MUSCLE (3.8) multiple sequence alignment

Kpol_1069.4        ------------------------------------------------------------
TBLA0D03180        --------------------------------MPASPSTATKTDTVGTSSSPLTKELFSL
Kpol_541.9         ----------------------------------------------MSAKDSKTLELFAK
TPHA0C04710        ---------------------------------------------MAESNPSKTLELFSS
KAFR0B03850        ------------------------------------------------MTTAKTLELFSK
KNAG0J00320        -----------------------------------------------MSSNSRTLELVSK
TDEL0B00680        ----------------------------------------------MSQDQSKTLELFSR
Suva_13.460        ----------------------------------------------MSTNTSKTLELFSK
Skud_13.444        ----------------------------------------------MSTNTSKTLELFSR
Smik_13.485        ----------------------------------------------MSANTSKTLELFSK
YMR272C            ----------------------------------------------MSTNTSKTLELFSK
ZYRO0G13948g       -----------------------------------------------MSTKSPTLQLFSQ
KLTH0C04114g       -------------------------------------------------METKTLPLYSQ
Kwal_27.10332      -------------------------------------------------METKTLPLYSA
KLLA0D01639g       ------------------------------------------------MSSSRILPLYSK
SAKL0D01760g       ------------------------------------------------MSESKTLPLLSK
CAGL0F03399g       --------------------------------------------MSVAADSSKTLELFPQ
NDAI0K00470        ----------------------------------------------MSINTSKTLELFSK
NCAS0C00470        MAFTYVWINEKVIIYIMSTFSLSSQFVGSFSIFRNTPAKLTTRRNQMSSNVSKTLELFSK
Ecym_2712          -----------------------------------------------MSSSCKTLPLYSK
AAL183W            -------------------------------------------------MVSKTLPLYSK
                                                                               

Kpol_1069.4        ---------------------MKIEESIETYIH---------------------------
TBLA0D03180        ESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPK--GNSKIIDFAGKDITSSFKNQERYNH
Kpol_541.9         SRFEEHNTEADCWVSVKERLIYDVSSYLKDNAD--ADSSILEHAGKDITKLTKTRE----
TPHA0C04710        EKFQSHNTEDDCWVSVKDRLIYDVSKFVQENKDVPVEDAVLKRAGKDISDLLETK-----
KAFR0B03850        KEVANHTKREDCWVTIFSRKIYDVTKFLDENRD--FDSLLLDYAGTDITDELVNGKLDEK
KNAG0J00320        DTVASHNQKNDAWVVVQGRKVVDISAYIRERPE--KEELLLSLAGKDITDRSHE------
TDEL0B00680        KQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPG--GPQYILDYAGKDITEVLKDSTIHEH
Suva_13.460        KTVEEHNTAKDCWVTYQNRKIYDVTKFLSEHPG--GEESILDYAGKDITEVMKDSDVHEH
Skud_13.444        KTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPG--GDESILDYAGKDVTEIMKDSDVHEH
Smik_13.485        KTVEKHNTAKDCWVTYQNRKIYDVTKFLSEHPG--GDESILDYAGKDITEVMKDTDVHEH
YMR272C            KTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPG--GDESILDYAGKDITEIMKDSDVHEH
ZYRO0G13948g       EQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPG--GAEYILKYAGRDITEVLKDRDVHEH
KLTH0C04114g       SQLEQHNTRDDCWVSLHHRKIYNVTSFLDEHPG--GAELIEEYAGKDVTEIMKDGPTHEH
