MUSCLE (3.8) multiple sequence alignment

TBLA0B03240        --MISVNIKFKEEKFTIESEL---DELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKT
KNAG0J00290        -MGITVGVKQGQNRWDVAVASEPGETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQT
TBLA0D03230        -MTISVHIKSGQNTWDVEIEA---SSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQT
KLLA0D01859g       MSQISVHVKSGQNNWTVEIES---AATIRAFKETISGVSGVPADNQRLIYSGKILKDTET
ABL129W            -MTIKIQVKSGQNRWEVSVEA---SGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQT
Ecym_4608          -MSISLHVKSGQNKWQVSADP---SSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQT
NDAI0K00440        MSTISIHIKSGQNNWQVSIDT---TASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQN
TPHA0I00220        -MSISVQIKSGQNKWDVAVEP---SNTILEFKEIISKASDIPAGNQRLIYSGKILKDAET
NCAS0C00430        -MSISIHVKSGQNNWQVSIDP---ASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQT
Kpol_1068.11       -MGIKIHIKSGQNKWEVTVDV---SNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQV
SAKL0D01540g       -MSITLHIKSGQNKWDVSIEP---TNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQT
KLTH0C03938g       -MSITVHIKSGQNKWDVAIDP---SSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQT
Kwal_27.10275      -MSITVHVKSGQSKWDVSVDA---DSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQT
Suva_13.464        -MSLNVYVKSGQDKWEVSVAP---ESTVLQFKEAISEANGIPVANQRLIYSGKILKDDQT
Skud_13.448        -MSLNIHIKSGQDKWEVAVAP---ECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQT
YMR276W            -MSLNIHIKSGQDKWEVNVAP---ESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQT
Smik_13.489        -MSLNIHIKSGQDKWEVSVAP---ESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQT
ZYRO0G14124g       MSTITVQIKSGQNKWEVTVDP---ESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQT
TDEL0B00600        -MSITVQVKCGQSKWEVSVNP---EKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQN
CAGL0M02937g       -MSITIHIKSGQNKWDVSIDP---SQTILNLKEEIAKVSEIPSGNQRLIYSGKILKDDQT
KAFR0B03900        -MSITIHIKSGQNKWDVNTNL---SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQT
                      :.: :*  :. : :          :  :.  :     :.  .****:**.**.  : 

TBLA0B03240        LKDYNFKDGHCIIVIIHK---EEKNNLHPPPNNTTNL--------NPNNSVYPASNTPIN
KNAG0J00290        LEEYKITDGHTVHLVKSG---GAKSAGSSSSSSEATT---------AAGTAGTAPAAGAS
TBLA0D03230        IESYKIQDGHSIHMVKSG------AHATASSTTNSMT--------TTNTTAPQNNNGSSG
KLLA0D01859g       VESYKIQDGHSVHMVKSG---GASAATTGSTTTGSAA-----------SPAATNSAAPSN
ABL129W            VESYKIADGHAIHLVKSG---GAKAAPAASAAGGEST-----------GAAAGAGAVPSS
Ecym_4608          VESYKIADGHSIHLVRSG---GGKVSGSSGATGGASGSVEAVGSGGRNSTAGSGSTVPNN
NDAI0K00440        VDFYNIQDGHSVHLVRSG----KKSTPTPATTNTTTN--------------ASNNTVPSN
TPHA0I00220        VESYKIQDGHSIHLVKSG---DASANAAKSSTAAAAT--------ANAAAGSAESAVPTN
NCAS0C00430        VEFYKILDGLSIHMVKSG---GGSANKNKSPPPQANT---------------TATPVAPN
Kpol_1068.11       LEFYKIQDEHSIHLVKSG---GASKTNTSASAAAAST--------STATNSDSNAPLPSN
SAKL0D01540g       VESYKIADDHAVHLVRSG---GPKPAASKSESTSATD-----------TGAAAAAAVPSN
KLTH0C03938g       VESYKILDDHSVHLVKSG---GSKKATSPGATAAASG-DATATGATSTPAAQPQQSAPAN
Kwal_27.10275      LESYKILDGHAVHLVKSGTKSGSGAIGAPGSGSTAPT----------NTASSGAAAAPAS
Suva_13.464        VESYHIQDGHSVHLVKSQ------PRPQAGAATGAGG-------DAGASATNASVSATPN
Skud_13.448        VDSYHIQDGHSVHLVKSQ------PKPDAGGATGANN--------ATATSAAVGTSATPN
YMR276W            VESYHIQDGHSVHLVKSQ------PKPQTASAAGANN--------ATATGAAAGTGATPN
Smik_13.489        VESYHIQDGHSVHLVKSQ------PKPQPGAAAGTNN--------ATATGAAAGTVATPN
ZYRO0G14124g       LQFYNLQDGHSVHLVKSSKAPGNASGGSSSTAAATAGSGASAVPPSGNASTTPTTGAPSN
TDEL0B00600        VESYKIQDGHAIHLVKSG---GGGGNTAAKASTSSQE---------SNTAAPGSATVPSN
CAGL0M02937g       VESYNIKDDHAIHMVKSG---GNASTSNAPTNANESS-------------NSSTTAVPSN
KAFR0B03900        VESYKIEEGHSIHLVKSG---GNVARNSAATNTTPTA--------TSNENTNSAPSVPSN
                   :. *:: :   : ::                                            .

