MUSCLE (3.8) multiple sequence alignment

KLTH0E04048g       --------------MLAQSFALCALLLQ-----PILGIDLDTSDSSSICDATSLIQGGIM
Kwal_55.20266      --------------MVLQLMALGALGAV--FTSQVSAIDLDTSSKDSICDATSLIQKGVM
KLLA0F24926g       -----------------MKISPLYSLFL--TVVSVLAIDLDTSSKSSICTATALIQQGIS
KNAG0J00700        MRAKLSSITSTGAPFTTLTTLASLTLFT--LFTGASALSLDP-----VCSATALVTDGLL
ZYRO0F12210g       ----------------MLLHNILVWLVF--SLSPIWAVDLQVGDKDSVCSATALIQQGML
TPHA0J01600        -----------------MFYLTLLGLIS--QILYASAITLDVDSKDSVCEATALIQKGML
TBLA0B03320        ----------------MILNELILSALS--FVSFTFAMDLDTSSKESICGATSLIIKGML
KAFR0B03490        -------------------MMITLLFPL--LLTVAKAIDLDTSSKTSICDATALIQDGML
SAKL0B05412g       -----------------MISLLISLIYM--SLNIVHAIDLDTSSKDSICYATSLIQKGML
Kpol_1030.20       ---------------MVLLLTVLLQAFN--FITTVTAIDLDVNSKDSICAATSLIQGGML
CAGL0M05049g       ---------------MKLLFSLQLWVLIGTLFPDAGAINLQ-DNKDSICAATALIQGGML
TDEL0B03360        -----------------------------------MGLDLDPSSKDSICYATALIQKGML
Suva_13.422        ---------MIVKASMKIALPLCFTLLS--FFKATDAMDLDTTSATSICDATALIQDGML
YMR238W            ---------MIVNISAKMILSICFTFLS--FFKATHAMDLDTTSKTSICDATALIQGGML
Skud_13.407        ---------MIVDSSMRMIPFICFTFLS--FVGISHAMDLDTTSKTSICDATALIQDGML
Smik_13.446        ---------MILKSSMEMIPLICFTLLS--FFRICHAMELDSTSKTSICDATALIQDGML
NCAS0C00810        -----------------MLHVWISFVLL--LPLLVQSIDLDVTSKDSICAATALIQKGML
NDAI0K00840        ---------MVRLLRRPSLYFHFFQLLL--TVHNTQAIDLDITSKESICDATSLIQGGMM
AFR530W            ----------MYLSAGMTGLLVGLFLLM--QGMLSRALDLDLSSREDVCHFTNEIQKGIM
Ecym_1474          --------------MRIIVQLYSLLLLI--CVPVCGGLQLDVKSKDSICAATQKIQRGIM
                                                       .: *:      :*  *  :  *: 

KLTH0E04048g       DYYAGTRIGGTVGMFQQPYYWWEAGEVFGGMLENWFLCQNDTYHDIIYDAMIHQAGPDYD
Kwal_55.20266      DYYEGNRFGGTVGMFQQPYYWWEAGEVFGGMMENWFLCQNDTYEKTLYDAMIAQAGPDYD
KLLA0F24926g       DYYEGDVYGGTVGMFVSPYYWWEAGLVFGGMIENWYLCQNTSYEDMLYDALMAQTGSDYD
KNAG0J00700        DYYSGTRYGGTVGMFQPPYYWWHAGEAFGGMIENWFLCQNSTYETLLMDAFIAQTGNNYD
ZYRO0F12210g       DYYAGDKYGGAIGMFQPPYYWWQAGEAFGGMIDNWHFCKNNTFEELIREAMLTQAGPHYD
TPHA0J01600        DYYQGTRYGGTVGMFQPPYYWWEAGEAFGGMLENWYLCQNDTFESLISDALIYQAGSNYD
TBLA0B03320        DYYWGTQYGGTVGMFQPPYYWWEAGEAFGGMLENWYLCQNDTYADLLFDALTAQTGPDYD
KAFR0B03490        DYYEGIRYGGTVGMFQSPYYWWEAGEAFGGMLENWFLCENDTFKEIIYDAILAQTGSDYD
SAKL0B05412g       DYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDNIYLCDNETYKDLIYDAMIAQTGENYD
Kpol_1030.20       DYYEGTRYGGTVGMFQPPYYWWEAGEAFGGMIENWFLCQNDTYHDIIYDALLAQTGSNYD
CAGL0M05049g       DYYEGTRYGGTVGMFQPPYYWWQAGVAFGGMLENWFLCQNDTYKDLLMNALVAQTGPNYD
TDEL0B03360        DYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNWYFCENTTFESLIYDGMLAQTGPHYD
Suva_13.422        DYYEGTRYGGTVGMFQSPYYWWHAGEAFGGMVENWYLCQNDTYQVLLYDALLAQTGADYD
YMR238W            DYYEGTRYGGTVGMFQSPYYWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYD
Skud_13.407        DYYDGTRYGGAVGMFQSPYYWWHAGEAFGGMLENWFLCENETYQELLYDALLAQTGSNYD
Smik_13.446        DYYEGTRYGGAVGMFQSPYYWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYD
NCAS0C00810        DYYEGERYGGAVGMFQPPYYWWNGGVAFGGMLENMYLCENNTFESLLMDALVAQTGDNYD
NDAI0K00840        DYYWGTQYGGTVGMFQPPYYWWEAGEAFGGMIENWYLCQNDTYEDMLKSALLAQTGSNYD
AFR530W            DYYWGSKYGGIVGMFQPPYYWWEAGEVFGGMLENWYLCDNQEYESVLRESMIAQTGDKFD
Ecym_1474          DYYWGSTPGGIVGMFIQPYYWWEAGLVFAGMLENWYLCDNMEYNSTLYESMIAQTGANYD
                   *** *   ** :***  ***** .* .*.**::* .:*.*  :   : ..:  *:*  :*

KLTH0E04048g       FMPSNQSMVEGNDDQGVWGLTVMSAAERNFTNPTEDGVPGWLAMAQGVFNTMWMRWDSEH
Kwal_55.20266      FMPSNQSMVEGNDDQGVWGLTLMSAVERNFTNPTEKGVPGWLAMVQGVFNTMWSRWDSDH
KLLA0F24926g       YMPSNQTMVEGNDDQGVWALTVMTAVERNFTNPKEDGTPGWLAMVQAVFNQMYSRWDSDH
KNAG0J00700        YIPENQTMVEGNDDQGIWGLTIMDAVERNFTKPTKDGVPGWLAMSQAVFNTMWARWDTQH
ZYRO0F12210g       YMPQNQTMVEGNDDQGVWGLTVMEAVERNFTDPGD-GKPGWLAMAQAVFNEINERWDDKS
TPHA0J01600        YIPSNQTLVEGNDDQGVWGLTVLGAVERNL--PDRDGVPGWLAISQAVFNTMYARWDTAY
TBLA0B03320        YIPQNQTMVEGNDDQCIWGLTVMDAVERNFTNPTE-G-PGWLAMGQAVFNTMWSRWDAAD
KAFR0B03490        FMPENQTMVEGNDDQCVWGLTIMDAVERNFTDPTD-GSPGWLYMTQAIFNEMWSRWDSAN
SAKL0B05412g       YIPANQSMVEGNDDQGVWGITIMGAVERNFTNPTKEGVPGWLAMVQAVFNTMYARWDSQH
Kpol_1030.20       YVPANQTFVEVMMIK-VFGGTVMDAAERNFTAPSD-GKPDWLAMAQAVFNTMYARWDSAN
CAGL0M05049g       YIPANQTTVEGNDDQGVWGLTILDAVERNFSAPID-GKPGWLAMSQGIFNTMYARWDMQS
TDEL0B03360        YMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPTN-GAPGWLAMAQAIFNQLNSRWDTAN
Suva_13.422        YIPANQTMVEGNDDQGIWGITVMGAVERNFTNPDN-GAPGWLAMVQAVFNTMYSRWDSEN
YMR238W            YIPSNQTMVEGNDDQGIWGITVMGAVERNFTDPGD-GKPGWLAMVQAVFNTMYSRWDSEH
Skud_13.407        YIPANQTMVEGNDDQGIWGITVMGAVERNFTDPDE-GKPGWLAMVQAVFNTMYSRWDSEH
Smik_13.446        YIPANQTMVEGNDDQGIWGITVMGAVERNFTDPSD-GKPGWLAMVQAVFNTMYSRWDSEH
NCAS0C00810        YIPSNQSMVEGNDDQGVWGLTIMDAVERNFTAPNKSGVPGWLAMAQAVFNTMYARWDPDH
NDAI0K00840        YIPANQSMVEGNDDQGVWGLTLMGAAERNFTDPDD-GTPGWLAMTQAVFNTMNARWDSAH
AFR530W            YIPANQSTTEGNDDQGVWALFIMGAVERNFKDPEKEGMPGWLTMVQTVFNKMEARWDAEN
Ecym_1474          YIPSNQSMTEGNDDQGIWGLFIMGAVERNFPDAQMGNVPGWLTMAQAVFNTMYARWDSQH
                   ::* **: .*    : ::.  :: *.***:  .   . *.** : * :** :  ***   

KLTH0E04048g       CGGGVRWQIFTWNSGYNYKNTVSNACMFQLAARLGRYTGNDTYLTKAETVWDWLVDVGFV
Kwal_55.20266      CGGGLRWQIFTWNSGYNYKNTVSNACLFQLAARLGRYTGNETYLTKAETVWNWLVDIGFV
KLLA0F24926g       CNGGLRWQIFTWNSGYNYKNTISNGCLFQLAARLGRYTGNTTYLEVAEKVFDWLVDIDFV
KNAG0J00700        CGGGLRWQIFTWNSGYNYKNTISNACLFNLAARLGRYTGNSTYLDVADQVFDWMVSVGYV
ZYRO0F12210g       CAGGVRWQIFTWNSGYNYKNTISNGCYFQLAARLGRYTNNQTYLEVAEKVFDWLTDVGFV
TPHA0J01600        CGGGLRWQIYTWNSGYNYKNTISNACLFQIAARLGRYTGNNTYLEVAEKVFDWMVDVEYI
TBLA0B03320        CGGGLRWQIFTWNSGYDYKNTISNACLFQMAARLGRYTGNNTYLDVANDVFDWLTGVGYV
KAFR0B03490        CGGGLRWQIFTWNSGYDYKSTISNVCLFQLASRLGRYTGNDTYLDVAESVYDWLVDVGFI
SAKL0B05412g       CGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARLGRYTGNDTYLEVASKVWDWLEDVGFV
Kpol_1030.20       CGGGLRWQIYTWNSGYNYKNTVSNACLFQIAARLGRYTGNDTYLEVAEKVFDWLVDVNFV
CAGL0M05049g       CNGGLRWQIFTWNSGYNYKNTISNACLFQIAARLGRYTGNTTYLDVAERVFDWLVGVGYI
TDEL0B03360        CGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGRYTGNDTYLEVAENVFDWLVDVGYV