Kwal_27.10332      SQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPG--GGDLIVEYAGKDITEVMKDGPLHSH
KLLA0D01639g       TDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPG--GAEYILDYAGTDITDVMKDVLTHEH
SAKL0D01760g       TQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPG--GDQYILDHAGEDITEIMKDKLVHEH
CAGL0F03399g       SVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPE-EADAVHKALDGKHGTDISQMELT---
NDAI0K00470        DKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDITDELKDK-IDSI
NCAS0C00470        DQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPD--GDKSILKHAGKDITELLKDEKIDQQ
Ecym_2712          SEFEKHVKPNQCWVSIDQRKIYNVSKFLDENPE--GYQYVLDHAGQDVTQLLKDMQTDEP
AAL183W            ATLQKHTDRTSCWVSVGNRKIYDVSQFLDEHPG--GDQYILDYAGKDITAVLKDKLIHEH
                                         .:   :                                

Kpol_1069.4        ----------------------------------------------------IRKTTLTE
TBLA0D03180        DPETYDFMSHNDKYLVGYLANEEEAYKLLSNPSHKVEVKLTE-QPSTYDSTTFVKELPSE
Kpol_541.9         ----FKFIS-D-EYLVGYLATEEEEVRLLTNKDHKVEVNLQD---GTYDSTVFVKELPAE
TPHA0C04710        ---SFKFVD-D-KYLVGYLANSTEEARLLTNKDHKVEVNLKD---GTYDSTVFVKELPSE
KAFR0B03850        ----YKALDND-NYLVGYVATADEEQKLLTNKDHKVEVTLEQ----DFDLATLVVELPPE
KNAG0J00320        ----FPGLNAD-DHLVGYLATDLEEKELLSNKDHKVEVKLEG--GETFDSSTFVKDLPTE
TDEL0B00680        SESAYEILE-DSSYLVGYMATELEEKELLTNSSHKVEVKLAT---LDFDSTTFVKDLPTE
Suva_13.460        SESAYEILE-D-EYLVGYLATDEEATRLLTNKNHKVEVQLSA-DGTEFDSTTFVKDLPTE
Skud_13.444        SDSAYEILE-D-EYLIGYLATDEEATRLLTNKSHKVEVQLSA-DGKEFDSTTFVKNLPTE
Smik_13.485        SDSAYEILE-D-EYLIGYLATDEEAARLLTNKNHKVEVQLSS-DGTEFDSTTFVKDLPAE
YMR272C            SDSAYEILE-D-EYLIGYLATDEEAARLLTNKNHKVEVQLSA-DGTEFDSTTFVKELPAE
ZYRO0G13948g       SESAYEILD-D-NYLVGYLATKEEATKLLTNKKHQVEVHLTDQNNSDFDSTTFVPELPAE
KLTH0C04114g       SYVAYEVLD-E-EYHVGYLATPEEEKKLLGNPEHPVEVKLEE----DYDSTVFVPEVPPE
Kwal_27.10332      SFVAYEVLD-E-EYHVGYLATAEEEQKLLGNSKHKVEVKLED----EYDSTVFVPEVPAE
KLLA0D01639g       SESAYEIMD-E-SYLVGYLATEEEEKKLLTNKDHVVEVNLKG--NNEFDSTVFVKELPTE
SAKL0D01760g       SESAYEIMN-D-MYLVGYLANEEEEKKLLTNEDHTVEVKLNE--STQFDSTTFVKELPTE
CAGL0F03399g       ---TLKFVT-D-DYLVGYLATSDEEKKLLTNKSHKVEVKLNA--DNTFDSTTFVKDLPTE
NDAI0K00470        KNPSFPILQTD-QYLIGYLATDHEEKTLLTNKDHKVEVQLNE-ATNGFDSTTFVKDLPTE
NCAS0C00470        T----DLLD-D-QYLIGYMATDAEEEKLLTNKDHKVEVKLNE-STNTFDSTTFVKDLPTE
Ecym_2712          TDLAHQLLS-D-AYLIGYLATSEEERKLLTNANHVVEVKPAN--GNRVDSG-FVKKLPTE
AAL183W            TEAAYEILD-E-SYLVGYLATEEEEIKLLTNEKHVMEVTPEN-----LDTTTFVKELPAE
                                                                       :     .*

Kpol_1069.4        EKLKVTTDYNKDFNENGFLKLDEPLFWQLLSSNFTRDFYIDQVHKPRHYGIESAPIFGN-
TBLA0D03180        DHFVIATDYKKDFNEHHFLDLEKPLIPQLWRAKFNRAFYIDQIHRPRHFGNKSAPLFGN-
Kpol_541.9         EKFTVATDLGKDFQDHHFLDLNKPMLWQVLFGNFTRDFYIDQVHRPRHYGKGSAPLFGN-
TPHA0C04710        EHFTISTDYKKDFVDHHFLDLEKPLLMQMLTGNFTREFYIDQIHRPRHYGKGSAKLFGN-
KAFR0B03850        EKLTIATNYDRDFKKHKFLDLNKPLLPQILKGKFTREFYVDQINRPRHYGQKSAPLFGNA