TBLA0B03240        SPTPF--GEGNIITITTTSPDPY--GVRSNEVHDPEV--------------ERELLQVLD
KNAG0J00290        MAAGQQPGFNPLADLTSARYAGYNLPMPSADMFGPDGGLTSGGG-PGGPQSQEEILSMLE
TBLA0D03230        MSTGRGSGFNPLSDLTSARYAGY-TNLPSADMFGPDGGS--FAS-QS----QDDMLHMLE
KLLA0D01859g       ISAGQTGGFNPLADLTGARYAGL-ANLPSADMFGPDGGLNSSNG-AN----PESMLQMLE
ABL129W            ISAGQSGGFNPLADLTGARYAGY-TNLPSTDMFGPDGGL--NSA-VG----QEEIIGMLE
Ecym_4608          ITAGQMGGFNPLADLTGARYAGY-ANLPSTDMFGPDGGL--NSA-IG----QEEILGMLD
NDAI0K00440        ISAGQTGGFNPLADLTSARYAGYNLNLPSADAFGPDGGM--NQSGTN----PDEFLSMLD
TPHA0I00220        ITSGQTNGFNPLADLTSARYAGYNLPMPSADMFGPDGGM--TNM-PN----QDDMLSMLE
NCAS0C00430        MAAGETGGFNPLSDLTSARYAGY-LNLPSADTFGPDGGL--NNSGPN----QDEMLRMLD
Kpol_1068.11       IAAGQSGGFNPLSDLTSARYAGYGLNLPSADMFGPDGGM--NSM-PN----QDDMLRMLE
SAKL0D01540g       ISSGQTGGFNPLADLTGARYAGY-ANLPSADMFGPDGGL--TNA-PN----SDEILNMLD
KLTH0C03938g       LSTGQGNGFNPLSDLTSARYAGF-LNLPSADSFGPDGGM--TSA-PN----SDDVLRMLE
Kwal_27.10275      LSSGQAGGFNPLSDLTSARYAGY-LNLPSADSFGPDGGM--TSA-PN----SDDMLRMLE
Suva_13.464        MSSGQSAGFNPLADLTSARYAGY-LNMPSADMFGPDGGALNNDS-NN----QDELLRMMD
Skud_13.448        MSSGQSAGFNPLADLTSARYAGY-LNMPSADMFGPDGGALNNDS-NN----QDELLRMME
YMR276W            MSSGQSAGFNPLADLTSARYAGY-LNMPSADMFGPDGGALNNDS-NN----QDELLRMME
Smik_13.489        MSSGQSAGFNPLADLTSARYAGY-LNMPSADMFGPDGGALNNDS-NN----QDELLRMME
ZYRO0G14124g       LSAGQSGGFNPLADLTSARYAGF-TSLPSADMFGPDGGA--TNM-PN----QEDLLNMLD
TDEL0B00600        IASGQTGGFNPLSDLTSARYAGF-TNLPSADMFGPDGGL--TNM-PN----QDDMLGMLE
CAGL0M02937g       IASGQTGGFNPLADLTGARYAGY-ANLPSADMFGPDGGI--NNA-PD----QDEMLRMME
KAFR0B03900        IASGQTGGFNPLNDLTSARYAGY-LNMPSADMFGPDGGL--NSG-PS----QDDMLRMLD
                    .:    * . :  :* :        : * : ..*:                 ..: :::

TBLA0B03240        HPRSFQENEMLLNNQNLLRFLIQTNPHLRHMDINGARQVLRDPRLQRAFMDVNFLNQQIS
KNAG0J00290        NPIFQSQMNEMFSNPQMVDFLIQSNPQLQAMG-PQAREMLQSPMFRQMLTNPDMVRQSMQ
TBLA0D03230        NPVFQSQMNEMLSNPEIVDFLINSNPQLQSLG-PQARTMFQSPMFRQMLTNPDMIRQSMR
KLLA0D01859g       NPIFQSQMNEMLSNPQMVDFLIQQNPQLQALG-PRARDMLQSPFFRQMMTDPQMIRQSMQ
ABL129W            NPIFQSQMNEMLNNPQMIDFLIQQHPHLQAMG-PAAREMLQSPFFRQMLTNPDIIRQMSR
Ecym_4608          NPIFQSQVNEMLANPQMIDFLIQQHPHLQAMG-PAAREMLQSPFFRQMMTNPDVIRQVSR
NDAI0K00440        NPIVQSQMNEMLSNPQMIDFMIQSNPQLQAMG-PQARQMFQSPMFRQMLTNPDMIRQSMQ
TPHA0I00220        NPVFQSQMNEMLSNPQMVEYMINSNPQLQALG-PQAREMFQSPFFRQMLTNPDMIRQSME
NCAS0C00430        NPVFQSQMNEMLSNPQMLDFIIQANPQLQAMG-PQARQILQNPMFRQMLTNPDMIRQSMQ
Kpol_1068.11       NPVFQSQMNEMLSNPQMIDFMIQSNPQLQAMG-PEARQMFQSPFFRQMLTNPEMIRQSMQ
SAKL0D01540g       NPIVQSQMNEMLSNPQMVDFMIQQNPQLQAMG-PRARELLQSDYFRQMMTNPDMIRQSMQ
KLTH0C03938g       NPVMQSQMNEMLSNPQMIDFLIQQSPQLQSMG-PQARTLLQSPFFRQMMTNPDMIRQSMQ
Kwal_27.10275      NPVMQSQMNEMLSNPQMIDFLIQQSPQLQSMG-PQARQMLQSPFFRQMMTNPEMIRQSMQ
Suva_13.464        NPIFQSQMNEMLSNPQMLDFMIQSNPQLQAMG-PQARQMLQSPMFRQMLTNPDMIRQSMQ
Skud_13.448        NPIFQSQMNEMLSNPQMLDFMIQSNPQLQAMG-PQARQMLQSPMFRQMLTNPEMMRQSMQ