Suva_13.422        CGGGLRWQIFTWNSGYNYKNTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYV
YMR238W            CGGGLRWQIFTWNSGYNYKNTVSNACLFQIAARLGRYTGNTTYLEVAEQVFDWLVDVGYV
Skud_13.407        CGGGLRWQIFTWNSGYNYKNTVSNACLFQIAARLGRYTGNSTYLDVAEQVFDWLVDVGYV
Smik_13.446        CGGGLRWQIFTWNSGYNYKNTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYV
NCAS0C00810        CGGGLRWQIFTWNSGYNYKNTIANACLFQMAARLGRYTGNQTYLDVAEKVFDWMVDINYI
NDAI0K00840        CGGGLRWQIFTWNSGYNYKNTISNACLFQLAARLGRYTGNTTYLEVAEKVFTWLVDVGYV
AFR530W            CGGGLRWQIFQWNNGYTYKNTIANGCLFQLAARLGRYTGNQTYLDVASKVFQWLVDVKYI
Ecym_1474          CGGGLRWQIFTWNLGYDYKNTIANGCLFQLAARLGRYTGNSTYLDIANETFSWLVDVKFV
                   * **:****: ** ** **.*::* * *::*:******.* ***  *. .: *: .: ::

KLTH0E04048g       -VLNENGNANVYDGANIDDNCTDIVKNEWSYNQGIVLGGAAYMYNATQNDTSVWKSRLDQ
Kwal_55.20266      -RFNESGNANVYDGATIDKNCTDIVEIEWSYNQGIVLGGAAYMYNATHNGTSDWESRLNQ
KLLA0F24926g       -VMKEE--ANVFDGATIDDNCTSIVKYEWSYNHGVVLGGCAYMYNAT-NGSDVWQTRTEQ
KNAG0J00700        -VLGDT--ANVFDGANIEDNCTTITTFEWSYNHGVVLGGTAFMYNAT-NGSSVWEDRVNR
ZYRO0F12210g       -VLKDK--GNVFDGAVTDDNCTQVTELEWTYNHGIILGGSAYMYNAT-NGSSKWEERVNQ
TPHA0J01600        -VLKDV--ANVYDGATTNYNCSDIVQYEWSYNHGVVLGGLAYMYNAT-NGTSKWETALTQ
TBLA0B03320        -NMDNA--AEVYDGADISENCTDITKYQWSYNNGCMLGGAAYMYNAT-NGSSIWETRVTQ
KAFR0B03490        NVANGT--AYVYDGADISENCTDITTIDWSYNHGILLGGAAYAYNAT-NGSSVWESRVTD
SAKL0B05412g       -VLQDK--ANVFDGANIENNCSSIVKIEWTYNHGVVLGGAAYMYNAT-NGSDIWQTRLTQ
Kpol_1030.20       -VLNDE--ANVFDGANITSNCSAVVKLEWSYNHGIVLGGLAYMYNAT-NGTSKWESGLTK
CAGL0M05049g       -VLSEK--GNVYDGAKVEDNCTDITAIEWTYNHGVVLGGLAYMYNAT-NGSSVWQSRLTS
TDEL0B03360        -VLKDV--GNVFDGAEIDNNCTSINKLEWSYNHGVVLGGLAFMYNAT-NGSSEWETRVTQ
Suva_13.422        -VLNDT--ANVYDGAEIDTNCTDITKIEWTYNHGIVLGGMAYMYNAT-NGTSEWKTSLQQ
YMR238W            -VLNDT--ANVFDGAEIDTNCTDITKIEWTYNHGIVLGGLAYMYNAT-NGTGEWETSLTK
Skud_13.407        -VLNDT--ANVFDGAEIDTNCTDITKIEWTYNHGIVLGGLAYMYNAT-NGTSEWETRLTQ
Smik_13.446        -VLNDT--ANVFDGAEIDTNCTDITKIEWTYNHGIVLGGLAYMYNAT-NGTSEWETSLTK
NCAS0C00810        -VLNDK--ANVFDGADIDENCTDITTLEWTYNHGVVLGGCAYMYNAT-NGSSTWETRVNK
NDAI0K00840        -LLDDT--ANVFDGAEIDSNCTDMTQIEWTYNHGVVLGGAAYMYNAT-NGSSDWESRVTK
AFR530W            -VLEDK--ARVFDGAHIHENCSDIKGIEWSYNHGIILAGAAYMYNAT-GGSPEWESHVTK
Ecym_1474          -VLKDE--ANVFDGAHIGDNCQDIKGIEWTYNHGVILGGCAYMYNAT-NGDPVWETRLRQ
                           . *:***    **  :   :*:**:* :*.* *: **** ..   *:     

KLTH0E04048g       IVGGSTEFFFK-DKVMYESTCQDSK--TCNQDQRSFKSIFSRMLSLTRSLAPYTAETIDP
Kwal_55.20266      IVGGSTDIFFR-NKIMYEATCQDSG--KCNQDQRSFKSIFSRMLSLTRTLAPYTADKIDP
KLLA0F24926g       ILGGATSFFFE-DDIMYESTCQASN--KCNTDQRVFKAIFSRMLGYTSVLAPFTTDTITP
KNAG0J00700        ILKGATTYFFR-DSIMFESACQDTG--KCNNDQRTFKAIFSRMLSFTAVLVPSTASTIDP
ZYRO0F12210g       ILNGASDYFFQ-DNVMYESGCQHGDSSNCNNDQRSFKSIFSRMLGLTSVLVPSVSDKVDQ
TPHA0J01600        VLSGATTYFFK-NNIMYESACQEAK--TCNTDQRSFKSIFSRMLGYTRVLAPYTAATLDT
TBLA0B03320        LLNGAKAYFFQ-DDIMYESACQTAK--TCNNDQRSFKSLFSRMLGFTSVLVPSTRDIIDP
KAFR0B03490        IVEGAKSIFFS-DGIMYESACQDYD--TCNNDQRSFKSIFSRMLGFTSVLAPFTASTIDP
SAKL0B05412g       VLDGAVEFFFN-NSIMYERACQGSG--TCNNDQRSFKSIFSRMLGLTSVLAPFTRDTIDP