KNAG0J00320        DKLSIATDTKRDYQKHHFLDLEKPLIPQVLFGSFTKDFYVDQIHRPRHYGKGSAPLFGN-
TDEL0B00680        EKLSIATDYSRDYKRHHFLDLQKPLLPQVMFGKFTKDFYVDQIHRPRHYGKGSAPLFGN-
Suva_13.460        EKLSIATDYGSDYKKHKFLDLNKPLLMQILRSDFTRDFYVDQIHRPRHYGKGSAPLFGN-
Skud_13.444        EKLSIATDYGNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGKGSAPLFGN-
Smik_13.485        EKLSIATDYGNDYKKHKFLDLNRPLLMQILCSDFKKDFYVDQIHRPRHYGKGSAPLFGN-
YMR272C            EKLSIATDYSNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGKGSAPLFGN-
ZYRO0G13948g       EKLNIATDYGRDYKKHKFLDLNRALLPQVMFGNFSKDFYLDQVHRPRHYGKGSAPLFGN-
KLTH0C04114g       EKLSIVTDYTKDYGRHKFLDLNRPLLMQMLTSDFSKEFYLDQVHRPRHYGRGSAPLFGN-
Kwal_27.10332      EKLSIVTDYTRDYGRHKFLDLNRPLLMQMLTADFTKEFYLDQVHRPRHYGRGSAPLFGN-
KLLA0D01639g       DKLSIATDYQNDYKKHKFLDLNKPLLWQVLFGKFTKDFYLDQVHRPRHYGKGSAPLFGN-
SAKL0D01760g       DKLSIATDYSSDYKKHKFLDLDKPLLWQVVFGNFTKDFYLDQVHRPRHYGKGSAPLFGN-
CAGL0F03399g       DKLSITTDYERDYKKHKFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGKGSAPLFGN-
NDAI0K00470        DKLSIATDTKKDLEKHKFLDLDKPLLKQILFGNFTKDFYLDQIHRPRHYGDKSAPLFGN-
NCAS0C00470        DKLSIATDYEKDLKKHNFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGQESAPLFGN-
Ecym_2712          EKLAIATDFKTDYEKHHFLDLDKPLFMQVLFGNFTKEFYIDQVHRPRHYGKESAPLFGN-
AAL183W            EVLSVATDFGTDYTKHHFLDLNKPLLMQVLRGNFTRDFYIDQIHRPRHYGKGSAPLFGN-
                   : : : *:   *   : **.*: .:: *:  ..*.. **:**::.***:*  ** :*** 

Kpol_1069.4        FLEPFTKTHWFMVPLIWGPVVLYNFIVSLREISIILAITLFSIGVFVWTLIEYCMHRYLF
TBLA0D03180        FLEPLTKTAWWVIPVVWLPVVFYHLKVAFHNMNNIFATFLFCVGVFVWTLIEYSLHRFLF
Kpol_541.9         FLEPISLTPWWLIPIIWGPVVVYHLSVALNNMNNIFAGFLFCLGIFVWTLIEYCLHRFLF
TPHA0C04710        WLEPISLTPWWLIPIIWGPVVVYHFYVGAQHMHPLSAVFFYFLGIFVWTFIEYCLHRFLF
KAFR0B03850        FLEPFSKTAWWVVPTFWLPVVFHFFRVALKNMNNPLALFLFCVGVFVWTLLEYCLHRFLF
KNAG0J00320        FLEPISKTAWYVVPIVWGPVVLYFLGRSLKGIHPIFALMLFALGGFVWTLIEYCMHRFLF
TDEL0B00680        FLEPLSKTSWYVIPMVWLPVVLYHVGVAFKNMNPIFTIFFFCLGTFVWTLIEYGLHRFLF
Suva_13.460        FLEPLTKTAWWVVPVAWVPVVVYHMGVALKNMNPLFACFLFGVGMFVWTLIEYSLHRFLF
Skud_13.444        FLEPLTKTAWWVVPLPWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWTLIEYGLHRFLF
Smik_13.485        FLEPLTKTAWWVVPTAWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWTLIEYGLHRFLF
YMR272C            FLEPLTKTAWWVVPVAWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWTLIEYGLHRFLF
ZYRO0G13948g       FLEPISKTPWWAIPIIWIPVVSFHFYVGFTNMNKLFSTFLFCLGIFVWTLIEYCLHRFLF
KLTH0C04114g       FLEPLSKTAWYVIPLVWFPVVVYHMYTALQNMNNVLAVFLFCLGVFVWTLIEYGLHRFLF
Kwal_27.10332      FLEPLSKTSWYVIPIVWLPVVAYHIFTAMQNMNKLFAVFLFFVGIFVWTLIEYGMHRFLF
KLLA0D01639g       FLEPLSKTPWWMVPVVWLPVVTYHIYTALMNMNQAFAIFLFAVGVFVWTLIEYGLHRFLF
SAKL0D01760g       FLEPLSKTPWYAIPIAWLPVVFYHLYVALTNMNKPFALFLFSLGVFVWTLIEYCLHRFLF
CAGL0F03399g       FLEAFTKTAWWVVPTVWGPVVLYFITTALMNMNNPLALFLFGLGIFVWTLIEYCLHRFLF
NDAI0K00470        ILEPLTKTSWYLVPIFWLPVVFYHIAVALTNMNPIFAIVLFAIGIYVWTLIEYCMHRFLF
NCAS0C00470        FLEPFTKTAWYLVPIAWLPVVFYHIALAFKNINALFAIMLFCIGVYVWTFIEYCMHRFLF