YMR276W            NPIFQSQMNEMLSNPQMLDFMIQSNPQLQAMG-PQARQMLQSPMFRQMLTNPDMIRQSMQ
Smik_13.489        NPIFQSQMNEMLSNPQMLDFMIQSNPQLQAMG-PQARQMLQSPMFRQMLTNPDMIRQSMQ
ZYRO0G14124g       NPIFQSQMNEMLSNPQMVDFMIQSNPQLQAMG-PQARQMFQSPFFRQMLTNPQMIRQSMQ
TDEL0B00600        NPIFQSQMNEMLSNPQMVDFMIQSNPQLQAMG-PQARQLLQSPFFRQMLTNPQMLRQSMQ
CAGL0M02937g       NPIFQSQMNEMLSNPEMLDFMIQSNPQLQAMG-PQARQMLQSPFFRQMLTNPAMIRQSMQ
KAFR0B03900        NPVFQSQMNEMLSNPQMIDFMIQSNPQLQAMG-PQARQMLQSPMFRQMLINPDMIRQSMQ
                   :*   .: : :: * ::: ::*:  *:*. :.   ** ::..  :.. : :  .:.*   

TBLA0B03240        LRRTAI------------EHANNGITHPG-----------SSNETITVV--------TRI
KNAG0J00290        FSQMMQ---GSGAG--AGGADPNAFPAPG-----------GDDTGAPTN-----------
TBLA0D03230        MAQMMN------GG--EGTASASSFPAPGDSTTTTQPTSTNIDSDTNATNNTNNATNTPT
KLLA0D01859g       MANSMG-------M--SPDGAASAFPAPG-----------SASGAGGAN--ETSTNDADS
ABL129W            LQMGMG-------G--AGAEQGTDFPAPG-------------------------------
Ecym_4608          FQMDMG-------A--ANGQSTNDFPAPG-----------SANNSATTS----GDNATLT
NDAI0K00440        LANMMGMGPGARGSTNATDNAASSFPAPG-GDDIINNNNTNTNTNTNTNNDTNDTATSNN
TPHA0I00220        MARMMG-GEGVGIG--GGLNGDSSFPAPG-----------ETSTESATA----EDNAAAR
NCAS0C00430        MARAMN-GGVDPNGN-GQANTSSDFPAPG-----------GDDDNTVSE--NTPSTTNTA
Kpol_1068.11       MANMMG-----GNGQFGANAAASSFPAPG-----------ETDTTAAAE----TNTETTS
SAKL0D01540g       FARMFG------ME--GAEGAGGAFPAPG-----------TATQTASTE-GGPAGTTASP
KLTH0C03938g       FSSMLG------GD--SAAGGGSSFPAPG-----------TPAEADAPS---------QP
Kwal_27.10275      FSGVLG-GAGDPSA--AG---ANAFPAPG-----------TADSDASAQ------PASTN
Suva_13.464        FARMMD--PNAGNG--SAGGAASAFPAPG-----------GDAPEETTD---------TD
Skud_13.448        FARMMD------PN--ADNSAASAFPAPG-----------GDASEEGAN-----TNAVPS
YMR276W            FARMMD--PNAGMG--SAGGAASAFPAPG-----------GDAPEEGSNTNTTSSSNTGN
Smik_13.489        FARMMD--PNAGTG--STGGAASAFPAPG-----------GDAPEESAN-TNTNTNTASS
ZYRO0G14124g       FARMMN-----PGG--GENDAANAFPAPG-----------NENTEGESA-------AGAN
TDEL0B00600        FSSMMN-----PSG--GNDAAAASFPAPG-----------DSTTEASST-----EANTDA
CAGL0M02937g       FARMMN-GQGGMPG--ADATDASAFPAPG-----------GDDTETTTG-STENTSTNNR
KAFR0B03900        FARMMN-G-GNDPA--ATGNDPSAFPAPG--------EASASTNEQNTNASGESTTAGGA
                   :                       :. **                               

TBLA0B03240        DES---GNLVGNAVDQEQY-----------------------------------------
KNAG0J00290        TST---NASAAGPAGANPFSSLFGGAPA-----PA-AQPFQSA-----------------
TBLA0D03230        DVP---GTTNSGTAAANPFAALFD---------PS-MNPYAALGG--------------G
KLLA0D01859g       AAT---GAAASSTGQANPFAGLFGATPGNA---AA-ANPFAGLFP--------------G
ABL129W            -SA---ATPDAAAPAPNPLAAILGLQP------GA-ANPLGAAPA--------------D
Ecym_4608          STG---TGTNTNAAAANPLTSLFN---------AQ-SNPFAAMFAPPANSGPNPGTNAGA
NDAI0K00440        DNA---NNNASSANTQNPFASLFNPTANNDSTGLA-PNPFLAMLN-----NAGAGSGTNN