Kpol_1030.20       VLNGAKSIFFK-NNIMYEQACQDHN--TCNTDQRSFKSIFSRMLGLTSVLAPYTSDTITP
CAGL0M05049g       VLGGATAYFFQ-DDIMYESACQPYK--TCNNDQRCFKSIFSRMLGFTSVLAPFTSDTIDP
TDEL0B03360        ILGGAESYFFK-DSIMYESLCQGDGTSTCNSDQRSFKAIFSRMLGLTSVLVPSTQSKVDD
Suva_13.422        VLNGAASYFFK-DGIMYESACQDYG--TCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDA
YMR238W            ILNGAKSYFFK-DSIMYESACQDYG--TCNTDQRTFKSIFSRMLGLTSVMAPFTRDTIDD
Skud_13.407        ILNGAKAYFFK-DTIMYESACQDYS--TCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDD
Smik_13.446        ILNGAKSYFFK-DSIMYESACQDYS--TCNTDQRTFKSIFSRMLGLTSVMAPYTSDTIDD
NCAS0C00810        ILAGAQEYFFQ-DNVMLESACQSYN--TCNNDQRCFKSIFSRMLGFTSVLAPFTAETIDP
NDAI0K00840        LLKGATTYFFDSNGIMFENACQEYN--TCNNDQRSFKSIFSRMLGLTSVLAPFTSDTVDP
AFR530W            ILAGAADFYFR-DKIMYERACQDYN--TCDNDQRSFKSIFSRMLAITSVVAPFTRGTIDE
Ecym_1474          ILGGARAFFFR-NNIMYERACQDNK--ICNNDQRSFKSIFSRMLAVTSVLAPFTRETIDP
                   :: *:   :*  : :* *  **      *: *** **::*****. *  :.* .   :  

KLTH0E04048g       LMEASAEGAAKSCTGGTDGHTCGLNWQLGYHDGYYGLGEQACALEGIQSLMYSKRPA---
Kwal_55.20266      LMKASAEGAAKSCTGGTDGHTCGLNWEKGEHDGWYGLGEQACALEGIQSQLYSMRPA---
KLLA0F24926g       LIDTSAAAAAKSCSGGTDGHTCGLNWFTGDWDGQYGLGEQACALEIINQLLVHDLPA---
KNAG0J00700        LMQSSAQAAAQSCSGGTDGHTCGLNWQHSGWDGMYGLGEQMSALEVMNYLLVHDRPA---
ZYRO0F12210g       LLNASAEGAAKSCSGGIDGHTCGLNWFKGSWDNQYGLGEQMSALEVIQNTLIHNSDP---
TPHA0J01600        LIETSAKAAAGSCDGGTDGVTCGLSWFDSTNDGYYGLGEQMSALEIINQLLVSSSGAAAE
TBLA0B03320        LILASAQGAARTCNGGTDGHTCGLNWQASTHDGYYGLGEQMSALEVIQNLLIHDRPA---
KAFR0B03490        LIKSSAAACALSCDGGTDGHTCGLNWQDKTCDGNYGLGEQMSALEVIQNLLIHDRPA---
SAKL0B05412g       LIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLGEQMSALEIMQNLLIDDIPG---
Kpol_1030.20       LIQASAEGAAKSCDGGTDGHTCGLNWNLGTNDGKYGLGEQMCALEIMSNLLILNRPA---
CAGL0M05049g       LLKASAMAAAGSCDGGTDGHTCGLDWQLKTNDGYYGLGEQMSALEVIQQLLIHERPA---
TDEL0B03360        LLKQSALAAAASCSGGTDGHTCGLNWNKQANDGYYGLGEQMSALEVMQQLLIHQKAA---
Suva_13.422        LIKTSAEAAAKSCDGGTDGHTCGLDWEKETNDGYYGLGEQMSALEVIQNLLIHDRPA---
YMR238W            LIKTSAEAAAKSCNGGTDGHTCGLNWQKQTNDGYYGLGEQMSALEVIQNLLIHDRPA---
Skud_13.407        LIKTSAEAAAKSCNGGTDGHTCGLDWGKQTHDGYYGLGEQMSALEVIQNLLIHDRPA---
Smik_13.446        LIKTSAEAAAKSCDGGRDGHTCGLNWGKQTNDGYYGLGEQMNALEVIQNLLIHDRPA---
NCAS0C00810        LIKASAEAAATSCTGGKDGHTCGLDWTKGSNDGYYGLGEQMNALEIMSNLLIHDRPA---
NDAI0K00840        LIKTSAAAAAKSCTGGTDGHTCGLNWAKGSHDGYYGLGEQMCALEVMQNLLIHDRPA---
AFR530W            LIYASATAASKSCEQGTHGYTCGLNWHKGTYDGVYGLGEQASALEIIQNVLIHTKAP---
Ecym_1474          LLEASAAAAAASCSGGKDGETCGLDWTTGSWDGYYGLGEQASALEVIQNLLIHTKAP---
                   *:  ** ..: :*  *  * ****.*     *. ******  *** :.  :         

KLTH0E04048g       ---------PYTSDNGGSSVGDTEAALNSTST--NVLQSDIKITHKDKVGASIITAVILA
Kwal_55.20266      ---------PYTADNGGTSVGDTEAGLNKTST--NVLHSDLNITQKDKVGASIITAVLLA
KLLA0F24926g       ---------PLTESTGGSSSGDASAGLNVSTT--NVLQKNINITAGDKAGAGIITTIVLG
KNAG0J00700        ---------PYTAAAGGSSVGDASAGLNSTAT--NVFANSLNIRGKDKAGAAIVTTVILG
ZYRO0F12210g       ---------PYRESTGGSSKGDSAAGLNTTTT--NVLQKKLKIQSKDRAGAAIITGVVLM
TPHA0J01600        AASSGSASSPYTSSSGGNSTGDASAGLNTTST--NVLQNNLDIESKDKAGAAVATAVILA
TBLA0B03320        ---------PYTSIDGGSSEGDANAGLNKTSK--NVLSNDLDIKTGDKVGAAILTAGVLA
KAFR0B03490        ---------PYTASTGGSSVGDASAGLNTTTSSADVLENNLTITSKDRAGAAIITAVILG
SAKL0B05412g       ---------PFTADNGGSSVGDPNAGLNSSSA--NVLENNLSITHKDRVGAAIITAIVLG
Kpol_1030.20       ---------PYTMHNGGTSVGDPSAGLNATST--SVLSNNLDIKQKDRAGAAIVTAVILF
CAGL0M05049g       ---------PYRADNGGTSVGDAAAGLNSTTT--NVLKNNLKITGGDRAGAAIVTTIVLG
TDEL0B03360        ---------PFTEQTGGSSAGDANAGLNTSSA--NVLQNQLDIQTKDRAGAAIITAVILM
Suva_13.422        ---------PYKEDNGGTSKGDANAGMNSSTT--SVLQNNLNITKGDRAGAAIITAVILS
YMR238W            ---------PYKEDNGGTSKGDANAGMNSSTT--NVLQNNLNIKKGDRAGAAIITAVILS
Skud_13.407        ---------PYKESNGGTSKGDANAGMNSSTT--NVLQNNLNITKGGRAGAAIITAIILS
Smik_13.446        ---------PYKESNGGTSKGDANAGMNSSTT--NVLQNNLNIKNGDRAGAAIITAIILS
NCAS0C00810        ---------PLTANTGGTSEGDASAGLNSTTT--NVLENKLKITQGDRAGAAIVTAVILG
NDAI0K00840        ---------PLTGNTGGSSKGDALAGLNSTTT--NVLENKMTITNGDRAGAAIVTAIILG
AFR530W            ---------PLTADTGGQSEGNPDAGLDHDSQP-AILRGMHNITGKDRVGASLITAISLG
Ecym_1474          ---------PLTKNAGGTSNGDPGAGLGTPMD--NVLHSRLNIGSKDRIKAALITAVCLG
                            *     ** * *:. *.:.       ::     *   ..  *.: *   * 

KLTH0E04048g       VLVGGSIWMIF
Kwal_55.20266      VLVGGSIWMIF
KLLA0F24926g       VLVLGTVWMVL
KNAG0J00700        TLAGGSIWMLF
ZYRO0F12210g       VVVGGSVWMLF
TPHA0J01600        VLVGGSVWMLF
TBLA0B03320        ILVGGAIWMLF
KAFR0B03490        CMAGGAIWMLF
SAKL0B05412g       VMIGGSVWMVF
Kpol_1030.20       VLLGGSVWMLF
CAGL0M05049g       IIIGGAAWMMF
TDEL0B03360        VLVGGSIWMLF
Suva_13.422        VLIGGAVWMLF
YMR238W            VLTGGAVWMLF
Skud_13.407        VLIGGAVWMLF
Smik_13.446        VLIGGAVWMLF
NCAS0C00810        IFVGGAVWMLF
NDAI0K00840        VLTGGAVWMFF
AFR530W            LMLGCALWMIF
Ecym_1474          LLVGTALWMVI
                    .   : **.:

FASTA FORMAT for MUSCLE Version 3.6

>KLTH0E04048g
--------------MLAQSFALCALLLQ-----PILGIDLDTSDSSSICDATSLIQGGIM
DYYAGTRIGGTVGMFQQPYYWWEAGEVFGGMLENWFLCQNDTYHDIIYDAMIHQAGPDYD
FMPSNQSMVEGNDDQGVWGLTVMSAAERNFTNPTEDGVPGWLAMAQGVFNTMWMRWDSEH
CGGGVRWQIFTWNSGYNYKNTVSNACMFQLAARLGRYTGNDTYLTKAETVWDWLVDVGFV
-VLNENGNANVYDGANIDDNCTDIVKNEWSYNQGIVLGGAAYMYNATQNDTSVWKSRLDQ
IVGGSTEFFFK-DKVMYESTCQDSK--TCNQDQRSFKSIFSRMLSLTRSLAPYTAETIDP
LMEASAEGAAKSCTGGTDGHTCGLNWQLGYHDGYYGLGEQACALEGIQSLMYSKRPA---
---------PYTSDNGGSSVGDTEAALNSTST--NVLQSDIKITHKDKVGASIITAVILA
VLVGGSIWMIF
>Kwal_55.20266
--------------MVLQLMALGALGAV--FTSQVSAIDLDTSSKDSICDATSLIQKGVM
DYYEGNRFGGTVGMFQQPYYWWEAGEVFGGMMENWFLCQNDTYEKTLYDAMIAQAGPDYD
FMPSNQSMVEGNDDQGVWGLTLMSAVERNFTNPTEKGVPGWLAMVQGVFNTMWSRWDSDH
CGGGLRWQIFTWNSGYNYKNTVSNACLFQLAARLGRYTGNETYLTKAETVWNWLVDIGFV
-RFNESGNANVYDGATIDKNCTDIVEIEWSYNQGIVLGGAAYMYNATHNGTSDWESRLNQ
IVGGSTDIFFR-NKIMYEATCQDSG--KCNQDQRSFKSIFSRMLSLTRTLAPYTADKIDP
LMKASAEGAAKSCTGGTDGHTCGLNWEKGEHDGWYGLGEQACALEGIQSQLYSMRPA---
---------PYTADNGGTSVGDTEAGLNKTST--NVLHSDLNITQKDKVGASIITAVLLA
VLVGGSIWMIF
>KLLA0F24926g
-----------------MKISPLYSLFL--TVVSVLAIDLDTSSKSSICTATALIQQGIS
DYYEGDVYGGTVGMFVSPYYWWEAGLVFGGMIENWYLCQNTSYEDMLYDALMAQTGSDYD
YMPSNQTMVEGNDDQGVWALTVMTAVERNFTNPKEDGTPGWLAMVQAVFNQMYSRWDSDH
CNGGLRWQIFTWNSGYNYKNTISNGCLFQLAARLGRYTGNTTYLEVAEKVFDWLVDIDFV
-VMKEE--ANVFDGATIDDNCTSIVKYEWSYNHGVVLGGCAYMYNAT-NGSDVWQTRTEQ
ILGGATSFFFE-DDIMYESTCQASN--KCNTDQRVFKAIFSRMLGYTSVLAPFTTDTITP
LIDTSAAAAAKSCSGGTDGHTCGLNWFTGDWDGQYGLGEQACALEIINQLLVHDLPA---
---------PLTESTGGSSSGDASAGLNVSTT--NVLQKNINITAGDKAGAGIITTIVLG
VLVLGTVWMVL
>KNAG0J00700
MRAKLSSITSTGAPFTTLTTLASLTLFT--LFTGASALSLDP-----VCSATALVTDGLL
DYYSGTRYGGTVGMFQPPYYWWHAGEAFGGMIENWFLCQNSTYETLLMDAFIAQTGNNYD
YIPENQTMVEGNDDQGIWGLTIMDAVERNFTKPTKDGVPGWLAMSQAVFNTMWARWDTQH
CGGGLRWQIFTWNSGYNYKNTISNACLFNLAARLGRYTGNSTYLDVADQVFDWMVSVGYV
-VLGDT--ANVFDGANIEDNCTTITTFEWSYNHGVVLGGTAFMYNAT-NGSSVWEDRVNR
ILKGATTYFFR-DSIMFESACQDTG--KCNNDQRTFKAIFSRMLSFTAVLVPSTASTIDP
LMQSSAQAAAQSCSGGTDGHTCGLNWQHSGWDGMYGLGEQMSALEVMNYLLVHDRPA---
---------PYTAAAGGSSVGDASAGLNSTAT--NVFANSLNIRGKDKAGAAIVTTVILG
TLAGGSIWMLF
>ZYRO0F12210g
----------------MLLHNILVWLVF--SLSPIWAVDLQVGDKDSVCSATALIQQGML
DYYAGDKYGGAIGMFQPPYYWWQAGEAFGGMIDNWHFCKNNTFEELIREAMLTQAGPHYD
YMPQNQTMVEGNDDQGVWGLTVMEAVERNFTDPGD-GKPGWLAMAQAVFNEINERWDDKS
CAGGVRWQIFTWNSGYNYKNTISNGCYFQLAARLGRYTNNQTYLEVAEKVFDWLTDVGFV
-VLKDK--GNVFDGAVTDDNCTQVTELEWTYNHGIILGGSAYMYNAT-NGSSKWEERVNQ
ILNGASDYFFQ-DNVMYESGCQHGDSSNCNNDQRSFKSIFSRMLGLTSVLVPSVSDKVDQ
LLNASAEGAAKSCSGGIDGHTCGLNWFKGSWDNQYGLGEQMSALEVIQNTLIHNSDP---
---------PYRESTGGSSKGDSAAGLNTTTT--NVLQKKLKIQSKDRAGAAIITGVVLM
VVVGGSVWMLF
>TPHA0J01600
-----------------MFYLTLLGLIS--QILYASAITLDVDSKDSVCEATALIQKGML
DYYQGTRYGGTVGMFQPPYYWWEAGEAFGGMLENWYLCQNDTFESLISDALIYQAGSNYD
YIPSNQTLVEGNDDQGVWGLTVLGAVERNL--PDRDGVPGWLAISQAVFNTMYARWDTAY
CGGGLRWQIYTWNSGYNYKNTISNACLFQIAARLGRYTGNNTYLEVAEKVFDWMVDVEYI
-VLKDV--ANVYDGATTNYNCSDIVQYEWSYNHGVVLGGLAYMYNAT-NGTSKWETALTQ
VLSGATTYFFK-NNIMYESACQEAK--TCNTDQRSFKSIFSRMLGYTRVLAPYTAATLDT
LIETSAKAAAGSCDGGTDGVTCGLSWFDSTNDGYYGLGEQMSALEIINQLLVSSSGAAAE
AASSGSASSPYTSSSGGNSTGDASAGLNTTST--NVLQNNLDIESKDKAGAAVATAVILA
VLVGGSVWMLF
>TBLA0B03320
----------------MILNELILSALS--FVSFTFAMDLDTSSKESICGATSLIIKGML
DYYWGTQYGGTVGMFQPPYYWWEAGEAFGGMLENWYLCQNDTYADLLFDALTAQTGPDYD
YIPQNQTMVEGNDDQCIWGLTVMDAVERNFTNPTE-G-PGWLAMGQAVFNTMWSRWDAAD
CGGGLRWQIFTWNSGYDYKNTISNACLFQMAARLGRYTGNNTYLDVANDVFDWLTGVGYV
-NMDNA--AEVYDGADISENCTDITKYQWSYNNGCMLGGAAYMYNAT-NGSSIWETRVTQ
LLNGAKAYFFQ-DDIMYESACQTAK--TCNNDQRSFKSLFSRMLGFTSVLVPSTRDIIDP
LILASAQGAARTCNGGTDGHTCGLNWQASTHDGYYGLGEQMSALEVIQNLLIHDRPA---
---------PYTSIDGGSSEGDANAGLNKTSK--NVLSNDLDIKTGDKVGAAILTAGVLA
ILVGGAIWMLF
>KAFR0B03490
-------------------MMITLLFPL--LLTVAKAIDLDTSSKTSICDATALIQDGML
DYYEGIRYGGTVGMFQSPYYWWEAGEAFGGMLENWFLCENDTFKEIIYDAILAQTGSDYD
FMPENQTMVEGNDDQCVWGLTIMDAVERNFTDPTD-GSPGWLYMTQAIFNEMWSRWDSAN
CGGGLRWQIFTWNSGYDYKSTISNVCLFQLASRLGRYTGNDTYLDVAESVYDWLVDVGFI
NVANGT--AYVYDGADISENCTDITTIDWSYNHGILLGGAAYAYNAT-NGSSVWESRVTD
IVEGAKSIFFS-DGIMYESACQDYD--TCNNDQRSFKSIFSRMLGFTSVLAPFTASTIDP
LIKSSAAACALSCDGGTDGHTCGLNWQDKTCDGNYGLGEQMSALEVIQNLLIHDRPA---
---------PYTASTGGSSVGDASAGLNTTTSSADVLENNLTITSKDRAGAAIITAVILG
CMAGGAIWMLF
>SAKL0B05412g
-----------------MISLLISLIYM--SLNIVHAIDLDTSSKDSICYATSLIQKGML
DYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDNIYLCDNETYKDLIYDAMIAQTGENYD