Ecym_2712          FLEPLSKTSWWVIPIVWYPCVIYYIRTALLNISTPLALFLFGVGVFVWTLIEYGLHRFLF
AAL183W            FLEPLSKTVWWVVPMVWYPVVLYYLTRALQNMPAHLALTCFAAGVFVWTLIEYSLHRFLF
                    **.:: * *: :*  * * * . .  .   :    :   :  * :***::** :**:**

Kpol_1069.4        HLDDSVPETRLFFVLHFLLHGIHHYLPMDKYRLVMPPALFSILCYPFYLLTFAIFPRYWA
TBLA0D03180        HMDNRIPDHPMFYVLHFTIHGCHHYLPMDPYRLVMPPTLFLILCTPFYKLVFSVLPLYWA
Kpol_541.9         HLDDWVPQHNIFYTLHFLLHGVHHYLPMDQYRLVVPPALFLVLCTPIYKLVFGLLPLYWA
TPHA0C04710        HLDDWVPQHNFFYTIHFLLHGVHHYLPMDQYRLVVPPALFVVLCTPFYKAVFALLPLYVA
KAFR0B03850        HFDNYLPENNIAFALHFLLHGFHHYLPMDPYRLVVPPALFIILCAPIYKTVFLLLPYYWA
KNAG0J00320        HFDDWLPENNVAFTIHFLLHGVHHYLPMDGYRLVVPPALFVVLCTPFYKLVFKLLPHYVA
TDEL0B00680        HFDDWLPESNVCFTLHFLLHGVHHYLPMDKYRLVMPPTLFVILCTPFYKLVFGLLPLYVA
Suva_13.460        HFDDWLPESNIAFATHFLLHGCHHYLPMDGYRLVMPPSLFVILCAPFYKLVFALLPLYWA
Skud_13.444        HFDDWLPESNVAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVFALLPLYWA
Smik_13.485        HFDDWLPESNIAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVFALLPLYWA
YMR272C            HFDDWLPESNIAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVFALLPLYWA
ZYRO0G13948g       HLDEWLPDNNAALTLHFLLHGVHHYLPMDRYRLVMPPTLGIVLMAPIYKTVFGLLPTYWA
KLTH0C04114g       HLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMPPTLFVVLCTPFYKLVFALLPKYWA
Kwal_27.10332      HLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMPPTLFLLLCTPFYKLVFALLPYYWA
KLLA0D01639g       HLDDRLPEKQWAFTLHFLLHGVHHYLPMDRFRLVMPPTLFVVLCTPFYKLVFALLPYYWA
SAKL0D01760g       HLDQYLPERQLAFALHFLLHGVHHYLPMDRYRLVMPPTLFVLLCTPFYKLVFSLLPYYWA
CAGL0F03399g       HFDEWLPEHSMFFMIHFLLHGCHHYLPMDAYRLVVPPALFVVLCAPIYKLVFAALPYYWA
NDAI0K00470        HFDERLPEHNIFYVIHFLLHGCHHYLPMDKYRLVVPPTLFIFLCFPFYKVVFKLLPLYWA
NCAS0C00470        HFDERLPEHNFAYMIHFLLHGCHHYLPMDKYRLVVPPVLFIFLCAPFYKLVFALLPYYWA
Ecym_2712          HFDDRMPESNIVFTLHFLLHGIHHYLPMDKYRLVMPPALFLALCYPFYKLVFSILPYYCA
AAL183W            HFDDNMPESNIAFTVHFLLHGVHHYLPMDKYRLVMPPALFVVLCAPFYRLVFSIFPEYCA
                   *:*  :*        ** :** ******* :***:** *   *  *:*  .*  :* * *

Kpol_1069.4        HAGFAGGLFGYVCYDVTHYFLHHKKMPSFMRKVKKYHLEHHYKNFQLGFGVTSSFWDRVF
TBLA0D03180        YAGFAGGLFGYVCYDEVHYWLHHSRVPKFMRLLKKLHLEHHYKNYQLAFGVSNYFWDKVF
Kpol_541.9         YAGFAGGLLGYICYDLTHYFIHHVKLPKFMRKVKKHHLEHHYKNYQLGFGVSNYFWDKVF
TPHA0C04710        YVGFAGGLTGYIIYDLTHYFIHHVKLPRVFRKIKKHHLEHHYKNYQLGFGVSNYFWDLVF
KAFR0B03850        CAGFAGGLFGYVYYDMCHYALHHSKLPPFMRRLKQYHLEHHYKNYELGYGITSWFWDKVF
KNAG0J00320        CAGFAGGMFGYICYDLIHYFLHHSKMPKFMRKLKQYHLEHHYKNYQLGFGVSNWFWDKVF
TDEL0B00680        YAGFAGGLFGYVCYDLTHYFLHHSKLPSFMRKLKKYHLEHHYKNYQLGFGVTSWFWDKVF
Suva_13.460        YAGFAGGLFGYVCYDECHYFIHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVTSWFWDDVF
Skud_13.444        YAGFAGGLFGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVTSWFWDEVF
Smik_13.485        YAGFAGGLFGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVTSWFWDEVF
YMR272C            YAGFAGGLFGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVTSWFWDEVF
ZYRO0G13948g       YSGFAGGLFGYVCYDLTHYFLHHAKLPSYMRKLKKYHLEHHYKNYQLGFGVTSWFWDNVF
KLTH0C04114g       CAGFAGGMFGYMCYDLTHYFLHHAKLPSYMRKLKKYHMEHHYKNYELGFGVTSWFWDKVF
Kwal_27.10332      CAGFAGGMLGYVCYDLTHYFLHHAKLPGILKKLKKYHMEHHYKNYELGFGVTSWVWDKVF
KLLA0D01639g       CAGFAGGMLGYVCYDLTHYFLHHSQLPPYMRKLKKYHLEHHYKNYELGFGVTSWFWDKVF
SAKL0D01760g       CAGFAGGMLGYTCYDLTHYFLHHAKLPPYMRKLKKYHLEHHYKNYELGFGVTSWFWDKVF
CAGL0F03399g       CAGFAGGMLGYICYDLCHYFLHHSKMPPFMRKLKKYHLEHHYKNYQLGFGVTSWFWDKVF
NDAI0K00470        YAGFAGGLFGYVCYDLCHYFLHHSKMPPPLRKLKKYHLEHHYKNYQLGYGVTSWYWDKIF
NCAS0C00470        CAGFAGGMFGYICYDLCHYFLHHSKLPPFMRKLKKYHLEHHYKNYQLGYGVTSWYWDKKF
Ecym_2712          CAGFAGGLFGYVGYDVTHYFLHHRKLPPFMRKLKKYHLEHHYKNYELGFGVTSWYWDKVF
AAL183W            CGCFAGGLFGYVCYDVTHYFLHHHKLPPFMRKLKKYHLEHHYKNYELGFGVTSWYWDKVF
                      ****: **  **  *: :** .:*  :. :*: *:******::*.:*::.  **  *

Kpol_1069.4        GTYLDPKTIPYARSKRTT
TBLA0D03180        GTYLYPDS-PLSPMKYE-
Kpol_541.9         GTYLGPDS-PASIMRYK-
TPHA0C04710        GTYLGPDS-PASIMRTK-
KAFR0B03850        GTYLSKDA-PASVMKFD-
KNAG0J00320        DTYLGKDA-PISPMKYD-
TDEL0B00680        GTYLSPTS-PISQMKYD-
Suva_13.460        GTYLGPDA-PLSKMKYE-
Skud_13.444        GTYLGPDA-PLSKMKYE-
Smik_13.485        GTYLGPDA-PLSKMKYE-
YMR272C            GTYLGPDA-PLSKMKYE-
ZYRO0G13948g       GTYLGPDA-PLAHMKYD-
KLTH0C04114g       GTYLGDNA-PLSQMKFD-
Kwal_27.10332      GTYLAENA-PLSQMKFD-
KLLA0D01639g       GTYLGENA-PLSNMKYD-
SAKL0D01760g       GTYLGSDA-PLSKMKYE-
CAGL0F03399g       GTYLGPDA-PLSKMKYE-
NDAI0K00470        GTYLSPDS-PMSKMKYE-
NCAS0C00470        GTYLSPDS-PLSKMKYQ-
Ecym_2712          NTYLSPTA-PLSRAKYD-
AAL183W            GTYLASNS-PVSRPKCE-
                   .***   : * :  .   

FASTA FORMAT for MUSCLE Version 3.6

>Kpol_1069.4
------------------------------------------------------------
---------------------MKIEESIETYIH---------------------------
----------------------------------------------------IRKTTLTE
EKLKVTTDYNKDFNENGFLKLDEPLFWQLLSSNFTRDFYIDQVHKPRHYGIESAPIFGN-
FLEPFTKTHWFMVPLIWGPVVLYNFIVSLREISIILAITLFSIGVFVWTLIEYCMHRYLF
HLDDSVPETRLFFVLHFLLHGIHHYLPMDKYRLVMPPALFSILCYPFYLLTFAIFPRYWA
HAGFAGGLFGYVCYDVTHYFLHHKKMPSFMRKVKKYHLEHHYKNFQLGFGVTSSFWDRVF
GTYLDPKTIPYARSKRTT
>TBLA0D03180
--------------------------------MPASPSTATKTDTVGTSSSPLTKELFSL
ESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPK--GNSKIIDFAGKDITSSFKNQERYNH
DPETYDFMSHNDKYLVGYLANEEEAYKLLSNPSHKVEVKLTE-QPSTYDSTTFVKELPSE
DHFVIATDYKKDFNEHHFLDLEKPLIPQLWRAKFNRAFYIDQIHRPRHFGNKSAPLFGN-
FLEPLTKTAWWVIPVVWLPVVFYHLKVAFHNMNNIFATFLFCVGVFVWTLIEYSLHRFLF
HMDNRIPDHPMFYVLHFTIHGCHHYLPMDPYRLVMPPTLFLILCTPFYKLVFSVLPLYWA
YAGFAGGLFGYVCYDEVHYWLHHSRVPKFMRLLKKLHLEHHYKNYQLAFGVSNYFWDKVF
GTYLYPDS-PLSPMKYE-
>Kpol_541.9
----------------------------------------------MSAKDSKTLELFAK
SRFEEHNTEADCWVSVKERLIYDVSSYLKDNAD--ADSSILEHAGKDITKLTKTRE----
----FKFIS-D-EYLVGYLATEEEEVRLLTNKDHKVEVNLQD---GTYDSTVFVKELPAE
EKFTVATDLGKDFQDHHFLDLNKPMLWQVLFGNFTRDFYIDQVHRPRHYGKGSAPLFGN-