TPHA0I00220        NPA---ATNPAAANPANPFAALFN---------PG-MNPFAGLGN---------PAAAGS
NCAS0C00430        STN---PSSTATTNAANPFASLFN---------PA-MNPFAAGMA------------NTN
Kpol_1068.11       TPA---ATGAAAAGQQNPFASLFN---------PA-MNPFAAMMN--NNAAAAAGAGATG
SAKL0D01540g       STT---GNGSANSEAANPFASLFN---------GQ-ANPFASMFP---------------
KLTH0C03938g       AAN---PSAAPSAGTANPFASLLGGQAGASGASPA-ANPFLSMLG---------------
Kwal_27.10275      TST---ADAAQSATNANPFASLLAGQAAAPGGASAPANPFLSMLG-------------QQ
Suva_13.464        AAP---SSNAGANAAANPFASLLN---------PA-LNPFANAGN---------------
Skud_13.448        SNA---GTNGSANAAANPFASLLN---------PA-LNPFANA----------------G
YMR276W            NAGTNAGTNAGANTAANPFASLLN---------PA-LNPFANA----------------G
Smik_13.489        PNA---GSNASSSTAANPFASLLN---------PA-LNPFASA----------------G
ZYRO0G14124g       DGG---NPAAAATNAGAP---------------PA-GNPFAALLG--------------G
TDEL0B00600        NAN---TNANANTNAANPFAAMFN---------PG-SNPLASMFG------------NQG
CAGL0M02937g       TNS---NANANPNAAANPFAALMD---------PA-SNPFAAMMG---------NMNNQQ
KAFR0B03900        TNN---TNSTSAPAAANPFDALFN---------PA-ANPFGAMSS-------------NT
                                                                               

TBLA0B03240        -----RR-----------------NQIEVALQAHRQAL---DRLQNQNQ--QQQHPPPGK
KNAG0J00290        ------------------------PGFDAAAFMQAMSR-NGATAPAAAP--QDTRPPEER
TBLA0D03230        NGNANNM-------------------FNPAAFAQALQA---AAPHTQEP--EDNRPPEER
KLLA0D01859g       GQQ---------------------PQFNQELLASMFGGNSNATGAAPA---VDNRPPEER
ABL129W            RGLAM-------------------PPLDPAMLSSLFGA----GAASPAP--ADNRPPEER
Ecym_4608          TNSTTNPAAAFGADSQQPSRGFSLPPLDPAMLSALLSGG-FTATGRQQT--EDNRPPEER
NDAI0K00440        AGATGTL-----------------PPFDPSMFASLFGG-AGAPSTTPQQ--QDTRPPEER
TPHA0I00220        TGAPGTPQY---------------PGFNPSMLASMLQ-------QPRQPAQEDTRPPEVR
NCAS0C00430        AAGSGNP-----------------PAFDPSFFASMFQP----PAAQQQQ--EDTRPPEER
Kpol_1068.11       AAGATGT-----------------PAFDPSLFASMFQP----PQQQQQE--QDNRPPEER
SAKL0D01540g       ---NGRA-----------------PQFDPSLLSSFLGGNTAAPGQQQQP--QDNRPPEER
KLTH0C03938g       GGSAGTP-----------------PALDPMVLSSILGG---AGAANQQP--QDTRPPEER
Kwal_27.10275      APGAGGL-----------------PAFDPAMLSALLGG--AGNNASQQP--QDTRPPEER
Suva_13.464        SAAATGM-----------------PAFDPALLASMFQP-QQAAAQAPQP--EDTRPPEER
Skud_13.448        NTAPTGM-----------------PAFDPALLASMFQP-QQASAQASQP--EDSRPPEER
YMR276W            NAASTGM-----------------PAFDPALLASMFQP----PVQASQA--EDTRPPEER
Smik_13.489        NATGTGM-----------------PAFDPALLASMFQP-QQASAQASQP--EDTRPPEER
ZYRO0G14124g       GGPLQQP-----------------GGLDPQLLASMLGA----PSQQQQP--QDNRPPEER
TDEL0B00600        VGAADNQQN---------------QPFDPSMLASLLGG---GAAQQRAE--QDNRPPEER
CAGL0M02937g       GGAGVQQ-----------------PAFDPTLLASLLGG------QLPAPAQEDNRPPEER
KAFR0B03900        NGSQPQQ-----------------PAFDPALLASMLGM----PQSQQTPAQQDNRPPEER
                                             ::                        : .**  .