YIPANQSMVEGNDDQGVWGITIMGAVERNFTNPTKEGVPGWLAMVQAVFNTMYARWDSQH
CGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARLGRYTGNDTYLEVASKVWDWLEDVGFV
-VLQDK--ANVFDGANIENNCSSIVKIEWTYNHGVVLGGAAYMYNAT-NGSDIWQTRLTQ
VLDGAVEFFFN-NSIMYERACQGSG--TCNNDQRSFKSIFSRMLGLTSVLAPFTRDTIDP
LIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLGEQMSALEIMQNLLIDDIPG---
---------PFTADNGGSSVGDPNAGLNSSSA--NVLENNLSITHKDRVGAAIITAIVLG
VMIGGSVWMVF
>Kpol_1030.20
---------------MVLLLTVLLQAFN--FITTVTAIDLDVNSKDSICAATSLIQGGML
DYYEGTRYGGTVGMFQPPYYWWEAGEAFGGMIENWFLCQNDTYHDIIYDALLAQTGSNYD
YVPANQTFVEVMMIK-VFGGTVMDAAERNFTAPSD-GKPDWLAMAQAVFNTMYARWDSAN
CGGGLRWQIYTWNSGYNYKNTVSNACLFQIAARLGRYTGNDTYLEVAEKVFDWLVDVNFV
-VLNDE--ANVFDGANITSNCSAVVKLEWSYNHGIVLGGLAYMYNAT-NGTSKWESGLTK
VLNGAKSIFFK-NNIMYEQACQDHN--TCNTDQRSFKSIFSRMLGLTSVLAPYTSDTITP
LIQASAEGAAKSCDGGTDGHTCGLNWNLGTNDGKYGLGEQMCALEIMSNLLILNRPA---
---------PYTMHNGGTSVGDPSAGLNATST--SVLSNNLDIKQKDRAGAAIVTAVILF
VLLGGSVWMLF
>CAGL0M05049g
---------------MKLLFSLQLWVLIGTLFPDAGAINLQ-DNKDSICAATALIQGGML
DYYEGTRYGGTVGMFQPPYYWWQAGVAFGGMLENWFLCQNDTYKDLLMNALVAQTGPNYD
YIPANQTTVEGNDDQGVWGLTILDAVERNFSAPID-GKPGWLAMSQGIFNTMYARWDMQS
CNGGLRWQIFTWNSGYNYKNTISNACLFQIAARLGRYTGNTTYLDVAERVFDWLVGVGYI
-VLSEK--GNVYDGAKVEDNCTDITAIEWTYNHGVVLGGLAYMYNAT-NGSSVWQSRLTS
VLGGATAYFFQ-DDIMYESACQPYK--TCNNDQRCFKSIFSRMLGFTSVLAPFTSDTIDP
LLKASAMAAAGSCDGGTDGHTCGLDWQLKTNDGYYGLGEQMSALEVIQQLLIHERPA---
---------PYRADNGGTSVGDAAAGLNSTTT--NVLKNNLKITGGDRAGAAIVTTIVLG
IIIGGAAWMMF
>TDEL0B03360
-----------------------------------MGLDLDPSSKDSICYATALIQKGML
DYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNWYFCENTTFESLIYDGMLAQTGPHYD
YMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPTN-GAPGWLAMAQAIFNQLNSRWDTAN
CGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGRYTGNDTYLEVAENVFDWLVDVGYV
-VLKDV--GNVFDGAEIDNNCTSINKLEWSYNHGVVLGGLAFMYNAT-NGSSEWETRVTQ
ILGGAESYFFK-DSIMYESLCQGDGTSTCNSDQRSFKAIFSRMLGLTSVLVPSTQSKVDD
LLKQSALAAAASCSGGTDGHTCGLNWNKQANDGYYGLGEQMSALEVMQQLLIHQKAA---
---------PFTEQTGGSSAGDANAGLNTSSA--NVLQNQLDIQTKDRAGAAIITAVILM
VLVGGSIWMLF
>Suva_13.422
---------MIVKASMKIALPLCFTLLS--FFKATDAMDLDTTSATSICDATALIQDGML
DYYEGTRYGGTVGMFQSPYYWWHAGEAFGGMVENWYLCQNDTYQVLLYDALLAQTGADYD
YIPANQTMVEGNDDQGIWGITVMGAVERNFTNPDN-GAPGWLAMVQAVFNTMYSRWDSEN
CGGGLRWQIFTWNSGYNYKNTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYV
-VLNDT--ANVYDGAEIDTNCTDITKIEWTYNHGIVLGGMAYMYNAT-NGTSEWKTSLQQ
VLNGAASYFFK-DGIMYESACQDYG--TCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDA
LIKTSAEAAAKSCDGGTDGHTCGLDWEKETNDGYYGLGEQMSALEVIQNLLIHDRPA---
---------PYKEDNGGTSKGDANAGMNSSTT--SVLQNNLNITKGDRAGAAIITAVILS
VLIGGAVWMLF
>YMR238W
---------MIVNISAKMILSICFTFLS--FFKATHAMDLDTTSKTSICDATALIQGGML
DYYEGTRYGGTVGMFQSPYYWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYD
YIPSNQTMVEGNDDQGIWGITVMGAVERNFTDPGD-GKPGWLAMVQAVFNTMYSRWDSEH
CGGGLRWQIFTWNSGYNYKNTVSNACLFQIAARLGRYTGNTTYLEVAEQVFDWLVDVGYV
-VLNDT--ANVFDGAEIDTNCTDITKIEWTYNHGIVLGGLAYMYNAT-NGTGEWETSLTK
ILNGAKSYFFK-DSIMYESACQDYG--TCNTDQRTFKSIFSRMLGLTSVMAPFTRDTIDD
LIKTSAEAAAKSCNGGTDGHTCGLNWQKQTNDGYYGLGEQMSALEVIQNLLIHDRPA---
---------PYKEDNGGTSKGDANAGMNSSTT--NVLQNNLNIKKGDRAGAAIITAVILS
VLTGGAVWMLF
>Skud_13.407
---------MIVDSSMRMIPFICFTFLS--FVGISHAMDLDTTSKTSICDATALIQDGML
DYYDGTRYGGAVGMFQSPYYWWHAGEAFGGMLENWFLCENETYQELLYDALLAQTGSNYD
YIPANQTMVEGNDDQGIWGITVMGAVERNFTDPDE-GKPGWLAMVQAVFNTMYSRWDSEH
CGGGLRWQIFTWNSGYNYKNTVSNACLFQIAARLGRYTGNSTYLDVAEQVFDWLVDVGYV
-VLNDT--ANVFDGAEIDTNCTDITKIEWTYNHGIVLGGLAYMYNAT-NGTSEWETRLTQ
ILNGAKAYFFK-DTIMYESACQDYS--TCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDD
LIKTSAEAAAKSCNGGTDGHTCGLDWGKQTHDGYYGLGEQMSALEVIQNLLIHDRPA---
---------PYKESNGGTSKGDANAGMNSSTT--NVLQNNLNITKGGRAGAAIITAIILS
VLIGGAVWMLF
>Smik_13.446
---------MILKSSMEMIPLICFTLLS--FFRICHAMELDSTSKTSICDATALIQDGML
DYYEGTRYGGAVGMFQSPYYWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYD
YIPANQTMVEGNDDQGIWGITVMGAVERNFTDPSD-GKPGWLAMVQAVFNTMYSRWDSEH
CGGGLRWQIFTWNSGYNYKNTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYV
-VLNDT--ANVFDGAEIDTNCTDITKIEWTYNHGIVLGGLAYMYNAT-NGTSEWETSLTK
ILNGAKSYFFK-DSIMYESACQDYS--TCNTDQRTFKSIFSRMLGLTSVMAPYTSDTIDD
LIKTSAEAAAKSCDGGRDGHTCGLNWGKQTNDGYYGLGEQMNALEVIQNLLIHDRPA---
---------PYKESNGGTSKGDANAGMNSSTT--NVLQNNLNIKNGDRAGAAIITAIILS
VLIGGAVWMLF
>NCAS0C00810
-----------------MLHVWISFVLL--LPLLVQSIDLDVTSKDSICAATALIQKGML
DYYEGERYGGAVGMFQPPYYWWNGGVAFGGMLENMYLCENNTFESLLMDALVAQTGDNYD
YIPSNQSMVEGNDDQGVWGLTIMDAVERNFTAPNKSGVPGWLAMAQAVFNTMYARWDPDH
CGGGLRWQIFTWNSGYNYKNTIANACLFQMAARLGRYTGNQTYLDVAEKVFDWMVDINYI
-VLNDK--ANVFDGADIDENCTDITTLEWTYNHGVVLGGCAYMYNAT-NGSSTWETRVNK
ILAGAQEYFFQ-DNVMLESACQSYN--TCNNDQRCFKSIFSRMLGFTSVLAPFTAETIDP
LIKASAEAAATSCTGGKDGHTCGLDWTKGSNDGYYGLGEQMNALEIMSNLLIHDRPA---
---------PLTANTGGTSEGDASAGLNSTTT--NVLENKLKITQGDRAGAAIVTAVILG
IFVGGAVWMLF
>NDAI0K00840
---------MVRLLRRPSLYFHFFQLLL--TVHNTQAIDLDITSKESICDATSLIQGGMM
DYYWGTQYGGTVGMFQPPYYWWEAGEAFGGMIENWYLCQNDTYEDMLKSALLAQTGSNYD
YIPANQSMVEGNDDQGVWGLTLMGAAERNFTDPDD-GTPGWLAMTQAVFNTMNARWDSAH
CGGGLRWQIFTWNSGYNYKNTISNACLFQLAARLGRYTGNTTYLEVAEKVFTWLVDVGYV
-LLDDT--ANVFDGAEIDSNCTDMTQIEWTYNHGVVLGGAAYMYNAT-NGSSDWESRVTK
LLKGATTYFFDSNGIMFENACQEYN--TCNNDQRSFKSIFSRMLGLTSVLAPFTSDTVDP
LIKTSAAAAAKSCTGGTDGHTCGLNWAKGSHDGYYGLGEQMCALEVMQNLLIHDRPA---
---------PLTGNTGGSSKGDALAGLNSTTT--NVLENKMTITNGDRAGAAIVTAIILG
VLTGGAVWMFF
>AFR530W
----------MYLSAGMTGLLVGLFLLM--QGMLSRALDLDLSSREDVCHFTNEIQKGIM
DYYWGSKYGGIVGMFQPPYYWWEAGEVFGGMLENWYLCDNQEYESVLRESMIAQTGDKFD
YIPANQSTTEGNDDQGVWALFIMGAVERNFKDPEKEGMPGWLTMVQTVFNKMEARWDAEN
CGGGLRWQIFQWNNGYTYKNTIANGCLFQLAARLGRYTGNQTYLDVASKVFQWLVDVKYI
-VLEDK--ARVFDGAHIHENCSDIKGIEWSYNHGIILAGAAYMYNAT-GGSPEWESHVTK
ILAGAADFYFR-DKIMYERACQDYN--TCDNDQRSFKSIFSRMLAITSVVAPFTRGTIDE
LIYASATAASKSCEQGTHGYTCGLNWHKGTYDGVYGLGEQASALEIIQNVLIHTKAP---
---------PLTADTGGQSEGNPDAGLDHDSQP-AILRGMHNITGKDRVGASLITAISLG
LMLGCALWMIF
>Ecym_1474
--------------MRIIVQLYSLLLLI--CVPVCGGLQLDVKSKDSICAATQKIQRGIM
DYYWGSTPGGIVGMFIQPYYWWEAGLVFAGMLENWYLCDNMEYNSTLYESMIAQTGANYD
YIPSNQSMTEGNDDQGIWGLFIMGAVERNFPDAQMGNVPGWLTMAQAVFNTMYARWDSQH
CGGGLRWQIFTWNLGYDYKNTIANGCLFQLAARLGRYTGNSTYLDIANETFSWLVDVKFV
-VLKDE--ANVFDGAHIGDNCQDIKGIEWTYNHGVILGGCAYMYNAT-NGDPVWETRLRQ
ILGGARAFFFR-NNIMYERACQDNK--ICNNDQRSFKSIFSRMLAVTSVLAPFTRETIDP
LLEASAAAAAASCSGGKDGETCGLDWTTGSWDGYYGLGEQASALEVIQNLLIHTKAP---
---------PLTKNAGGTSNGDPGAGLGTPMD--NVLHSRLNIGSKDRIKAALITAVCLG
LLVGTALWMVI