FLEPISLTPWWLIPIIWGPVVVYHLSVALNNMNNIFAGFLFCLGIFVWTLIEYCLHRFLF
HLDDWVPQHNIFYTLHFLLHGVHHYLPMDQYRLVVPPALFLVLCTPIYKLVFGLLPLYWA
YAGFAGGLLGYICYDLTHYFIHHVKLPKFMRKVKKHHLEHHYKNYQLGFGVSNYFWDKVF
GTYLGPDS-PASIMRYK-
>TPHA0C04710
---------------------------------------------MAESNPSKTLELFSS
EKFQSHNTEDDCWVSVKDRLIYDVSKFVQENKDVPVEDAVLKRAGKDISDLLETK-----
---SFKFVD-D-KYLVGYLANSTEEARLLTNKDHKVEVNLKD---GTYDSTVFVKELPSE
EHFTISTDYKKDFVDHHFLDLEKPLLMQMLTGNFTREFYIDQIHRPRHYGKGSAKLFGN-
WLEPISLTPWWLIPIIWGPVVVYHFYVGAQHMHPLSAVFFYFLGIFVWTFIEYCLHRFLF
HLDDWVPQHNFFYTIHFLLHGVHHYLPMDQYRLVVPPALFVVLCTPFYKAVFALLPLYVA
YVGFAGGLTGYIIYDLTHYFIHHVKLPRVFRKIKKHHLEHHYKNYQLGFGVSNYFWDLVF
GTYLGPDS-PASIMRTK-
>KAFR0B03850
------------------------------------------------MTTAKTLELFSK
KEVANHTKREDCWVTIFSRKIYDVTKFLDENRD--FDSLLLDYAGTDITDELVNGKLDEK
----YKALDND-NYLVGYVATADEEQKLLTNKDHKVEVTLEQ----DFDLATLVVELPPE
EKLTIATNYDRDFKKHKFLDLNKPLLPQILKGKFTREFYVDQINRPRHYGQKSAPLFGNA
FLEPFSKTAWWVVPTFWLPVVFHFFRVALKNMNNPLALFLFCVGVFVWTLLEYCLHRFLF
HFDNYLPENNIAFALHFLLHGFHHYLPMDPYRLVVPPALFIILCAPIYKTVFLLLPYYWA
CAGFAGGLFGYVYYDMCHYALHHSKLPPFMRRLKQYHLEHHYKNYELGYGITSWFWDKVF
GTYLSKDA-PASVMKFD-
>KNAG0J00320
-----------------------------------------------MSSNSRTLELVSK
DTVASHNQKNDAWVVVQGRKVVDISAYIRERPE--KEELLLSLAGKDITDRSHE------
----FPGLNAD-DHLVGYLATDLEEKELLSNKDHKVEVKLEG--GETFDSSTFVKDLPTE
DKLSIATDTKRDYQKHHFLDLEKPLIPQVLFGSFTKDFYVDQIHRPRHYGKGSAPLFGN-
FLEPISKTAWYVVPIVWGPVVLYFLGRSLKGIHPIFALMLFALGGFVWTLIEYCMHRFLF
HFDDWLPENNVAFTIHFLLHGVHHYLPMDGYRLVVPPALFVVLCTPFYKLVFKLLPHYVA
CAGFAGGMFGYICYDLIHYFLHHSKMPKFMRKLKQYHLEHHYKNYQLGFGVSNWFWDKVF
DTYLGKDA-PISPMKYD-
>TDEL0B00680
----------------------------------------------MSQDQSKTLELFSR
KQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPG--GPQYILDYAGKDITEVLKDSTIHEH
SESAYEILE-DSSYLVGYMATELEEKELLTNSSHKVEVKLAT---LDFDSTTFVKDLPTE
EKLSIATDYSRDYKRHHFLDLQKPLLPQVMFGKFTKDFYVDQIHRPRHYGKGSAPLFGN-
FLEPLSKTSWYVIPMVWLPVVLYHVGVAFKNMNPIFTIFFFCLGTFVWTLIEYGLHRFLF
HFDDWLPESNVCFTLHFLLHGVHHYLPMDKYRLVMPPTLFVILCTPFYKLVFGLLPLYVA
YAGFAGGLFGYVCYDLTHYFLHHSKLPSFMRKLKKYHLEHHYKNYQLGFGVTSWFWDKVF
GTYLSPTS-PISQMKYD-
>Suva_13.460
----------------------------------------------MSTNTSKTLELFSK
KTVEEHNTAKDCWVTYQNRKIYDVTKFLSEHPG--GEESILDYAGKDITEVMKDSDVHEH
SESAYEILE-D-EYLVGYLATDEEATRLLTNKNHKVEVQLSA-DGTEFDSTTFVKDLPTE
EKLSIATDYGSDYKKHKFLDLNKPLLMQILRSDFTRDFYVDQIHRPRHYGKGSAPLFGN-
FLEPLTKTAWWVVPVAWVPVVVYHMGVALKNMNPLFACFLFGVGMFVWTLIEYSLHRFLF
HFDDWLPESNIAFATHFLLHGCHHYLPMDGYRLVMPPSLFVILCAPFYKLVFALLPLYWA
YAGFAGGLFGYVCYDECHYFIHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVTSWFWDDVF
GTYLGPDA-PLSKMKYE-
>Skud_13.444
----------------------------------------------MSTNTSKTLELFSR
KTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPG--GDESILDYAGKDVTEIMKDSDVHEH
SDSAYEILE-D-EYLIGYLATDEEATRLLTNKSHKVEVQLSA-DGKEFDSTTFVKNLPTE
EKLSIATDYGNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGKGSAPLFGN-
FLEPLTKTAWWVVPLPWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWTLIEYGLHRFLF
HFDDWLPESNVAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVFALLPLYWA
YAGFAGGLFGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVTSWFWDEVF
GTYLGPDA-PLSKMKYE-
>Smik_13.485
----------------------------------------------MSANTSKTLELFSK
KTVEKHNTAKDCWVTYQNRKIYDVTKFLSEHPG--GDESILDYAGKDITEVMKDTDVHEH
SDSAYEILE-D-EYLIGYLATDEEAARLLTNKNHKVEVQLSS-DGTEFDSTTFVKDLPAE
EKLSIATDYGNDYKKHKFLDLNRPLLMQILCSDFKKDFYVDQIHRPRHYGKGSAPLFGN-
FLEPLTKTAWWVVPTAWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWTLIEYGLHRFLF
HFDDWLPESNIAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVFALLPLYWA
YAGFAGGLFGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVTSWFWDEVF
GTYLGPDA-PLSKMKYE-
>YMR272C
----------------------------------------------MSTNTSKTLELFSK
KTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPG--GDESILDYAGKDITEIMKDSDVHEH
SDSAYEILE-D-EYLIGYLATDEEAARLLTNKNHKVEVQLSA-DGTEFDSTTFVKELPAE
EKLSIATDYSNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGKGSAPLFGN-
FLEPLTKTAWWVVPVAWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWTLIEYGLHRFLF
HFDDWLPESNIAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVFALLPLYWA
YAGFAGGLFGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVTSWFWDEVF
GTYLGPDA-PLSKMKYE-
>ZYRO0G13948g
-----------------------------------------------MSTKSPTLQLFSQ
EQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPG--GAEYILKYAGRDITEVLKDRDVHEH
SESAYEILD-D-NYLVGYLATKEEATKLLTNKKHQVEVHLTDQNNSDFDSTTFVPELPAE
EKLNIATDYGRDYKKHKFLDLNRALLPQVMFGNFSKDFYLDQVHRPRHYGKGSAPLFGN-
FLEPISKTPWWAIPIIWIPVVSFHFYVGFTNMNKLFSTFLFCLGIFVWTLIEYCLHRFLF
HLDEWLPDNNAALTLHFLLHGVHHYLPMDRYRLVMPPTLGIVLMAPIYKTVFGLLPTYWA
YSGFAGGLFGYVCYDLTHYFLHHAKLPSYMRKLKKYHLEHHYKNYQLGFGVTSWFWDNVF
GTYLGPDA-PLAHMKYD-
>KLTH0C04114g
-------------------------------------------------METKTLPLYSQ
SQLEQHNTRDDCWVSLHHRKIYNVTSFLDEHPG--GAELIEEYAGKDVTEIMKDGPTHEH
SYVAYEVLD-E-EYHVGYLATPEEEKKLLGNPEHPVEVKLEE----DYDSTVFVPEVPPE
EKLSIVTDYTKDYGRHKFLDLNRPLLMQMLTSDFSKEFYLDQVHRPRHYGRGSAPLFGN-
FLEPLSKTAWYVIPLVWFPVVVYHMYTALQNMNNVLAVFLFCLGVFVWTLIEYGLHRFLF
HLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMPPTLFVVLCTPFYKLVFALLPKYWA
CAGFAGGMFGYMCYDLTHYFLHHAKLPSYMRKLKKYHMEHHYKNYELGFGVTSWFWDKVF
GTYLGDNA-PLSQMKFD-
>Kwal_27.10332
-------------------------------------------------METKTLPLYSA
SQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPG--GGDLIVEYAGKDITEVMKDGPLHSH
SFVAYEVLD-E-EYHVGYLATAEEEQKLLGNSKHKVEVKLED----EYDSTVFVPEVPAE
EKLSIVTDYTRDYGRHKFLDLNRPLLMQMLTADFTKEFYLDQVHRPRHYGRGSAPLFGN-
FLEPLSKTSWYVIPIVWLPVVAYHIFTAMQNMNKLFAVFLFFVGIFVWTLIEYGMHRFLF
HLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMPPTLFLLLCTPFYKLVFALLPYYWA
CAGFAGGMLGYVCYDLTHYFLHHAKLPGILKKLKKYHMEHHYKNYELGFGVTSWVWDKVF
GTYLAENA-PLSQMKFD-
>KLLA0D01639g
------------------------------------------------MSSSRILPLYSK
TDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPG--GAEYILDYAGTDITDVMKDVLTHEH
SESAYEIMD-E-SYLVGYLATEEEEKKLLTNKDHVVEVNLKG--NNEFDSTVFVKELPTE
DKLSIATDYQNDYKKHKFLDLNKPLLWQVLFGKFTKDFYLDQVHRPRHYGKGSAPLFGN-
FLEPLSKTPWWMVPVVWLPVVTYHIYTALMNMNQAFAIFLFAVGVFVWTLIEYGLHRFLF
HLDDRLPEKQWAFTLHFLLHGVHHYLPMDRFRLVMPPTLFVVLCTPFYKLVFALLPYYWA
CAGFAGGMLGYVCYDLTHYFLHHSQLPPYMRKLKKYHLEHHYKNYELGFGVTSWFWDKVF
GTYLGENA-PLSNMKYD-
>SAKL0D01760g
------------------------------------------------MSESKTLPLLSK
TQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPG--GDQYILDHAGEDITEIMKDKLVHEH
SESAYEIMN-D-MYLVGYLANEEEEKKLLTNEDHTVEVKLNE--STQFDSTTFVKELPTE
DKLSIATDYSSDYKKHKFLDLDKPLLWQVVFGNFTKDFYLDQVHRPRHYGKGSAPLFGN-
FLEPLSKTPWYAIPIAWLPVVFYHLYVALTNMNKPFALFLFSLGVFVWTLIEYCLHRFLF
HLDQYLPERQLAFALHFLLHGVHHYLPMDRYRLVMPPTLFVLLCTPFYKLVFSLLPYYWA
CAGFAGGMLGYTCYDLTHYFLHHAKLPPYMRKLKKYHLEHHYKNYELGFGVTSWFWDKVF
GTYLGSDA-PLSKMKYE-
>CAGL0F03399g
--------------------------------------------MSVAADSSKTLELFPQ
SVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPE-EADAVHKALDGKHGTDISQMELT---
---TLKFVT-D-DYLVGYLATSDEEKKLLTNKSHKVEVKLNA--DNTFDSTTFVKDLPTE
DKLSITTDYERDYKKHKFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGKGSAPLFGN-
FLEAFTKTAWWVVPTVWGPVVLYFITTALMNMNNPLALFLFGLGIFVWTLIEYCLHRFLF
HFDEWLPEHSMFFMIHFLLHGCHHYLPMDAYRLVVPPALFVVLCAPIYKLVFAALPYYWA
CAGFAGGMLGYICYDLCHYFLHHSKMPPFMRKLKKYHLEHHYKNYQLGFGVTSWFWDKVF
GTYLGPDA-PLSKMKYE-
>NDAI0K00470
----------------------------------------------MSINTSKTLELFSK
DKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDITDELKDK-IDSI
KNPSFPILQTD-QYLIGYLATDHEEKTLLTNKDHKVEVQLNE-ATNGFDSTTFVKDLPTE
DKLSIATDTKKDLEKHKFLDLDKPLLKQILFGNFTKDFYLDQIHRPRHYGDKSAPLFGN-
ILEPLTKTSWYLVPIFWLPVVFYHIAVALTNMNPIFAIVLFAIGIYVWTLIEYCMHRFLF
HFDERLPEHNIFYVIHFLLHGCHHYLPMDKYRLVVPPTLFIFLCFPFYKVVFKLLPLYWA
YAGFAGGLFGYVCYDLCHYFLHHSKMPPPLRKLKKYHLEHHYKNYQLGYGVTSWYWDKIF
GTYLSPDS-PMSKMKYE-
>NCAS0C00470
MAFTYVWINEKVIIYIMSTFSLSSQFVGSFSIFRNTPAKLTTRRNQMSSNVSKTLELFSK
DQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPD--GDKSILKHAGKDITELLKDEKIDQQ
T----DLLD-D-QYLIGYMATDAEEEKLLTNKDHKVEVKLNE-STNTFDSTTFVKDLPTE
DKLSIATDYEKDLKKHNFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGQESAPLFGN-
FLEPFTKTAWYLVPIAWLPVVFYHIALAFKNINALFAIMLFCIGVYVWTFIEYCMHRFLF
HFDERLPEHNFAYMIHFLLHGCHHYLPMDKYRLVVPPVLFIFLCAPFYKLVFALLPYYWA
CAGFAGGMFGYICYDLCHYFLHHSKLPPFMRKLKKYHLEHHYKNYQLGYGVTSWYWDKKF
GTYLSPDS-PLSKMKYQ-
>Ecym_2712
-----------------------------------------------MSSSCKTLPLYSK
SEFEKHVKPNQCWVSIDQRKIYNVSKFLDENPE--GYQYVLDHAGQDVTQLLKDMQTDEP
TDLAHQLLS-D-AYLIGYLATSEEERKLLTNANHVVEVKPAN--GNRVDSG-FVKKLPTE
EKLAIATDFKTDYEKHHFLDLDKPLFMQVLFGNFTKEFYIDQVHRPRHYGKESAPLFGN-
FLEPLSKTSWWVIPIVWYPCVIYYIRTALLNISTPLALFLFGVGVFVWTLIEYGLHRFLF
HFDDRMPESNIVFTLHFLLHGIHHYLPMDKYRLVMPPALFLALCYPFYKLVFSILPYYCA
CAGFAGGLFGYVGYDVTHYFLHHRKLPPFMRKLKKYHLEHHYKNYELGFGVTSWYWDKVF
NTYLSPTA-PLSRAKYD-
>AAL183W
-------------------------------------------------MVSKTLPLYSK
ATLQKHTDRTSCWVSVGNRKIYDVSQFLDEHPG--GDQYILDYAGKDITAVLKDKLIHEH
TEAAYEILD-E-SYLVGYLATEEEEIKLLTNEKHVMEVTPEN-----LDTTTFVKELPAE
EVLSVATDFGTDYTKHHFLDLNKPLLMQVLRGNFTRDFYIDQIHRPRHYGKGSAPLFGN-
FLEPLSKTVWWVVPMVWYPVVLYYLTRALQNMPAHLALTCFAAGVFVWTLIEYSLHRFLF
HFDDNMPESNIAFTVHFLLHGVHHYLPMDKYRLVMPPALFVVLCAPFYRLVFSIFPEYCA
CGCFAGGLFGYVCYDVTHYFLHHHKLPPFMRKLKKYHLEHHYKNYELGFGVTSWYWDKVF
GTYLASNS-PVSRPKCE-