TBLA0B03240        ------------------------------------------
KNAG0J00290        YEQQLRQLNDMGFSDFDRNVAALRRAGGSLQGALDALLNGDV
TBLA0D03230        YEHQLRQLNDMGFFDFDKNVAALRRSGGSVQGAVNALLSEQ-
KLLA0D01859g       YESQLRQLNDMGFFDFDRNVAALRRAGGSVQGALDALLNGDV
ABL129W            YEQQLRQLNDMGFFDFDRNVAALRRAGGSVQGALDALLNGDV
Ecym_4608          YQQQLEQLNEMGFVDFDRNVAALRRSGGSVQGALNALLNGDV
NDAI0K00440        YETQLRQLNDMGFFDFDRNIAALRRTGGSVEAAVNALLNGDV
TPHA0I00220        YESQLRQLNDMGFFEFDRNIAALRRSGGSVQGALDALLNNDV
NCAS0C00430        YEHQLRQLNDMGFFDFDRNVAALRRSGGNVESALNALLNGDV
Kpol_1068.11       YESQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDALLSNDV
SAKL0D01540g       YEQQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDALLNGDV
KLTH0C03938g       YEHQLRQLNDMGFFEFDRNVAALRRSGGSVQGALDALLNGDV
Kwal_27.10275      YEQQLRQLNDMGFFEFDRNVAALRRSGGSVQGALDALLNGDV
Suva_13.464        YEQQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLLNGDV
Skud_13.448        YEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLLNGDV
YMR276W            YEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLLNGDV
Smik_13.489        YEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLLNGDV
ZYRO0G14124g       YETQLRQLNEMGFFDFDRNVAALRRSGGSVQGALDSLLNGDV
TDEL0B00600        YEQQLRQLNDMGFFDFEKNVAALRRSGGSVQGALDSLLNGDV
CAGL0M02937g       YEQQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDALLNGDV
KAFR0B03900        YEAQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDALLNGDV
                                                             

FASTA FORMAT for MUSCLE Version 3.6

>TBLA0B03240
--MISVNIKFKEEKFTIESEL---DELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKT
LKDYNFKDGHCIIVIIHK---EEKNNLHPPPNNTTNL--------NPNNSVYPASNTPIN
SPTPF--GEGNIITITTTSPDPY--GVRSNEVHDPEV--------------ERELLQVLD
HPRSFQENEMLLNNQNLLRFLIQTNPHLRHMDINGARQVLRDPRLQRAFMDVNFLNQQIS
LRRTAI------------EHANNGITHPG-----------SSNETITVV--------TRI
DES---GNLVGNAVDQEQY-----------------------------------------
-----RR-----------------NQIEVALQAHRQAL---DRLQNQNQ--QQQHPPPGK
------------------------------------------
>KNAG0J00290
-MGITVGVKQGQNRWDVAVASEPGETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQT
LEEYKITDGHTVHLVKSG---GAKSAGSSSSSSEATT---------AAGTAGTAPAAGAS
MAAGQQPGFNPLADLTSARYAGYNLPMPSADMFGPDGGLTSGGG-PGGPQSQEEILSMLE
NPIFQSQMNEMFSNPQMVDFLIQSNPQLQAMG-PQAREMLQSPMFRQMLTNPDMVRQSMQ
FSQMMQ---GSGAG--AGGADPNAFPAPG-----------GDDTGAPTN-----------
TST---NASAAGPAGANPFSSLFGGAPA-----PA-AQPFQSA-----------------
------------------------PGFDAAAFMQAMSR-NGATAPAAAP--QDTRPPEER
YEQQLRQLNDMGFSDFDRNVAALRRAGGSLQGALDALLNGDV
>TBLA0D03230
-MTISVHIKSGQNTWDVEIEA---SSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQT
IESYKIQDGHSIHMVKSG------AHATASSTTNSMT--------TTNTTAPQNNNGSSG
MSTGRGSGFNPLSDLTSARYAGY-TNLPSADMFGPDGGS--FAS-QS----QDDMLHMLE
NPVFQSQMNEMLSNPEIVDFLINSNPQLQSLG-PQARTMFQSPMFRQMLTNPDMIRQSMR
MAQMMN------GG--EGTASASSFPAPGDSTTTTQPTSTNIDSDTNATNNTNNATNTPT
DVP---GTTNSGTAAANPFAALFD---------PS-MNPYAALGG--------------G
NGNANNM-------------------FNPAAFAQALQA---AAPHTQEP--EDNRPPEER
