDLVSWNVDVGDEIVEPNQTICEIVRPCNHDIVYAGICTMCGKEVDESDQV
SA---------NLTISHTDTNLKVSRREANDIGQGIKKRLIREKKLILVVDLDQTVIHCG
VDPTIAEWKNDPTNPNFETLRDVKSFVLEEEPILPPMYMG-----PK-PPTHKCWYYVKI
RPGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTLFADRILSRNENGSLTHKSL
ERLFPTDQSMVVVIDDRGDVWNWCPNLIKVTPYNFFVGIGDINSNFLPRQQTTMLQLGRR
-----NH--KKTE----------------------DTDELLTDIMDTEKKLQEKIDEEVK
RQEENLSHQSAALGEE--ISSQVRKEDITKKIEFSASLEVQQQNRPLAELQKHMHNQQLL
TDDDDELFYLKDILKNVQQKYYEELKTDKE------IQIQTLMPKLKKKVLEGCNFVFSG
LIPLGTNIQKADIVLWTNMFGAQSSADITEDTTHVITKTPHTYKAKIAKAFKSDIKVLHP
DWVFECLLNWKYMPEFPYEYNIIPTATDKELNEFKEALERRKKKETKTKITVSEESLEGD
SNSPSSQGASVDLFASGASWLIDDDD--DEIIDSEEEESKEPEYDEFA------------
-----------------DDNNDLQTVKKHPLESNEFTDEDGSNKKVHIAEEDEGQNEGQD
EGQDDQLSED------KTSQPKDE----ESD-SELEEEILNALDDSDDDEE-----
>TPHA0I00240
----MATP--VKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKS---PD-
-----ELDVNGN-VQDG---------------------------------EQSKKTIRES
IDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIVYAGICTMCGKEVDERDQV
SA---------NLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLILVVDLDQTVIHCG
VDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMG-----PK-PPVHKCSYYVKV
RPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSRDENGSLTHKSL
ERLFPTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPRQQATMLQMGRR
-----NHNAEKEK----------------------ESEELLTDIIDTEKKLQEKIDKEVK
RQEADLTHKSAALGEE--AVAQVRNGDITKKIEFSASLEVQQQNRPLAELQKHMHNQQLL
RDDDDELSYLKEILATVQSEFYKALELKNG--NSDDTSIQELMPKLKRSVFKDCNFVFSG
LIPLGTDIQKADIVLWTKMFGASSTSNITENTTHVITKTPGTLKARIAKSFNPSIKVVHP
DWVFECLSTWKHVDEKSFELKVDQVASERELEEFKKNLEKRNKNKLTDAVNFSGDLNNGT
ATMSST-DNVVDLFAGGSSWLVDDEL--EDVLDSEDDNEDDSDEDEDE------------
------------------YDEFADVISK------------------REEKKRSGEALEES
NNKKQHLQDD------ADAASAKS----ESE-SDLDLELLNALDDSDSE-------
>KAFR0B03910
----MTTP--VLAPEGLPYPITIDELICPIGTYIEKGIRLFAYKFWYMVEIASS---PD-
-----DNDPANT-DTQA---------------------------------SHPKKKIRES
IEFFDAPFEGTLISWNIDVGDELSSASQVICEIKRPCNHDIVYGGLCTQCGKEVDESEQS
QF-------GSNFTVSHTDTNLKISRKEALDIGEDFKKRLRNEKKLVLVVDLDQTVIHCG
VDPTIGEWKSDPNNPNYDTLKDVQMFALEEEPVLPFMYMG-----PK-PTPRKCWYYVKV
RPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGELFGNRILSRDENGSLTSKSL
ERLFPTDQSMVIIIDDRGDVWNWSPNLIKVVPYSFFVGVGDINSNFLPKQQTTMLQLGRR
-----SR--EKAK----------------------EADELLTDIMDTEKKLQEKIDEEVK
RQEKNL-SHQVVPTEE--SVSNETKEEWTKKLEHSASVEVQQQNRPLAALQEHLHNQRLL
IDDDDELYFLKDTLAKVHNEYYSILENKSL--DESGADIKLIMPKLKQSVFEGCHFVFSG
LIPLHTDIRRADIVVWTSMFGAESSSEINEVTTHVITKTPGTFKARLAKSFNSDIKIVHP
DWVFECLIRWTHVDEKPYTLIVEEPISDRELKKFREDLNNRKLTERNNEQNSGDITGTIV
ENF----DNTVDLFATGTSWLNDEDE--DEIPSSDEDDESSSDEEEIK------------
------------------ENDSGTGLPK------------------RRVSEDSAAEELLS
HKKIHLQNDK------EEDDEEEE----DSE-SGLEDELMNVLDD-----------
>NDAI0K00420
----MATPTVIRAPLGLPYPITIDELMKPIGTEMNKDDRLLAYKFWYVVEIATS---PDE
LEDDNDNDNDND-PDGDVDKNTINGNNVTNLTNRPSIEPISRNTITHAHKKKKKKTVRES
IEFFDCPYDGILTSWLVEKGDQIVGPNQPLCEIQRPCNHDVIYGGLCTLCGKEVDENDID
DL------SGPNLTISHTDTNLKISTREAVDIGQSVKKRLRDDKKLILVVDLDQTVIHCG
VDPTIGEWKRDPTNPNFETLKDVKEFALEEEPILPLMYMG-----PK-PPARKCWYYVKV
RPGLKDFFQKVAPLFEMHIYTMATRAYASEIAKIIDPTGDLFGNRILSRDENGSLTTKSL
ERLFPTDQSMVIIIDDRGDVWNWSPNLIKVIPYNFFVGVGDINSNFLPKQQATMLQLGRR
SSRGESK--VSTK----------------------ENDDLLTDIMDTEKVLQRKINEEVK
RQEEKL-NHQLATIEEPPTTAGENKEEISKKIEYSASLEVQQKNRPLATLQKHFHDQRLL
IDDDEELYHLKDTLSKIHSKYYEMLQKANENKDSIEPDIKYIMPQMKQTVLQDCHFVFSG
LIPLGTNIQKSDIVIWTNMFGARSTADIDENTTHVITKTPGTYKARLAKSYDPDIKIVHP
DWVFECLMRWKHVEEKPYELLVEQLVSDKELADFNRKLERRIQLSELKDEGLYNKLPDGN
ID-----INEVNLFAGGTSWLDEDE---EIFEGDDDDDDDDDDDDDDD------------
-----------------EDEDEDNEGTKTSTS--------------EKPMDDSTAEKDAK
KNTKEAPSEG------ASDDGDDD----ESG-SEFEEELLNMLDD-----------
>NCAS0C00420
----MSTQ--ILAPIGLPYPITIDQLITHVGDEVQKGDRLLAYKFWFVVDVASS---PD-
-----DNDVSSP-PTAG------------------------------------KKSIRES
IEFFESPYKGQLISWNVDIGDEIASPNQVLAEIIRPCNHDVVYGGLCTLCGEEVDEDDND
AS-----GSGANLTISHTDTNLKISTREALDIGLNVRTRLRKEKKLVLVVDLDQTVIHCG
VDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPTLYMG-----PK-PPLRKCWYYVKV
RPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPNGDLFGDRILSRDENGSMTTKSL
ERLFPTDQSMVIVIDDRGDVWNWSPNLIKVVPYNFFVGVGDINSNFLPKQQATMLQLGRR
-----SR--EKSK----------------------DTEDLLIDIMDSEKKLKEKIDQEVK
RQEEEL-SHQSATTEEPPTSAGENKEEISKKIEYSASLEVQQQNRPLAALQKHFHDQRLL
IDDDDELYHLKDTLVRIHDKYYNVLKKDGE----LKADIKLIMPAMKQNVLDNCRFVFSG
LIPLGTDIQRADIVIWTNTFGAISTSDIDEKTTHVITKTPGTYKARLAKSFNPKIKILHP
DWVFECLTSWKHVDEKPYELIVEQPVSETELEEFKKKLAKRQLLATANENLSPANGTN--
-------SAELELFSGGMSWLDDDEG--DILDSDEEEEEDAEEEDEEQ------------
-----------------EDGEGQNNKEENMTNGKNTRGP-------TKRLHSDYNEEAIE
AKKVRPSKEE-----------EEE----ESD-SDLEDELMNMLDS-----------
>TBLA0D03260
----MSTP--VLSPADLPFPITIDQLITPIGSHVEKGQRLFAYKFWYMVEIAQS---PD-
-----NNDPTSENSSDLSGNNSDSNENGNNA-------------------SHQKKSIRES
IEFFESPFEGDLIGWNVDKGDEIISENQLLCDIKRPCNHDIVYAGICTQCGKEVDDSDIM
DA---------SLSISHTDTNLKISRKEARDIDQSSMSRLKKIKKLILVVDLDQTVIHCG
VDPTIGEWKNDPKNPNYETLKDVRSFSLDEEPILPPSYMG-----PR-PPVRKCWYYVKV
RPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGSLFGSRILSRDENGSLTQKSL
ERLFPTDQSMVIIIDDRGDVWNWCNNLIKVIPYNFFVGIGDINSNFLPRQQSTMLQLGIR
-----SH--KKKNTNETLNSEDDKSDSTLSVHEKDKTEELLTDIMDTEKKLQKKIDEEVR
RQEKKLIKDEMPKRKS--ISDESSNNELSKKIEFSASLEVQQQNRPLATLQRHRQNQRLL
IDDDDELFYLKDILTEVHDTFYEQLDEDKN----ESVSIQTLMPRLKFSVFSGYNFVFSG
LIPLGTDIRRADIVLWTNMFGANSTADIDENTTHVITKTAGTYKARLAKAFNPEIKVVHP
DWIFECLVSWKRMPEKPYELIIEQPASEEELEEFKKKLELKNELLEKREMETEAQFEALN
TR-----DPAIDLFASGTSWLNDDD---DDIPISDSDSSIESDTEKNE------------
------------------EDYEPNLSDG------------------KRSFKEESTDQMRN
NKKLKILDES------ESEVKKNE----EQEDTDLEEELLNALDDFDDDDEGDKNN
>CAGL0M02959g
----MSTP--VLTPMGLPYPITVDELMVPIGSYVEKGQRLFAYKFWYMVEIANS---PD-
-----DNDIDYE-GPEI---------------------------------EKSKRKVRES
IEFYEAPFEGDLLSWNVDEKDEIAGPNMAVCEIKRPCNHDIVYGGLCTMCGKEVDEYDQV
DA---------NLTISHTDTNLRVSRKEAIDLDKQITTRLKNEKKLVLVVDLDQTVIHCG
VDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYMG-----PK-PPVRTCWYYVKI
RPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLTQKSL
TRLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQQTTMLQLGRR
-----TR--QKIK----------------------ESEELLTDIMDTEKKLQEKIDEEVK
RQEEKL-NHQMATAEE--STDQESKEKIAKKLEFSASLEVQQQNRPLAKLQKHLHDQRLL
IDDDDELFYLKDTLAYIHKEFYHLLEDASD---QNEADITMLLPKLKKKVFKECHFVFSG
LIPLGTDIKRADIVIWTSLFGAESTSDIDEHTTHVVTKTPGTYKARLAKAFNPDIKVVHP
DWIFECLASWKRIDEKPYLLIVEQPVSEDELIEFKKKLEQKKKKLEELEIEEEEELNERA
NQM----EPTMPLFGGDTSWLNDDED--EVEFGSDDDNSDEDSLISED------------
---------TDNGLAANGNSSESSITNKVPEATEDVLNNPSDTQNEEDQIPNGNGNHLPK
RPIDDVSENAHEMASKKQLTSKDDDRSSDVE-SDFEEDLLNALDD-----------
>ZYRO0G14168g
----MATP--VIAPESLPYPITIDQLIAPIGSTVKKGQRLFAYKFWYMVEIASS---PD-
-----END---G-NGGA---------------------------------QHSKKTVRES
IEFFESPFEGDLVSWEVDRGDEVASARQVICEIMRPCNHDVVYGGLCTMCGKEVDENDQM
EA---------NLAISHTDTNLKVSRKEAEDMEHFLKQRLRQSKKLVLVVDLDQTVIHCG
VDPTIGEWKKDPSNPNYETLKDVQMFSLEEEPIVPPMYMG-----PR-LPERKCWYFVKV
RPGLREFFAQLAPLYEMHIYTMATRTYALEIAKIIDPDGSLFGDRILSRDENGSLTQKSL
ERLFPTDQSMVIVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQSGLLQLGRR
-----TH--KKPQ----------------------ESDELLTDIMDTEKRLQEKIDEEVK
RQEEKL-SHQLTTNDE--PVQGESKEQLTKKLEYSASLEVQQQNRPLATLQKHMHNQRLL
VDDDDELYYLKDTLAKIHRKYYKLLDEGNE----NSADIQSLVPTMKGQVFKDCYFVFSG
LIPLGTNIRRADIVLWTGMFGAITSSEIDENTTHVITKTPGTYKARIAKGFNENVKVVHP
DWVFECLVTWTHVDEKPYELIIQDPATEEEIQDFKRKIEQRHLIEEQRREQFESEALMKT
AQ-----DSTLNLFAGGTSWLNDEDE--EISEDEEDDNDDEEEEEEEDVADGGYGANDIP
DGGNEDNRNKENDSDRAPTNQQDQQDQKQDQGGEKPQEQTKDPESLKRALQNSDSQSSED
QPSQKKVHLE------NSKGNRED----DSE-SDLEEELLNALDA-----------
>TDEL0B00580
----MTTP--VFSPEVLPYPITIDQLIAPIGSHVEKGQRLFAFKFWYMVEIASS---PD-
-----ENEG-----------------------------------------GHRKKTVRES
IEFFEAPFEGDLMSWNVDVGDEVVAPNQAICEISRPCNHDIVYGGLCTLCGKEVDESEQF
NG---------NLAISHTDVNLKVSRKEATDIENNLKTRLRESKKLVLVVDLDQTVIHCG
VDPTIGEWKRDSSNPNYEALKDVQSFALDEEPILPLLYMG-----PK-PPVRKCWYYVKV
RPGLKEFFDKVAPLFEMHIYTMATRAYALEIAKIIDPDGSLFGDRILSRDENGSITQKSL
ERLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQNTMLQLGRG
-----AR--KKTQ----------------------ESDELITDIMDTEKKLQEKIDEEVK
RQEEKL-NHQMASGEE--VPAPESKDQLAKKLEYSASLEVQQQNRPLATLQKHMHNQRLL
VDDDDELNYLREILAKVHDEYYKTLGQDSE----KKADIKTLLPLMKSKVFEDCHFVFSG
LIPLGTNINRADIVLWTNMFGAQSSPEIDDSTTHVITRTPGTYKARIAKAFNENIKVVHP
DWVFECLVSWKHVDEKPYELIVEQTATDEELGDYKQKLARRSSALAEQEMELAMESAK--
-------NGTINLFAGGTSWLNDDDD--DEMPDGLDDSDDEDDDDEQE------------
---------------EEKTEDQNQVVDGHTSQP-------------KRSLENDHDSLGDS
SPYKKSHVDE---------LKQDN----DSD-SEIEEELLNALDE-----------