YEHQLRQLNDMGFFDFDKNVAALRRSGGSVQGAVNALLSEQ-
>KLLA0D01859g
MSQISVHVKSGQNNWTVEIES---AATIRAFKETISGVSGVPADNQRLIYSGKILKDTET
VESYKIQDGHSVHMVKSG---GASAATTGSTTTGSAA-----------SPAATNSAAPSN
ISAGQTGGFNPLADLTGARYAGL-ANLPSADMFGPDGGLNSSNG-AN----PESMLQMLE
NPIFQSQMNEMLSNPQMVDFLIQQNPQLQALG-PRARDMLQSPFFRQMMTDPQMIRQSMQ
MANSMG-------M--SPDGAASAFPAPG-----------SASGAGGAN--ETSTNDADS
AAT---GAAASSTGQANPFAGLFGATPGNA---AA-ANPFAGLFP--------------G
GQQ---------------------PQFNQELLASMFGGNSNATGAAPA---VDNRPPEER
YESQLRQLNDMGFFDFDRNVAALRRAGGSVQGALDALLNGDV
>ABL129W
-MTIKIQVKSGQNRWEVSVEA---SGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQT
VESYKIADGHAIHLVKSG---GAKAAPAASAAGGEST-----------GAAAGAGAVPSS
ISAGQSGGFNPLADLTGARYAGY-TNLPSTDMFGPDGGL--NSA-VG----QEEIIGMLE
NPIFQSQMNEMLNNPQMIDFLIQQHPHLQAMG-PAAREMLQSPFFRQMLTNPDIIRQMSR
LQMGMG-------G--AGAEQGTDFPAPG-------------------------------
-SA---ATPDAAAPAPNPLAAILGLQP------GA-ANPLGAAPA--------------D
RGLAM-------------------PPLDPAMLSSLFGA----GAASPAP--ADNRPPEER
YEQQLRQLNDMGFFDFDRNVAALRRAGGSVQGALDALLNGDV
>Ecym_4608
-MSISLHVKSGQNKWQVSADP---SSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQT
VESYKIADGHSIHLVRSG---GGKVSGSSGATGGASGSVEAVGSGGRNSTAGSGSTVPNN
ITAGQMGGFNPLADLTGARYAGY-ANLPSTDMFGPDGGL--NSA-IG----QEEILGMLD
NPIFQSQVNEMLANPQMIDFLIQQHPHLQAMG-PAAREMLQSPFFRQMMTNPDVIRQVSR
FQMDMG-------A--ANGQSTNDFPAPG-----------SANNSATTS----GDNATLT
STG---TGTNTNAAAANPLTSLFN---------AQ-SNPFAAMFAPPANSGPNPGTNAGA
TNSTTNPAAAFGADSQQPSRGFSLPPLDPAMLSALLSGG-FTATGRQQT--EDNRPPEER
YQQQLEQLNEMGFVDFDRNVAALRRSGGSVQGALNALLNGDV
>NDAI0K00440
MSTISIHIKSGQNNWQVSIDT---TASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQN
VDFYNIQDGHSVHLVRSG----KKSTPTPATTNTTTN--------------ASNNTVPSN
ISAGQTGGFNPLADLTSARYAGYNLNLPSADAFGPDGGM--NQSGTN----PDEFLSMLD
NPIVQSQMNEMLSNPQMIDFMIQSNPQLQAMG-PQARQMFQSPMFRQMLTNPDMIRQSMQ
LANMMGMGPGARGSTNATDNAASSFPAPG-GDDIINNNNTNTNTNTNTNNDTNDTATSNN
DNA---NNNASSANTQNPFASLFNPTANNDSTGLA-PNPFLAMLN-----NAGAGSGTNN
AGATGTL-----------------PPFDPSMFASLFGG-AGAPSTTPQQ--QDTRPPEER
YETQLRQLNDMGFFDFDRNIAALRRTGGSVEAAVNALLNGDV
>TPHA0I00220
-MSISVQIKSGQNKWDVAVEP---SNTILEFKEIISKASDIPAGNQRLIYSGKILKDAET
VESYKIQDGHSIHLVKSG---DASANAAKSSTAAAAT--------ANAAAGSAESAVPTN
ITSGQTNGFNPLADLTSARYAGYNLPMPSADMFGPDGGM--TNM-PN----QDDMLSMLE
NPVFQSQMNEMLSNPQMVEYMINSNPQLQALG-PQAREMFQSPFFRQMLTNPDMIRQSME
MARMMG-GEGVGIG--GGLNGDSSFPAPG-----------ETSTESATA----EDNAAAR
NPA---ATNPAAANPANPFAALFN---------PG-MNPFAGLGN---------PAAAGS
TGAPGTPQY---------------PGFNPSMLASMLQ-------QPRQPAQEDTRPPEVR
YESQLRQLNDMGFFEFDRNIAALRRSGGSVQGALDALLNNDV
>NCAS0C00430
-MSISIHVKSGQNNWQVSIDP---ASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQT
VEFYKILDGLSIHMVKSG---GGSANKNKSPPPQANT---------------TATPVAPN
MAAGETGGFNPLSDLTSARYAGY-LNLPSADTFGPDGGL--NNSGPN----QDEMLRMLD
NPVFQSQMNEMLSNPQMLDFIIQANPQLQAMG-PQARQILQNPMFRQMLTNPDMIRQSMQ
MARAMN-GGVDPNGN-GQANTSSDFPAPG-----------GDDDNTVSE--NTPSTTNTA
STN---PSSTATTNAANPFASLFN---------PA-MNPFAAGMA------------NTN
AAGSGNP-----------------PAFDPSFFASMFQP----PAAQQQQ--EDTRPPEER
YEHQLRQLNDMGFFDFDRNVAALRRSGGNVESALNALLNGDV
>Kpol_1068.11
-MGIKIHIKSGQNKWEVTVDV---SNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQV
LEFYKIQDEHSIHLVKSG---GASKTNTSASAAAAST--------STATNSDSNAPLPSN
IAAGQSGGFNPLSDLTSARYAGYGLNLPSADMFGPDGGM--NSM-PN----QDDMLRMLE
NPVFQSQMNEMLSNPQMIDFMIQSNPQLQAMG-PEARQMFQSPFFRQMLTNPEMIRQSMQ
MANMMG-----GNGQFGANAAASSFPAPG-----------ETDTTAAAE----TNTETTS
TPA---ATGAAAAGQQNPFASLFN---------PA-MNPFAAMMN--NNAAAAAGAGATG
AAGATGT-----------------PAFDPSLFASMFQP----PQQQQQE--QDNRPPEER
YESQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDALLSNDV
>SAKL0D01540g
-MSITLHIKSGQNKWDVSIEP---TNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQT
VESYKIADDHAVHLVRSG---GPKPAASKSESTSATD-----------TGAAAAAAVPSN
ISSGQTGGFNPLADLTGARYAGY-ANLPSADMFGPDGGL--TNA-PN----SDEILNMLD
NPIVQSQMNEMLSNPQMVDFMIQQNPQLQAMG-PRARELLQSDYFRQMMTNPDMIRQSMQ
FARMFG------ME--GAEGAGGAFPAPG-----------TATQTASTE-GGPAGTTASP
STT---GNGSANSEAANPFASLFN---------GQ-ANPFASMFP---------------
---NGRA-----------------PQFDPSLLSSFLGGNTAAPGQQQQP--QDNRPPEER
YEQQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDALLNGDV
>KLTH0C03938g
-MSITVHIKSGQNKWDVAIDP---SSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQT
VESYKILDDHSVHLVKSG---GSKKATSPGATAAASG-DATATGATSTPAAQPQQSAPAN
LSTGQGNGFNPLSDLTSARYAGF-LNLPSADSFGPDGGM--TSA-PN----SDDVLRMLE
NPVMQSQMNEMLSNPQMIDFLIQQSPQLQSMG-PQARTLLQSPFFRQMMTNPDMIRQSMQ
FSSMLG------GD--SAAGGGSSFPAPG-----------TPAEADAPS---------QP
AAN---PSAAPSAGTANPFASLLGGQAGASGASPA-ANPFLSMLG---------------
GGSAGTP-----------------PALDPMVLSSILGG---AGAANQQP--QDTRPPEER
YEHQLRQLNDMGFFEFDRNVAALRRSGGSVQGALDALLNGDV
>Kwal_27.10275
-MSITVHVKSGQSKWDVSVDA---DSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQT
LESYKILDGHAVHLVKSGTKSGSGAIGAPGSGSTAPT----------NTASSGAAAAPAS
LSSGQAGGFNPLSDLTSARYAGY-LNLPSADSFGPDGGM--TSA-PN----SDDMLRMLE
NPVMQSQMNEMLSNPQMIDFLIQQSPQLQSMG-PQARQMLQSPFFRQMMTNPEMIRQSMQ
FSGVLG-GAGDPSA--AG---ANAFPAPG-----------TADSDASAQ------PASTN
TST---ADAAQSATNANPFASLLAGQAAAPGGASAPANPFLSMLG-------------QQ
APGAGGL-----------------PAFDPAMLSALLGG--AGNNASQQP--QDTRPPEER
YEQQLRQLNDMGFFEFDRNVAALRRSGGSVQGALDALLNGDV
>Suva_13.464
-MSLNVYVKSGQDKWEVSVAP---ESTVLQFKEAISEANGIPVANQRLIYSGKILKDDQT
VESYHIQDGHSVHLVKSQ------PRPQAGAATGAGG-------DAGASATNASVSATPN
MSSGQSAGFNPLADLTSARYAGY-LNMPSADMFGPDGGALNNDS-NN----QDELLRMMD
NPIFQSQMNEMLSNPQMLDFMIQSNPQLQAMG-PQARQMLQSPMFRQMLTNPDMIRQSMQ
FARMMD--PNAGNG--SAGGAASAFPAPG-----------GDAPEETTD---------TD
AAP---SSNAGANAAANPFASLLN---------PA-LNPFANAGN---------------
SAAATGM-----------------PAFDPALLASMFQP-QQAAAQAPQP--EDTRPPEER
YEQQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLLNGDV
>Skud_13.448
-MSLNIHIKSGQDKWEVAVAP---ECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQT
VDSYHIQDGHSVHLVKSQ------PKPDAGGATGANN--------ATATSAAVGTSATPN
MSSGQSAGFNPLADLTSARYAGY-LNMPSADMFGPDGGALNNDS-NN----QDELLRMME
NPIFQSQMNEMLSNPQMLDFMIQSNPQLQAMG-PQARQMLQSPMFRQMLTNPEMMRQSMQ
FARMMD------PN--ADNSAASAFPAPG-----------GDASEEGAN-----TNAVPS
SNA---GTNGSANAAANPFASLLN---------PA-LNPFANA----------------G
NTAPTGM-----------------PAFDPALLASMFQP-QQASAQASQP--EDSRPPEER
YEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLLNGDV
>YMR276W
-MSLNIHIKSGQDKWEVNVAP---ESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQT
VESYHIQDGHSVHLVKSQ------PKPQTASAAGANN--------ATATGAAAGTGATPN
MSSGQSAGFNPLADLTSARYAGY-LNMPSADMFGPDGGALNNDS-NN----QDELLRMME
NPIFQSQMNEMLSNPQMLDFMIQSNPQLQAMG-PQARQMLQSPMFRQMLTNPDMIRQSMQ
FARMMD--PNAGMG--SAGGAASAFPAPG-----------GDAPEEGSNTNTTSSSNTGN
NAGTNAGTNAGANTAANPFASLLN---------PA-LNPFANA----------------G
NAASTGM-----------------PAFDPALLASMFQP----PVQASQA--EDTRPPEER
YEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLLNGDV
>Smik_13.489
-MSLNIHIKSGQDKWEVSVAP---ESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQT
VESYHIQDGHSVHLVKSQ------PKPQPGAAAGTNN--------ATATGAAAGTVATPN
MSSGQSAGFNPLADLTSARYAGY-LNMPSADMFGPDGGALNNDS-NN----QDELLRMME
NPIFQSQMNEMLSNPQMLDFMIQSNPQLQAMG-PQARQMLQSPMFRQMLTNPDMIRQSMQ
FARMMD--PNAGTG--STGGAASAFPAPG-----------GDAPEESAN-TNTNTNTASS
PNA---GSNASSSTAANPFASLLN---------PA-LNPFASA----------------G
NATGTGM-----------------PAFDPALLASMFQP-QQASAQASQP--EDTRPPEER
YEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLLNGDV
>ZYRO0G14124g
MSTITVQIKSGQNKWEVTVDP---ESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQT
LQFYNLQDGHSVHLVKSSKAPGNASGGSSSTAAATAGSGASAVPPSGNASTTPTTGAPSN
LSAGQSGGFNPLADLTSARYAGF-TSLPSADMFGPDGGA--TNM-PN----QEDLLNMLD
NPIFQSQMNEMLSNPQMVDFMIQSNPQLQAMG-PQARQMFQSPFFRQMLTNPQMIRQSMQ
FARMMN-----PGG--GENDAANAFPAPG-----------NENTEGESA-------AGAN
DGG---NPAAAATNAGAP---------------PA-GNPFAALLG--------------G
GGPLQQP-----------------GGLDPQLLASMLGA----PSQQQQP--QDNRPPEER
YETQLRQLNEMGFFDFDRNVAALRRSGGSVQGALDSLLNGDV
>TDEL0B00600
-MSITVQVKCGQSKWEVSVNP---EKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQN
VESYKIQDGHAIHLVKSG---GGGGNTAAKASTSSQE---------SNTAAPGSATVPSN
IASGQTGGFNPLSDLTSARYAGF-TNLPSADMFGPDGGL--TNM-PN----QDDMLGMLE
NPIFQSQMNEMLSNPQMVDFMIQSNPQLQAMG-PQARQLLQSPFFRQMLTNPQMLRQSMQ
FSSMMN-----PSG--GNDAAAASFPAPG-----------DSTTEASST-----EANTDA
NAN---TNANANTNAANPFAAMFN---------PG-SNPLASMFG------------NQG
VGAADNQQN---------------QPFDPSMLASLLGG---GAAQQRAE--QDNRPPEER
YEQQLRQLNDMGFFDFEKNVAALRRSGGSVQGALDSLLNGDV
>CAGL0M02937g
-MSITIHIKSGQNKWDVSIDP---SQTILNLKEEIAKVSEIPSGNQRLIYSGKILKDDQT
VESYNIKDDHAIHMVKSG---GNASTSNAPTNANESS-------------NSSTTAVPSN
IASGQTGGFNPLADLTGARYAGY-ANLPSADMFGPDGGI--NNA-PD----QDEMLRMME
NPIFQSQMNEMLSNPEMLDFMIQSNPQLQAMG-PQARQMLQSPFFRQMLTNPAMIRQSMQ
FARMMN-GQGGMPG--ADATDASAFPAPG-----------GDDTETTTG-STENTSTNNR
TNS---NANANPNAAANPFAALMD---------PA-SNPFAAMMG---------NMNNQQ
GGAGVQQ-----------------PAFDPTLLASLLGG------QLPAPAQEDNRPPEER
YEQQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDALLNGDV
>KAFR0B03900
-MSITIHIKSGQNKWDVNTNL---SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQT
VESYKIEEGHSIHLVKSG---GNVARNSAATNTTPTA--------TSNENTNSAPSVPSN
IASGQTGGFNPLNDLTSARYAGY-LNMPSADMFGPDGGL--NSG-PS----QDDMLRMLD
NPVFQSQMNEMLSNPQMIDFMIQSNPQLQAMG-PQARQMLQSPMFRQMLINPDMIRQSMQ
FARMMN-G-GNDPA--ATGNDPSAFPAPG--------EASASTNEQNTNASGESTTAGGA
TNN---TNSTSAPAAANPFDALFN---------PA-ANPFGAMSS-------------NT
NGSQPQQ-----------------PAFDPALLASMLGM----PQSQQTPAQQDNRPPEER
YEAQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDALLNGDV