MUSCLE (3.8) multiple sequence alignment

TPHA0C04190       -------------------------------------------------------MSRSN
TBLA0I01480       -------------------------------------------------------MNVPK
CAGL0K03003g      MKDGASEDCNPSSAVEEDRGRHAAPINHLGSSNKANEIAVADREHTFSIRKLYPISENVS
KNAG0A07040       ------------------------------------------------------------
KAFR0J00340       --------------------------------------------------------MNKI
KLLA0E18547g      ----------------------------------------------------MNINTNTD
KAFR0A01860       ------------------------------------------------------------
NCAS0F00900       -----------------------------------------------------MSNWTAY
Kwal_26.8021      -------------------------------------------MLSAHSFEGDSGLDSET
KLTH0D06842g      ---------------------------------------------------MLSVHPYTS
TPHA0G03510       -----------------------------------------------------MTKRDPR
KNAG0C05810       ------------------------------------------------------------
Kpol_1018.33      ------------------------------MDSNSNDGSGSNTDYSLFSDPNLNVPATVD
AGL071C           ------------------------------------------------------------
Ecym_7255         -------------------------------------------------------MEYEG
Suva_13.246       --------------------------------------------------------MNAD
Skud_13.226       ------------------------------------------------------------
Smik_13.249       --------------------------------------------------------MNAE
YMR070W           --------------------------------------------------------MNAD
NCAS0A04800       ----------------------------------------------------------MM
NDAI0K01860       MTSPSFNVHLLPHREEENSYDDPINSSNNNDFRNVEYSTYDNTQSSFLERKIWVQSDYQQ
SAKL0A09482g      -----------------------------------------------------------M
NDAI0H01400       -----------------------------------MNDAGKRLMGNSDFTTGQYTAKQEP
TBLA0G02230       ------------------------------------------------------------
TDEL0A03070       ------------------------------------------------------------
ZYRO0B02002g      ------------------------------------------------------------
                                                                              

TPHA0C04190       RLLY---------------DESEVPPINRLQRNYYYQNH----------------DYVSN
TBLA0I01480       PNAT---------------NNTASQDPLNIPFLNSNSLHLPLQAATAA-------AAAAN
CAGL0K03003g      RVKS---------------QQQEVPYQRNLPTINGTETESARQNLQHAFDKYSKNNNLTP
KNAG0A07040       MAMY---------------HYQHAPQHTILPPIEKYLQHQPINQ-----------MNNCN
KAFR0J00340       MNGN---------------NQQPVIRPHVQGFLERKRLESPRL------------VYVPN
KLLA0E18547g      ADIG---------------PNSGLGFGNVMVKHEQELLQKQQLFQM---------SQYQQ
KAFR0A01860       MNYW---------------NNQSPPTIIKPELSSNLLDPSFKNSENAS-------KNKSK
NCAS0F00900       QDQK---------------VKQEQEQEQEQEKQNQRQSQMTAAQKDTSTSTSTNTNGVSS
Kwal_26.8021      HTEA---------------NNSTTSTQPPMAFRRRSSAASLASVGSDPMRTTTRVGSSSH
KLTH0D06842g      PADI---------------DRDARRGSSQLDFRRRSSASSVASIGGAA-------AGGGP
TPHA0G03510       LNAE---------------PDNSNSSCNNTNSGNQFDYNKPLLDSQ---------AKSPD
KNAG0C05810       MNPW--------------IRQLAPQYPLMVDNNNNNTSNNPGANNSGGVL-----VNENN
Kpol_1018.33      QSMG---------------ENSSNKINNQSSFNNTIIHNQTNNQTNNN-------NTRSP
AGL071C           MDYE---------------SQQQQQQAAAGPGGPAGAGPAGPAGGGGGT------AGGPS
Ecym_7255         HHHH---------------QQQSAAAAAAQQQQQQQPQQPQQPQQ----------PQQPQ
Suva_13.246       HHLQ---------------QQQQQHTIL---------------------------QNAPN
Skud_13.226       -EIS---------------RQQQNADHHIQQHQQRQQHQQRQQHQQHTIL-----QNVPN
Smik_13.249       HHLQ---------------HQQQQQQQHQHQHQHQHQQQQQQQHQQHAIL-----QNVPN
YMR070W           HHLQ---------------QQQQQRQQHQQQQHQQQQHQHQHQQQQHTIL-----QNVSN
NCAS0A04800       KHYY---------------NNQLLPNQNDIDNIDDTEILNTAPGVVAGPV-----EFIPF
NDAI0K01860       LPMEGISRQSTGQSWFQGHPSQQPQQPQLFQPQTQPQQQLPRPIYNNTVIP----LSDSQ
SAKL0A09482g      LSVQ---------------KRTQVPVDHHLEMDFNAQHVF---------------AKHEN
NDAI0H01400       QSNF---------------QSQNAQNNGPSQFENRSQQPLGQGFQ----------RNNPL
TBLA0G02230       MNNK---------------SNNEGNANSNEFRSNRNQFPR---------------VGETS
TDEL0A03070       MNNW---------------PHQQGRRSGEQDERSQRPMPLNLP------------PRYSY
ZYRO0B02002g      MDIY---------------ESERLPLPQPLYYRNPAAGA----------------ADAAT
                                                                              

TPHA0C04190       NILHQRSNRIEQ---------------------------------NHLVSNS-HLFANAN
TBLA0I01480       AQTQNYNPLS-------------------------------------SINSL-NSYSTHT
CAGL0K03003g      KAVQPALNQGVRYIWTKTNPVPRVGNSTVSLSNSSEGSSGAMVNNNDHALDN-ALNTSVT
KNAG0A07040       NNGVYASHYMQCMLPIVQG----------------------------VKNIN-VPCTTTV
KAFR0J00340       VPSADTMNYTER------------------------------------------------
KLLA0E18547g      QQQQQQQVQQQQ-----------------------------------------QQQQQQP
KAFR0A01860       KNNKNHNDNSQM--IIKPNNDCSPNNNIATTVPNTAVAT--------NIVPA-YPYNHN-
NCAS0F00900       LLNPPQLQSEKLSLPINTTDQMHSHSHSHSKNDSLGTIPLPQTSKYNPIYHQPSSYMMNE
Kwal_26.8021      GTWVPPYAAAAA--APPPPPMQLPAPLPAPAPVSTHYSVAPIHSQAQSIRQT-PAWDTAA
KLTH0D06842g      AQSPTSALWAAAPAPAPAPPLVPPAAVSSTVHRQPQYSVAQMHSQAYAIRQK-HARASST
TPHA0G03510       NQTKRINVRTSS-----------------------------------INKHE-KPYLLAP
KNAG0C05810       GFKRDQRTLLHPLSSTPRNSESLPANSNTVANGYGYQLFQPYVLQPSPHYQA-YQNAPAN
Kpol_1018.33      HILLPNPTINLQNSATILPNVQSQSNINPILNVNNNTTANSSNNNYYYQTSR-QSYYGIG
AGL071C           QLHVQQYQRHVG--------------------------------GELYDAKY-VPNVPVP
Ecym_7255         QPQQPQQPQQYQ------------------------RHIVSAGSGDLYDTKY-VPNMPMP
Suva_13.246       NISAGADPLTSR--TFNASVASSSNKDDVIVNPNTRELPMPLHQQQ-YIYPY-YQYSNNN
Skud_13.226       TNNVGADLLASQ--HFNAT-AVSSNKEDVMVNPGGRELPMPLHQQQ-YIYPY-YQYANNS
Smik_13.249       TTNVGNEPQASQ--PFNPT-STSSNKDDVTVNSGARELPMPLHQQQ-YIYPY-YQYTGNA
YMR070W           TNNIGSDSLASQ--PFNTT-TVSSNKDDVMVNSGARELPMPLHQQQ-YIYPY-YQYTSNN
NCAS0A04800       NTQPDNNNISNV--SEGTSWTRSAPPPQQQQPPPAYHQKKASNDTFQQNYPF-PPQQQHV
NDAI0K01860       QQQQQQDDLIQQSQFYNLRQNQIQSESAIYLQNNNGNLEDRSSSPN-INNNI-SSSGSNN
SAKL0A09482g      ELLESDIHRQAR-----------------------------------YQQQL-NQYNT--
NDAI0H01400       VQHPPINTLGKE--SGMFMNNSSINRSISNTSPMLYHWTKPTNTDEEKKADD-NSDNGVP
TBLA0G02230       RTSPWQYHMQNE------------------------------------------------
TDEL0A03070       TQYPHAFPVVNA-----------------------------------TVPQQ-YLYVPG-
ZYRO0B02002g      RAMPGELPTMN---WKIPS----------------------------ITRQN-HQHNHAP
                                                                              

TPHA0C04190       NNTLKA---------FSNRSTKQ---------------STVV---HNNSIHPYNNINHFN
TBLA0I01480       SSNTYS---------NNNSLQQA---------------YLPF---ANSNAANSL----YT
CAGL0K03003g      KGQNDPRLSHILSSSNGNIDTTVAKHSLRKEEKSSLEISNNF---DHQAQAPKGLDLSAV
KNAG0A07040       RGYPST---------MGVSGPHD---------------NMYS---LRDTAYPVSSTGQVI
KAFR0J00340       --------------------------------------MGDI------------------
KLLA0E18547g      QHQMMQ---------RSTTPVMM---------------HPVY---YTNNGASSQHSQQLP
KAFR0A01860       ---------------NYNYIPNT---------------QYYY---NPNNLYNQH----YL
NCAS0F00900       SDMRRN---------YYPTPQQQ---------------QPPP---QQQQQVTGSQAQTNT
Kwal_26.8021      SPGSAPQLQQYPNTLQAQYPVPS---------------QAQP---QSPQAPGHAQQPQQP
KLTH0D06842g      DSSGTPI--------PGPAAAVT---------------TPGP---ASVPAPVTAAQQQPP
TPHA0G03510       ELKSFN---------QYNNNTTR---------------HNSL---RNNNFNLRPWTPTVH
KNAG0C05810       YNMLAQQQQQQHHQQQAQQGQRPQAQQTPQQG------PYHY---QYNVLRLSQPTVGSP
Kpol_1018.33      SNNNNSTLYQNNNNQIPGNPEYQ---------------SPTYLYQHNGNEQTNNNIGNFQ
AGL071C           MPMSMS---------TYPTPSTT---------------PYYF---HEDP-----------
Ecym_7255         MHMSLS---------TYPTPSTT---------------PYYF---HDDPHAQVAVYHQLQ
Suva_13.246       NNSSNV---------AAANNTSA---------------SPII---HSNSNAPATDFGGAG
Skud_13.226       SNSTSV---------ATANNTSA---------------SPVI---HSNSNNSNNS---AS
Smik_13.249       SGNNNA---------AAGNNTSA---------------SPIV---HNNSNNSNNSNIAAA
YMR070W           SNNNNV---------TAGNNMSA---------------SPIV---HNNSNNSNNSNISAS
NCAS0A04800       YMQPFPPQ-------QQGMNASA---------------YPPP---PENNTSNNNIHYFEM
NDAI0K01860       GNLGMSIPRWAPQKLTSLYPAQS---------------NQTF---DPQQFSQSNCNHPVP
SAKL0A09482g      ---------------QYLSATQP---------------QFVF----SQVQPQGIAISNYR
NDAI0H01400       KQTSLI---------QQPYQRQSYPSDY----------TPIY---HQQQPRFVGQQSVPP
TBLA0G02230       --------------------------------------GPLP------------------
TDEL0A03070       ---------------SVPPPPQA---------------QLQF------------------
ZYRO0B02002g      IITRFP---------ITPSGHQT---------------PSAF---TAR----------SV
                                                                              

TPHA0C04190       NNA-----AGLHNYSNKLSVAKLIDS-AHEDNLHLQRNALHPPYTQSQA-----------
TBLA0I01480       QPA-----FNYPLATSTTSAY------NYTTSNPNTTNAIANANANANA-----------
CAGL0K03003g      DTT-----SQPGLYTTTGSQVHPVTQ-HYQYNGSKMPYDWSNSLRQRIG-----------
KNAG0A07040       QPA-----GVNLGYQHNIITPL-----LPKTVLFSGYPQIINDQSQSQG-----------
KAFR0J00340       ------------------------------------------------------------
KLLA0E18547g      QSQ-----ASAFTHNSSIGGSG-----GFNTSSNSSLNSAGHDSNQLLS-----------
KAFR0A01860       QNR-----QYPLQQQQQFP----------QQFYPSNIPVQQHQPQKNND-----------
NCAS0F00900       SPFLYHWNTGRSDENQQQQQQMLQSLPTTSNPYGVQYNVLAPDTLQMYS-----------
Kwal_26.8021      QQP-----QQAPYFRGSFSEYTEYDQRYVPYYYKPAYPGWGPPQPLPPP-----------
KLTH0D06842g      PPP-----IGGPLYELMEYDTR-----YLPYHYKSAYPMWGPAGPTAAAAGTA-------
TPHA0G03510       NTY-----AFPPFYSEK-------------------------------------------
KNAG0C05810       TPSINSL-TGSANSANGSNGIGNQNGSGVTSNSTLSFGIGQPSDGLGSN-----------
Kpol_1018.33      SSY-----VNRSQLIYNNSTFANKNQITVDESNNYNTGNARDNLDNINRHRVQQQQELQG
AGL071C           --------HSQVVYHQLQQ-----------------------------------------
Ecym_7255         QQL-----PHLMNQQLQQQ--------------GQAQGQAQTQHYQQAQ-----------
Suva_13.246       GPN-----NNNTTTTTTTN---------------NNTNNIHTNQYAAAT-----------
Skud_13.226       DPS-----AANNNNNNNNN-------------------NIHTNQFAAAA-----------
Smik_13.249       PDY-----TAVNSNTSNNS---------------NNNNNIHTNQFAAAA-----------
YMR070W           DYT-----VANNSTSNNN---------NNNNNNNNNNNNIHPNQFTAAA-----------
NCAS0A04800       DPN-----TSNNNNSINNPSFVMGDGYMVPRWLPVTSPQSGNTLDRNIS-----------
NDAI0K01860       NQF-----ASQLGYSTDNTVSYANPSSTLQQSESLLSNSFHSNIPPTRTISLPQQSKFRS
SAKL0A09482g      NPY-----YDHNDWNAQQR----------------FVKSAGTENSVGNS-----------
NDAI0H01400       PPP-----PSTNHALPIQQDF------QATIGHPQQAPVYGRVPLRNMN-----------
TBLA0G02230       ------------------------------------------------------------
TDEL0A03070       ------------------------------------------------------------
ZYRO0B02002g      VPP-----HATPMVQINSA-----------------------------------------
                                                                              

TPHA0C04190       ---------------------------SSSLLSLPQPNFHNYQQQQQDFQNTNMKYQPWN
TBLA0I01480       ---------------------------NANANANAIANANANANANANANANANSLSSYN
CAGL0K03003g      ---------------------------NSNTAGQVYFVGTPPDAPNRSHDYTHLYANTAP
KNAG0A07040       ---------------------------TPPFLAYNPQSQQFYQRPYQHREYMQQGVPAAR
KAFR0J00340       ------------------------------------------------------------
KLLA0E18547g      ---------------------------LQSNNGNINSTSQLQQHQYQNMYQHQQPTFPLS
KAFR0A01860       ---------------------------QNAIHNSLMNNKKFNRPSVSNIQDTQTSGSNIN
NCAS0F00900       --------------------------MGQVPSNMGAYIPYQTAQQYQSVPWVIQYDPYST
Kwal_26.8021      ---------------------------PPPAQQQSQQHQPPYQQQPQPHPQQQQQQHHHH
KLTH0D06842g      ---------------------------PGTAPGAPGAAYPAYQYPPPAWNSYQAPHHVWN
TPHA0G03510       ---------------------------NNGTNNSQSVIVNSSKTVQSDGDFLSKGLPPRL
KNAG0C05810       ---------------------------NSSNSSLSSSSSTSNNNSTGSKSVATTTNNGTT
Kpol_1018.33      YPI------------------------NSSIKNYEYNQPYQQYQSINNQPHHLPNINQMM
AGL071C           -----------------------------------------------------QLPHLMS
Ecym_7255         ---------------------------AQQAQAQQQAQQQAQQQQAQQQAQQAQQQQAQQ
Suva_13.246       ---------------------------TANMNANAAAAAAYYAFPNSNIPIPQQDQPYMF
Skud_13.226       ---------------------------GNMNANAAAA--AYYAFPPSNMPIPQQEQQYMF
Smik_13.249       ---------------------------NINTSAAAAA---YYTFPTANMPIPQQDQQYMF
YMR070W           ---------------------------NMNSNAAAAA---YYSFPTANMPIPQQDQQYMF
NCAS0A04800       ---------------------------STSLRRLMYTSSSGSSTQLNQIPFIQQELDNIQ
NDAI0K01860       LSETVESQTLRSTPAYPPAQLFKKYYESNDNPTTTAASASATTNTSTTTNNTNNNNLHEQ
SAKL0A09482g      ---------------------------TFNNSGSSSGSSIGSSISSSISSNGSIGNPVGN
NDAI0H01400       ---------------------------QTVIQAVPLHSQYFTAYGMPQIPTGQQEPLLIS
TBLA0G02230       ------------------------------------------------------------
TDEL0A03070       -----------------------------------------------------PIYPYYP
ZYRO0B02002g      ----------------------------------------------------------FA
                                                                              

TPHA0C04190       SPVYNTNTNY----------LSKLN---HGNNHFPSIQHPNHIA---------------N
TBLA0I01480       NSNTSTSINTNSNS------QNYIN---TNTSSSSSYPFQFQLPVT-------------N
CAGL0K03003g      LPQGVSYVWHAHGPPFLASNSNTTE---SYSGSTLVAATTNQAKIASPSVSYGN-----N
KNAG0A07040       TPCSFETIRSDS-----------------------------------------------N
KAFR0J00340       -----------------------------------------------------------V
KLLA0E18547g      QSNQTNRIFSSNSTSANTTNYQYSN---NNNLQQ---AYHPAVP---------------V
KAFR0A01860       IAATATTNRTNLVANNDQMNSSNNI---ANTSPF---IYHWGPINTSKNISELQDS---N
NCAS0F00900       GPPPPPPPNASITNSPP---YQQSY---PSQQPQQSQPQQYQRPV--------------S
Kwal_26.8021      LQQQ----------------HPYQA---AAWNPYQVPSHAFGT----------------H
KLTH0D06842g      GQPAASSGGYPHMQLQIPTQLPQQP---QMTTSQQQQQQQQQQ----------------Q
TPHA0G03510       GPVH----------------TQYNN---QHKIHASNAQFNYHLP----------------
KNAG0C05810       KKTHSPLIYDLRTVVTPHSLISINDQKPGNGSNNGRGSFVAGTPRLARNDSTSE-----A
Kpol_1018.33      NPKKIINQFHPLTSIITNLKRNSSNFIEGNLLPNLPIQSQQSTPLQS------------S
AGL071C           QPQ-------------------------GGGVAAQQPYYSWGMP---------------H
Ecym_7255         QQAQAQQAQT----------QQAQA---QAQAQQQQPYYSWGMP---------------H
Suva_13.246       NPASYINHYYSAMNNNMNNNNNNNN---NNNNNN---NTGSNAA---------------N
Skud_13.226       NPASYIGHYYSAV-------NNNNN---NNNNGN---NGGSNPP---------------N
Smik_13.249       NPASYIGHYYSAV-------NNSNN---GNNAAN---NSGSNPP----------------
YMR070W           NPASYISHYYSAV-------NSNNN---GNNAAN---NGSNN-----------------S
NCAS0A04800       SPNTDTNNNTNAFTTTNKQIPNSNT---NKYRTYSEMTFHMMPPGSQ------------Q
NDAI0K01860       LPIQEQGHVKVNISQPLQQSQQKQN---QHQNQSSWASFPNSTTIRPCQENIVLSSSSSS
SAKL0A09482g      VPSGIPSQA-------------------WNKAPALYAPFPWN-----------------V
NDAI0H01400       NAPPISYMPTIPTTVPVTT-FQRQN---SNALPNMYIDNGQKVPVQPEQ----------I
TBLA0G02230       -----------------------------------------------------------Y
TDEL0A03070       QPA--------------------------------------------------------A
ZYRO0B02002g      LPGDSAGGR-----------NDRSN---GTAATS---NIPSMMP---------------T
                                                                              

TPHA0C04190       TLPVPYPKTSATYYHPNKILPDPNESQPVQQHPMP--QYKKATILFTSNGTENKSNQRHS
TBLA0I01480       HDNSTIPSSANTNSTNNNNSYLDSSTSLDNSSNNNLSIPSFTNQFIRDKYLPTSQHHLPL
CAGL0K03003g      THPENTPRLSVSNIHQLTPNQKGASFQRPLQSILPIIPSHTQSKFANVKLDQDKQTNFGN
KNAG0A07040       GMHSPLGSVSSIEASPSSTSQPVQLPTEEEEGKST-------------------------
KAFR0J00340       TVPQYIPNPVPQYVIAGQPMQGYFVSSNNITGP---------------------------
KLLA0E18547g      HSIDRMQHYKQLHNLQQLQMLQVKLQAQTQNLSHNIQPSTALQPLNIRTGEDSFSTFKEH
KAFR0A01860       PYSSTQPFIIQRQFYNDLPYANNQRPHVYQLSSQQ--PLYSSTIPFTVSGNDTQPNASST
NCAS0F00900       VSPNILPQPVYSQTIKSSLKNSFNGDTNNATTTTSISQPFKRSDAMASIGTNIQQNNNNI
Kwal_26.8021      HVPNQQQQPQQQQQQQHTPQTQPQSQSQPQSQLQQ--APTPYKQTYNQGFAPASDRPQMQ
KLTH0D06842g      QQPHQPQQPQQQYQFQQQPQQPQQPSLHRQSISHRQSQGFSADQFPSALAATELPLSAYA
TPHA0G03510       ---FPLADSNISLHTQSNSNASNYNNGSSTTGSSSDSASGGSGSIMTSKNEKIYSNDQQ-
KNAG0C05810       PPPQQVNGAMNPKHYAGTNFNNGMGNNNNGQRMLNPAPFQQQLYSIPMNGPYQYQQQRHH
Kpol_1018.33      YNPSQNDGRWPSSYYKRSDSDSTLTIPKVKQSNDHVDTSNSLPCISDRNLSHQDTSSNSD
AGL071C           SYQYSVVHAQVAPGQGPGQGAAQGGTQYAQQVAIP-------------------------
Ecym_7255         TYQYSIPHPQMQQTQQPQPMQQAQQHHQQQQHSQQ-------------------------
Suva_13.246       ASSNLPPHPAPPPHHRHNNSSNSNISN----TNNP--PPPHQPTIITDQFQFQLQQNGSP
Skud_13.226       PVPPPPHHQQQQHHHH---SSGHNNLNNSTVNTNN--GPPHHPTIITDQFQFQLQQNAPS
Smik_13.249       ---HPAPPPPPPHHHHHHRSNPHNNLNNGTVNSNN--APQHHPTIITDQFQFQLQQNHPS
YMR070W           SHSAPAPAPGPPHHHHHHSNTHNNLNNGGAVNTNN--APQHHPTIITDQFQFQLQQNPSP
NCAS0A04800       APNFQLVGTAGPTTNEEDPIEAPQPLPPWFMYNNSSTANKNVTVFAPDQMTAPDMTTTPQ
NDAI0K01860       SSDRFARSTVDNIIATTSNNNNNNNNNNNNNNSNNIPGYAGSTSGSDDGSHNINPRQHHF
SAKL0A09482g      NSAPPIPQQQQQQQKQQQNPQQQKQQQNPQPSYQEWNRGVFSN-----------------
NDAI0H01400       ASKQYIPSTLNNVVHSHTNSNIYYTSPNYQMVPEDISRSHHSQNFITSQTVVTQPNFKTG
TBLA0G02230       SSNYLIPNNKDCQGVGNGNVQRVEGNNGNREPPKN-------------------------
TDEL0A03070       GGGAAAPPPRMRLKLEQPPMPMPMSIPGQRAVAVA-------------------------
ZYRO0B02002g      VAGTTAGHQGPSLPLPHVAATMGQAGAGVMAASVG--AM---------------------
                                                                              

TPHA0C04190       NTENDSNHSI-----------------HEQQNSLQDNDQAYASKSPKQDF----------
TBLA0I01480       NNTNTNPNLNS----------------FQNVINPTTLPSSSITPPPLQHPNSLINN----
CAGL0K03003g      QIMFNSSENTPPLAHQVVYADNRLGSVPNNAISYNADASRAPIGPPIGSAGVYYNPNYTY
KNAG0A07040       ------------------------------------------------------------
KAFR0J00340       ------------------------------------------------------------
KLLA0E18547g      NTHEQ-------------------------------------------------------
KAFR0A01860       STVPAKQDILI----------------QEKKHSMHSIESKPNESKYRNDANS--------
NCAS0F00900       NNSRDKN--------------------------LPPISSITTTVPTTASTT---------
Kwal_26.8021      ---------------------------PQPQRWATEMPQSAYMPDPQHIGALAARQYA--
KLTH0D06842g      PDPRSGAQLAG----------------RPYVVAAAPGPAAASAPFGLGAVGIGAG-----
TPHA0G03510       ------------------------------------------------------------
KNAG0C05810       SYSGAVINNPT----------------PGYSLSNSALATSSKFPFGDDANGNGTDNILKK
Kpol_1018.33      KSTFSMLNTLNKTQDAFNKSDLSGGQSTDVSSYGPSQTSQSSAPDSVEDIKIKFPKQSLE
AGL071C           ------------------------------------------------------------
Ecym_7255         -----------------------------PQQYVQTIPQLGAIPPP--------------
Suva_13.246       NLNMSMN--------------------QAQPLHLPPGWKINTMPQPHPAA----------
Skud_13.226       SLNLNIN--------------------PAQPLHLPPGWKVNTMPQPHPAA----------
Smik_13.249       NLNLNIN--------------------PAQPLHLPPGWKINTMPQPHPAT----------
YMR070W           NLNLNIN--------------------PAQPLHLPPGWKINTMPQPRPTT----------
NCAS0A04800       LAEYND---------------------PTTATLSPPTSSLNYLPPKSAPPMTNNAMREFH
NDAI0K01860       QNPHHQHILSTTSQPPPPCQSRIHISEEEGTFLNMVPMNNYGIPLPSPLTTSLDTIGSSV
SAKL0A09482g      ---------------------------PEYPLSVYPVDSRGYSDPPHITSQHVA------
NDAI0H01400       QLPFSYPNIVA----------------PKEERRNDSSFSIDNTNPNPDNANSNTTT----
TBLA0G02230       ------------------------------------------------------------
TDEL0A03070       ------------------------------------------------------------
ZYRO0B02002g      ------------------------------------------------------------
                                                                              

TPHA0C04190       ----------------------------EYLFCSTNLSTFIQDSQKKLFRYKR-----AK
TBLA0I01480       ----------------------------SILNNNNNNNANNSNNHNNTANLLNAPQSAIN
CAGL0K03003g      VMQEQPKTVSDNVVSRINSHPILGQTNYLLPRADPSLTTQLGVTNEMMFGNQGEKIEVSS
KNAG0A07040       ----------------------------PMLTLTRNPKPKRKASARGKGRTPK-----PP
KAFR0J00340       ----------------------------IIDYNRRESEPRCMYAYVKEEGKNE-----DE
KLLA0E18547g      ----------------------------QLLSNPNNGRDQDHDQQQQQLTHDGVP---HE
KAFR0A01860       ----------------------------SKDNNDSNNAGGNGDNTDNSSNVIG-----GN
NCAS0F00900       ----------------------------TATTPPSVIREPHSNQRFVTPSPPRGTF--DS
Kwal_26.8021      ----------------------------GGYGSGSAAGPDSGPVALLAPMSNGPFGMGLV
KLTH0D06842g      ----------------------------AGAGARGPAPYSGTGSDRGSFDDTG-----SS
TPHA0G03510       ----------------------------QSYYAQNNQQQDSFAFSDNIY---------MN
KNAG0C05810       GTGANDIT--------------------GIVNNGTIPSEQDTSNNKLTITTLTNSDNSSP
Kpol_1018.33      GIGLNDDFN-------------------LSSSSSLSSTSSSAYSTPSNIGHQNKTNASNL
AGL071C           --------------------------------PPAAGLGGMGAGQLMDL---------NS
Ecym_7255         ----------------------------AATAPATSTSIGVSNVTSSQLMDP------NS
Suva_13.246       ----------------------------ASNHPPLPPQPPNSVAPNAMP-APS-----SD
Skud_13.226       ----------------------------PSNHPSVAAPPSNSVALHALP-TSS-----ST
Smik_13.249       ----------------------------TPNHPPAPVPPSNSVALNSVT-APS-----SD
YMR070W           ----------------------------APNHPPAPVPSSNPVASNLVP-APS-----SD
NCAS0A04800       ----------------------------QHISMTGASGPFMASSSSSSSFSVE-----RD
NDAI0K01860       GSSSFHPMSSSSGVSG------------NINDTTASNSNSSSNSTSTSMNNNNNSNN-II
SAKL0A09482g      ----------------------------SHQRPPAAVQPHQGQNP-------------AD
NDAI0H01400       ----------------------------IINNNNSNAVAIATILSMGEF---------DI
TBLA0G02230       ----------------------------QIYNIYYNVRPTEQELQVLLYNSS------MN
TDEL0A03070       ----------------------------SLSSNSADDEEQR-----------------EA
ZYRO0B02002g      ----------------------------RIAAVNATQQQQAQQQQQQKMQLPR------L
                                                                              

TPHA0C04190       KIKFYECKVCHKTFKRNSWLKRHFFSHSKLKNFSCNWCSGKYKRKDNLVQHIRKKHRDKT
TBLA0I01480       QDIIFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKHLDYI
CAGL0K03003g      LAFPHRCHLCPKLFKRKSWLKRHLLSHSQQRHFLCPWCNSRHKRRDNLLQHMKLKHVPNL
KNAG0A07040       TMTSYPCPQCPKSFQRSAWLKRHSITHTNSHPFKCVWCKSEHKRRDNMFKHMKLKHMNLL
KAFR0J00340       VTSVYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELL
KLLA0E18547g      SHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYL
KAFR0A01860       LTLIHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYL
NCAS0F00900       ENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKNL
Kwal_26.8021      PPVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHV
KLTH0D06842g      MAMLYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQV
TPHA0G03510       NKYIFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQV
KNAG0C05810       SNFIHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYL
Kpol_1018.33      KNFAHVCHICGKQFKRKSWLQRHLLSHSSERNFDCPWCLSKHKRKDNLLQHMKLKHAENV
AGL071C           FENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEML
Ecym_7255         FENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEML
Suva_13.246       QKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYL
Skud_13.226       HRYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYL
Smik_13.249       HKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYL
YMR070W           HKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYL
NCAS0A04800       TPSVYQCHMCVKSFRRHSWLKRHLLAHSSQRHYSCPKCVSKHKRKDNLLQHLKLKHTAFV
NDAI0K01860       NNNVFQCSYCVKSFKRFSWLKRHLLAHSPERHYSCPWCLSKHKRKDNLLQHLKLKHTEMV
SAKL0A09482g      PENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQV
NDAI0H01400       ESQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNNL
TBLA0G02230       EMAYHKCPQCEKRFKRKSWLKRHMLSHSEERQYSCPWCISRHKRKDNLLQHMKLKHTDEV
TDEL0A03070       QGYVHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYV
ZYRO0B02002g      NGLSHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYV
                      . *  * * *.* :* .** ::*:  . : *  * .  **.**: :*:. **    

TPHA0C04190       NKEPN-------------------------------------------------------
TBLA0I01480       LKKLN---KDDLIIKYNLSSNSTTLHNNNLTNGILHAPNYQLKLPLNNSNLYGMGINNLN
CAGL0K03003g      LQEIN---SRNMRFNW--------------------------------------------
KNAG0A07040       MKVIR---NYYPLAEF--------------------------------------------
KAFR0J00340       MKAIR---EYYPLTDFEDK-----------------------------------------
KLLA0E18547g      LHEFT---LFGILMNVN-------------------------------------------
KAFR0A01860       VIELK---KNNAVFSCV-------------------------------------------
NCAS0F00900       INELK---FRNVIFDWHNYHYQQQVQRHQ--------------------------QYQ--
Kwal_26.8021      VQELL---EVGDV-----------------------------------------------
KLTH0D06842g      LQELM---EAGDL-----------------------------------------------
TPHA0G03510       LQEMDKLSESSLELNDESSTGT--------------------------------------
KNAG0C05810       LDELK---NANVSFNWGTY-----------------------------------------
Kpol_1018.33      LEQLR---INLKANNPN-------------------------------------------
AGL071C           LERLS---SNPNTPTSLINRL---------------------------------------
Ecym_7255         LERLS---SNPNTASHLMNRLHSGANGAV--------------------------AVTAA
Suva_13.246       LDELK---KNNIIFNYN-------------------------------------------
Skud_13.226       LDELK---KNNIIFNYNKTSTNSNDNNNS--------------------------TSTRT
Smik_13.249       LDELK---KNNIIFNYNNSSINSNNSN---------------------------------
YMR070W           LDELK---KNNIIFNYNNSSSSNNNNDNN--------------------------NNNNS
NCAS0A04800       LEQLR---QDNIDIKTAKD-----------------------------------------
NDAI0K01860       LQQLR---LENIEISTIEETMEDRRVDVH-------------------------------
SAKL0A09482g      LQELQSAGVHPIVSNITLINLAST------------------------------------
NDAI0H01400       INELK---LRNFISSQTAAASVAFVTSAAPSIM---------------------------
TBLA0G02230       LKKLK---MTCYL-----------------------------------------------
TDEL0A03070       LQELR---LNNVYVST--------------------------------------------
ZYRO0B02002g      LEKLR---NQNVGI----------------------------------------------
                                                                              

TPHA0C04190       -----ELENKSDEP------------------VVNVTSTPGLIDTDS--QLLNDVSEK--
TBLA0I01480       NQLHPNTSSTTSTSSIYDYNELRLENVKKNTVTVKKLINDAKVNKDELKRVINYIISEAN
CAGL0K03003g      -----PILERLSKQIDGTIEYP----------DTKTLIHEGLLNKDELKNILNTVIDKHN
KNAG0A07040       -----EGK------------------------DLKGLLADGRLHKEDVKRVLVDIVNPTR
KAFR0J00340       --------------------------------DLNELMRSGYLHREDIKRVFLHLIGLER
KLLA0E18547g      -----NGSGNTANLVTTSTGETICLINNEPSTTIRDMLDSNALPKDQVKRCLNYIVDSKC
KAFR0A01860       -----NGGNREKLNDTD---------------DIRNLISLGVINKDDVKKVINKLIDNHN
NCAS0F00900       ----QQGGMPPQIHGANEPFNINSEF------TIRTLVTNGVVNKEDVKRVLNQLVDENE
Kwal_26.8021      -----DGSVMSGMQVTSDESAPEP--------SIKTLIQDGQVKKERVKAVLNAVIARVN
KLTH0D06842g      -----DGSMGTNVRLAIDDMVAGP--------SIRTLVQDGRVKKERVKTVLNAVIARVH
TPHA0G03510       -----DTASPIVNETALSMLNDDSGSSSNDNVSIIAMVDNGTLKKENVKKVLNSIIERQR
KNAG0C05810       -----DGQNSTDSMPKTLSGYPDS--------SIKKLLYRGILNKDDVKRVLNKIIERSN
Kpol_1018.33      ----DNSEPTLEGNGDH---------------NIRTLMGEGILNKDEVKKLLNSLVAQHN
AGL071C           -----HSSDAAAGSAAAAAGTPAAF-------SIKDMIDSGMLSKNEVKKTLNSLINPEV
Ecym_7255         S---ADSSATMVSSSSSSAAGPTTF-------SIKDMIDSGMLSKNEVKKTLNSLINSDI
Suva_13.246       --------------------------------NSNTTSNSGR--REQLRSEHQDFDQ---
Skud_13.226       SASASSGGGGGGGGGAAAAAAPENEDGSSYDPNIKTLINDGVLNKDDVKRVLNNLIVSHN
Smik_13.249       -----NNNSASGSGGGSAAAAPENEDGNSYDPNIKTLINDGVLNKDDVKRVLNNLIVSHN
YMR070W           N---SASGSGGAGAAAAAATAPENEDGNGYDTNIKTLINDGVLNKDDVKRVLNNLIVSHN
NCAS0A04800       -----EGEEDQGTASNT---------------NIKTLLVEGRLNKEDVKKVLNRLIDSAN
NDAI0K01860       -----ERSKSVDTGTSGVNDDIDIKNVKQPGTNIKTLLYDGRLNKEDVKKVLNKLLDGTN
SAKL0A09482g      -----AGQNGVPSLVPVHGDMSMMT-------SIKTMIDDGTLNKDDVKRVLNMLINRSG
NDAI0H01400       -----SINDGMNNTVAGTVDNAVSTPGYETGITIKDLISEGLINKEDVKRLLNILIDEYN
TBLA0G02230       -----EGDDGEEMMNRD---------------NIRTMLYEGLLDKDEVKKVLNELLEE--
TDEL0A03070       -----EGSCKN---------------------NIRTLLYEGRLNKDEVKKVLNSLIDRHN
ZYRO0B02002g      -----DGEVRND--------------------NIRTLLCEGRLNKEDVKKVLNGLIDSYN
                                                               :        .     

TPHA0C04190       ------------------------------------------------------------
TBLA0I01480       K-----------------------------------------------------------
CAGL0K03003g      ------------------------------------------------------------
KNAG0A07040       DTT---------------------------------------------------------
KAFR0J00340       ------------------------------------------------------------
KLLA0E18547g      S-----------------------------------------------------------
KAFR0A01860       SNSNDNNDNDKGAADSHNSNSNNSNIPG--------------------------------
NCAS0F00900       NEP---------------------------------------------------------
Kwal_26.8021      GEINEP------------------------------------------------------
KLTH0D06842g      DGEPGQ------------------------------------------------------
TPHA0G03510       Q-----------------------------------------------------------
KNAG0C05810       ------------------------------------------------------------
Kpol_1018.33      PI----------------------------------------------------------
AGL071C           GDSASHHQLGPSGGDGAGISSLSSSASSASSASAATAAPISSSVSSAGH-----------
Ecym_7255         ADTVGHNT--PSMQVGA-LSSLSSSASSASSASSASSSSTTTAINVPGNNNTNVSVHQQQ
Suva_13.246       ------------------------------------------------------------
Skud_13.226       K-----------------------------------------------------------
Smik_13.249       K-----------------------------------------------------------
YMR070W           K-----------------------------------------------------------
NCAS0A04800       QEQQPASLKEESE-----------------------------------------------
NDAI0K01860       STFSDSTDGVVDNVRPRRGHSYSVADSRSRKSRN--------------------------
SAKL0A09482g      MSM---------------------------------------------------------
NDAI0H01400       N-----------------------------------------------------------
TBLA0G02230       ------------------------------------------------------------
TDEL0A03070       NNQ---------------------------------------------------------
ZYRO0B02002g      G-----------------------------------------------------------
                                                                              

TPHA0C04190       ------------------------------------------------------------
TBLA0I01480       ------------------------------------------------------------
CAGL0K03003g      ------------------------------------------------------------
KNAG0A07040       ------------------------------------------------------------
KAFR0J00340       ------------------------------------------------------------
KLLA0E18547g      ------------------------------------------------------------
KAFR0A01860       ------------------------------------------------------------
NCAS0F00900       ------------------------------------------------------------
Kwal_26.8021      ------------------------------------------------------------
KLTH0D06842g      ------------------------------------------------------------
TPHA0G03510       ------------------------------------------------------------
KNAG0C05810       ------------------------------------------------------------
Kpol_1018.33      ------------------------------------------------------------
AGL071C           ------------------------ATSAGHAASAGTSSIPPPLAVSVAPAIAGSGGLASM
Ecym_7255         PHHQHHHHHHHSAGAPNLVVAARPPSTSAAPDATNQSNIPPPLAVSVAPTITGSGNLTSM
Suva_13.246       ------------------------------------------------------------
Skud_13.226       ------------------------------------------------------------
Smik_13.249       ------------------------------------------------------------
YMR070W           ------------------------------------------------------------
NCAS0A04800       ------------------------------------------------------------
NDAI0K01860       ------------------------------------------------------------
SAKL0A09482g      ------------------------------------------------------------
NDAI0H01400       ------------------------------------------------------------
TBLA0G02230       ------------------------------------------------------------
TDEL0A03070       ------------------------------------------------------------
ZYRO0B02002g      ------------------------------------------------------------
                                                                              

TPHA0C04190       -----
TBLA0I01480       -----
CAGL0K03003g      -----
KNAG0A07040       -----
KAFR0J00340       -----
KLLA0E18547g      -----
KAFR0A01860       -----
NCAS0F00900       -----
Kwal_26.8021      -----
KLTH0D06842g      -----
TPHA0G03510       -----
KNAG0C05810       -----
Kpol_1018.33      -----
AGL071C           GNLHP
Ecym_7255         GNLHP
Suva_13.246       -----
Skud_13.226       -----
Smik_13.249       -----
YMR070W           -----
NCAS0A04800       -----
NDAI0K01860       -----
SAKL0A09482g      -----
NDAI0H01400       -----
TBLA0G02230       -----
TDEL0A03070       -----
ZYRO0B02002g      -----
                       

FASTA FORMAT for MUSCLE Version 3.6

>TPHA0C04190
-------------------------------------------------------MSRSN
RLLY---------------DESEVPPINRLQRNYYYQNH----------------DYVSN
NILHQRSNRIEQ---------------------------------NHLVSNS-HLFANAN
NNTLKA---------FSNRSTKQ---------------STVV---HNNSIHPYNNINHFN
NNA-----AGLHNYSNKLSVAKLIDS-AHEDNLHLQRNALHPPYTQSQA-----------
---------------------------SSSLLSLPQPNFHNYQQQQQDFQNTNMKYQPWN
SPVYNTNTNY----------LSKLN---HGNNHFPSIQHPNHIA---------------N
TLPVPYPKTSATYYHPNKILPDPNESQPVQQHPMP--QYKKATILFTSNGTENKSNQRHS
NTENDSNHSI-----------------HEQQNSLQDNDQAYASKSPKQDF----------
----------------------------EYLFCSTNLSTFIQDSQKKLFRYKR-----AK
KIKFYECKVCHKTFKRNSWLKRHFFSHSKLKNFSCNWCSGKYKRKDNLVQHIRKKHRDKT
NKEPN-------------------------------------------------------
-----ELENKSDEP------------------VVNVTSTPGLIDTDS--QLLNDVSEK--
------------------------------------------------------------
------------------------------------------------------------
-----
>TBLA0I01480
-------------------------------------------------------MNVPK
PNAT---------------NNTASQDPLNIPFLNSNSLHLPLQAATAA-------AAAAN
AQTQNYNPLS-------------------------------------SINSL-NSYSTHT
SSNTYS---------NNNSLQQA---------------YLPF---ANSNAANSL----YT
QPA-----FNYPLATSTTSAY------NYTTSNPNTTNAIANANANANA-----------
---------------------------NANANANAIANANANANANANANANANSLSSYN
NSNTSTSINTNSNS------QNYIN---TNTSSSSSYPFQFQLPVT-------------N
HDNSTIPSSANTNSTNNNNSYLDSSTSLDNSSNNNLSIPSFTNQFIRDKYLPTSQHHLPL
NNTNTNPNLNS----------------FQNVINPTTLPSSSITPPPLQHPNSLINN----
----------------------------SILNNNNNNNANNSNNHNNTANLLNAPQSAIN
QDIIFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKHLDYI
LKKLN---KDDLIIKYNLSSNSTTLHNNNLTNGILHAPNYQLKLPLNNSNLYGMGINNLN
NQLHPNTSSTTSTSSIYDYNELRLENVKKNTVTVKKLINDAKVNKDELKRVINYIISEAN
K-----------------------------------------------------------
------------------------------------------------------------
-----
>CAGL0K03003g
MKDGASEDCNPSSAVEEDRGRHAAPINHLGSSNKANEIAVADREHTFSIRKLYPISENVS
RVKS---------------QQQEVPYQRNLPTINGTETESARQNLQHAFDKYSKNNNLTP
KAVQPALNQGVRYIWTKTNPVPRVGNSTVSLSNSSEGSSGAMVNNNDHALDN-ALNTSVT
KGQNDPRLSHILSSSNGNIDTTVAKHSLRKEEKSSLEISNNF---DHQAQAPKGLDLSAV
DTT-----SQPGLYTTTGSQVHPVTQ-HYQYNGSKMPYDWSNSLRQRIG-----------
---------------------------NSNTAGQVYFVGTPPDAPNRSHDYTHLYANTAP
LPQGVSYVWHAHGPPFLASNSNTTE---SYSGSTLVAATTNQAKIASPSVSYGN-----N
THPENTPRLSVSNIHQLTPNQKGASFQRPLQSILPIIPSHTQSKFANVKLDQDKQTNFGN
QIMFNSSENTPPLAHQVVYADNRLGSVPNNAISYNADASRAPIGPPIGSAGVYYNPNYTY
VMQEQPKTVSDNVVSRINSHPILGQTNYLLPRADPSLTTQLGVTNEMMFGNQGEKIEVSS
LAFPHRCHLCPKLFKRKSWLKRHLLSHSQQRHFLCPWCNSRHKRRDNLLQHMKLKHVPNL
LQEIN---SRNMRFNW--------------------------------------------
-----PILERLSKQIDGTIEYP----------DTKTLIHEGLLNKDELKNILNTVIDKHN
------------------------------------------------------------
------------------------------------------------------------
-----
>KNAG0A07040
------------------------------------------------------------
MAMY---------------HYQHAPQHTILPPIEKYLQHQPINQ-----------MNNCN
NNGVYASHYMQCMLPIVQG----------------------------VKNIN-VPCTTTV
RGYPST---------MGVSGPHD---------------NMYS---LRDTAYPVSSTGQVI
QPA-----GVNLGYQHNIITPL-----LPKTVLFSGYPQIINDQSQSQG-----------
---------------------------TPPFLAYNPQSQQFYQRPYQHREYMQQGVPAAR
TPCSFETIRSDS-----------------------------------------------N
GMHSPLGSVSSIEASPSSTSQPVQLPTEEEEGKST-------------------------
------------------------------------------------------------
----------------------------PMLTLTRNPKPKRKASARGKGRTPK-----PP
TMTSYPCPQCPKSFQRSAWLKRHSITHTNSHPFKCVWCKSEHKRRDNMFKHMKLKHMNLL
MKVIR---NYYPLAEF--------------------------------------------
-----EGK------------------------DLKGLLADGRLHKEDVKRVLVDIVNPTR
DTT---------------------------------------------------------
------------------------------------------------------------
-----
>KAFR0J00340
--------------------------------------------------------MNKI
MNGN---------------NQQPVIRPHVQGFLERKRLESPRL------------VYVPN
VPSADTMNYTER------------------------------------------------
--------------------------------------MGDI------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------V
TVPQYIPNPVPQYVIAGQPMQGYFVSSNNITGP---------------------------
------------------------------------------------------------
----------------------------IIDYNRRESEPRCMYAYVKEEGKNE-----DE
VTSVYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELL
MKAIR---EYYPLTDFEDK-----------------------------------------
--------------------------------DLNELMRSGYLHREDIKRVFLHLIGLER
------------------------------------------------------------
------------------------------------------------------------
-----
>KLLA0E18547g
----------------------------------------------------MNINTNTD
ADIG---------------PNSGLGFGNVMVKHEQELLQKQQLFQM---------SQYQQ
QQQQQQQVQQQQ-----------------------------------------QQQQQQP
QHQMMQ---------RSTTPVMM---------------HPVY---YTNNGASSQHSQQLP
QSQ-----ASAFTHNSSIGGSG-----GFNTSSNSSLNSAGHDSNQLLS-----------
---------------------------LQSNNGNINSTSQLQQHQYQNMYQHQQPTFPLS
QSNQTNRIFSSNSTSANTTNYQYSN---NNNLQQ---AYHPAVP---------------V
HSIDRMQHYKQLHNLQQLQMLQVKLQAQTQNLSHNIQPSTALQPLNIRTGEDSFSTFKEH
NTHEQ-------------------------------------------------------
----------------------------QLLSNPNNGRDQDHDQQQQQLTHDGVP---HE
SHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYL
LHEFT---LFGILMNVN-------------------------------------------
-----NGSGNTANLVTTSTGETICLINNEPSTTIRDMLDSNALPKDQVKRCLNYIVDSKC
S-----------------------------------------------------------
------------------------------------------------------------
-----
>KAFR0A01860
------------------------------------------------------------
MNYW---------------NNQSPPTIIKPELSSNLLDPSFKNSENAS-------KNKSK
KNNKNHNDNSQM--IIKPNNDCSPNNNIATTVPNTAVAT--------NIVPA-YPYNHN-
---------------NYNYIPNT---------------QYYY---NPNNLYNQH----YL
QNR-----QYPLQQQQQFP----------QQFYPSNIPVQQHQPQKNND-----------
---------------------------QNAIHNSLMNNKKFNRPSVSNIQDTQTSGSNIN
IAATATTNRTNLVANNDQMNSSNNI---ANTSPF---IYHWGPINTSKNISELQDS---N
PYSSTQPFIIQRQFYNDLPYANNQRPHVYQLSSQQ--PLYSSTIPFTVSGNDTQPNASST
STVPAKQDILI----------------QEKKHSMHSIESKPNESKYRNDANS--------
----------------------------SKDNNDSNNAGGNGDNTDNSSNVIG-----GN
LTLIHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYL
VIELK---KNNAVFSCV-------------------------------------------
-----NGGNREKLNDTD---------------DIRNLISLGVINKDDVKKVINKLIDNHN
SNSNDNNDNDKGAADSHNSNSNNSNIPG--------------------------------
------------------------------------------------------------
-----
>NCAS0F00900
-----------------------------------------------------MSNWTAY
QDQK---------------VKQEQEQEQEQEKQNQRQSQMTAAQKDTSTSTSTNTNGVSS
LLNPPQLQSEKLSLPINTTDQMHSHSHSHSKNDSLGTIPLPQTSKYNPIYHQPSSYMMNE
SDMRRN---------YYPTPQQQ---------------QPPP---QQQQQVTGSQAQTNT
SPFLYHWNTGRSDENQQQQQQMLQSLPTTSNPYGVQYNVLAPDTLQMYS-----------
--------------------------MGQVPSNMGAYIPYQTAQQYQSVPWVIQYDPYST
GPPPPPPPNASITNSPP---YQQSY---PSQQPQQSQPQQYQRPV--------------S
VSPNILPQPVYSQTIKSSLKNSFNGDTNNATTTTSISQPFKRSDAMASIGTNIQQNNNNI
NNSRDKN--------------------------LPPISSITTTVPTTASTT---------
----------------------------TATTPPSVIREPHSNQRFVTPSPPRGTF--DS
ENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKNL
INELK---FRNVIFDWHNYHYQQQVQRHQ--------------------------QYQ--
----QQGGMPPQIHGANEPFNINSEF------TIRTLVTNGVVNKEDVKRVLNQLVDENE
NEP---------------------------------------------------------
------------------------------------------------------------
-----
>Kwal_26.8021
-------------------------------------------MLSAHSFEGDSGLDSET
HTEA---------------NNSTTSTQPPMAFRRRSSAASLASVGSDPMRTTTRVGSSSH
GTWVPPYAAAAA--APPPPPMQLPAPLPAPAPVSTHYSVAPIHSQAQSIRQT-PAWDTAA
SPGSAPQLQQYPNTLQAQYPVPS---------------QAQP---QSPQAPGHAQQPQQP
QQP-----QQAPYFRGSFSEYTEYDQRYVPYYYKPAYPGWGPPQPLPPP-----------
---------------------------PPPAQQQSQQHQPPYQQQPQPHPQQQQQQHHHH
LQQQ----------------HPYQA---AAWNPYQVPSHAFGT----------------H
HVPNQQQQPQQQQQQQHTPQTQPQSQSQPQSQLQQ--APTPYKQTYNQGFAPASDRPQMQ
---------------------------PQPQRWATEMPQSAYMPDPQHIGALAARQYA--
----------------------------GGYGSGSAAGPDSGPVALLAPMSNGPFGMGLV
PPVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHV
VQELL---EVGDV-----------------------------------------------
-----DGSVMSGMQVTSDESAPEP--------SIKTLIQDGQVKKERVKAVLNAVIARVN
GEINEP------------------------------------------------------
------------------------------------------------------------
-----
>KLTH0D06842g
---------------------------------------------------MLSVHPYTS
PADI---------------DRDARRGSSQLDFRRRSSASSVASIGGAA-------AGGGP
AQSPTSALWAAAPAPAPAPPLVPPAAVSSTVHRQPQYSVAQMHSQAYAIRQK-HARASST
DSSGTPI--------PGPAAAVT---------------TPGP---ASVPAPVTAAQQQPP
PPP-----IGGPLYELMEYDTR-----YLPYHYKSAYPMWGPAGPTAAAAGTA-------
---------------------------PGTAPGAPGAAYPAYQYPPPAWNSYQAPHHVWN
GQPAASSGGYPHMQLQIPTQLPQQP---QMTTSQQQQQQQQQQ----------------Q
QQPHQPQQPQQQYQFQQQPQQPQQPSLHRQSISHRQSQGFSADQFPSALAATELPLSAYA
PDPRSGAQLAG----------------RPYVVAAAPGPAAASAPFGLGAVGIGAG-----
----------------------------AGAGARGPAPYSGTGSDRGSFDDTG-----SS
MAMLYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQV
LQELM---EAGDL-----------------------------------------------
-----DGSMGTNVRLAIDDMVAGP--------SIRTLVQDGRVKKERVKTVLNAVIARVH
DGEPGQ------------------------------------------------------
------------------------------------------------------------
-----
>TPHA0G03510
-----------------------------------------------------MTKRDPR
LNAE---------------PDNSNSSCNNTNSGNQFDYNKPLLDSQ---------AKSPD
NQTKRINVRTSS-----------------------------------INKHE-KPYLLAP
ELKSFN---------QYNNNTTR---------------HNSL---RNNNFNLRPWTPTVH
NTY-----AFPPFYSEK-------------------------------------------
---------------------------NNGTNNSQSVIVNSSKTVQSDGDFLSKGLPPRL
GPVH----------------TQYNN---QHKIHASNAQFNYHLP----------------
---FPLADSNISLHTQSNSNASNYNNGSSTTGSSSDSASGGSGSIMTSKNEKIYSNDQQ-
------------------------------------------------------------
----------------------------QSYYAQNNQQQDSFAFSDNIY---------MN
NKYIFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQV
LQEMDKLSESSLELNDESSTGT--------------------------------------
-----DTASPIVNETALSMLNDDSGSSSNDNVSIIAMVDNGTLKKENVKKVLNSIIERQR
Q-----------------------------------------------------------
------------------------------------------------------------
-----
>KNAG0C05810
------------------------------------------------------------
MNPW--------------IRQLAPQYPLMVDNNNNNTSNNPGANNSGGVL-----VNENN
GFKRDQRTLLHPLSSTPRNSESLPANSNTVANGYGYQLFQPYVLQPSPHYQA-YQNAPAN
YNMLAQQQQQQHHQQQAQQGQRPQAQQTPQQG------PYHY---QYNVLRLSQPTVGSP
TPSINSL-TGSANSANGSNGIGNQNGSGVTSNSTLSFGIGQPSDGLGSN-----------
---------------------------NSSNSSLSSSSSTSNNNSTGSKSVATTTNNGTT
KKTHSPLIYDLRTVVTPHSLISINDQKPGNGSNNGRGSFVAGTPRLARNDSTSE-----A
PPPQQVNGAMNPKHYAGTNFNNGMGNNNNGQRMLNPAPFQQQLYSIPMNGPYQYQQQRHH
SYSGAVINNPT----------------PGYSLSNSALATSSKFPFGDDANGNGTDNILKK
GTGANDIT--------------------GIVNNGTIPSEQDTSNNKLTITTLTNSDNSSP
SNFIHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYL
LDELK---NANVSFNWGTY-----------------------------------------
-----DGQNSTDSMPKTLSGYPDS--------SIKKLLYRGILNKDDVKRVLNKIIERSN
------------------------------------------------------------
------------------------------------------------------------
-----
>Kpol_1018.33
------------------------------MDSNSNDGSGSNTDYSLFSDPNLNVPATVD
QSMG---------------ENSSNKINNQSSFNNTIIHNQTNNQTNNN-------NTRSP
HILLPNPTINLQNSATILPNVQSQSNINPILNVNNNTTANSSNNNYYYQTSR-QSYYGIG
SNNNNSTLYQNNNNQIPGNPEYQ---------------SPTYLYQHNGNEQTNNNIGNFQ
SSY-----VNRSQLIYNNSTFANKNQITVDESNNYNTGNARDNLDNINRHRVQQQQELQG
YPI------------------------NSSIKNYEYNQPYQQYQSINNQPHHLPNINQMM
NPKKIINQFHPLTSIITNLKRNSSNFIEGNLLPNLPIQSQQSTPLQS------------S
YNPSQNDGRWPSSYYKRSDSDSTLTIPKVKQSNDHVDTSNSLPCISDRNLSHQDTSSNSD
KSTFSMLNTLNKTQDAFNKSDLSGGQSTDVSSYGPSQTSQSSAPDSVEDIKIKFPKQSLE
GIGLNDDFN-------------------LSSSSSLSSTSSSAYSTPSNIGHQNKTNASNL
KNFAHVCHICGKQFKRKSWLQRHLLSHSSERNFDCPWCLSKHKRKDNLLQHMKLKHAENV
LEQLR---INLKANNPN-------------------------------------------
----DNSEPTLEGNGDH---------------NIRTLMGEGILNKDEVKKLLNSLVAQHN
PI----------------------------------------------------------
------------------------------------------------------------
-----
>AGL071C
------------------------------------------------------------
MDYE---------------SQQQQQQAAAGPGGPAGAGPAGPAGGGGGT------AGGPS
QLHVQQYQRHVG--------------------------------GELYDAKY-VPNVPVP
MPMSMS---------TYPTPSTT---------------PYYF---HEDP-----------
--------HSQVVYHQLQQ-----------------------------------------
-----------------------------------------------------QLPHLMS
QPQ-------------------------GGGVAAQQPYYSWGMP---------------H
SYQYSVVHAQVAPGQGPGQGAAQGGTQYAQQVAIP-------------------------
------------------------------------------------------------
--------------------------------PPAAGLGGMGAGQLMDL---------NS
FENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEML
LERLS---SNPNTPTSLINRL---------------------------------------
-----HSSDAAAGSAAAAAGTPAAF-------SIKDMIDSGMLSKNEVKKTLNSLINPEV
GDSASHHQLGPSGGDGAGISSLSSSASSASSASAATAAPISSSVSSAGH-----------
------------------------ATSAGHAASAGTSSIPPPLAVSVAPAIAGSGGLASM
GNLHP
>Ecym_7255
-------------------------------------------------------MEYEG
HHHH---------------QQQSAAAAAAQQQQQQQPQQPQQPQQ----------PQQPQ
QPQQPQQPQQYQ------------------------RHIVSAGSGDLYDTKY-VPNMPMP
MHMSLS---------TYPTPSTT---------------PYYF---HDDPHAQVAVYHQLQ
QQL-----PHLMNQQLQQQ--------------GQAQGQAQTQHYQQAQ-----------
---------------------------AQQAQAQQQAQQQAQQQQAQQQAQQAQQQQAQQ
QQAQAQQAQT----------QQAQA---QAQAQQQQPYYSWGMP---------------H
TYQYSIPHPQMQQTQQPQPMQQAQQHHQQQQHSQQ-------------------------
-----------------------------PQQYVQTIPQLGAIPPP--------------
----------------------------AATAPATSTSIGVSNVTSSQLMDP------NS
FENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEML
LERLS---SNPNTASHLMNRLHSGANGAV--------------------------AVTAA
S---ADSSATMVSSSSSSAAGPTTF-------SIKDMIDSGMLSKNEVKKTLNSLINSDI
ADTVGHNT--PSMQVGA-LSSLSSSASSASSASSASSSSTTTAINVPGNNNTNVSVHQQQ
PHHQHHHHHHHSAGAPNLVVAARPPSTSAAPDATNQSNIPPPLAVSVAPTITGSGNLTSM
GNLHP
>Suva_13.246
--------------------------------------------------------MNAD
HHLQ---------------QQQQQHTIL---------------------------QNAPN
NISAGADPLTSR--TFNASVASSSNKDDVIVNPNTRELPMPLHQQQ-YIYPY-YQYSNNN
NNSSNV---------AAANNTSA---------------SPII---HSNSNAPATDFGGAG
GPN-----NNNTTTTTTTN---------------NNTNNIHTNQYAAAT-----------
---------------------------TANMNANAAAAAAYYAFPNSNIPIPQQDQPYMF
NPASYINHYYSAMNNNMNNNNNNNN---NNNNNN---NTGSNAA---------------N
ASSNLPPHPAPPPHHRHNNSSNSNISN----TNNP--PPPHQPTIITDQFQFQLQQNGSP
NLNMSMN--------------------QAQPLHLPPGWKINTMPQPHPAA----------
----------------------------ASNHPPLPPQPPNSVAPNAMP-APS-----SD
QKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYL
LDELK---KNNIIFNYN-------------------------------------------
--------------------------------NSNTTSNSGR--REQLRSEHQDFDQ---
------------------------------------------------------------
------------------------------------------------------------
-----
>Skud_13.226
------------------------------------------------------------
-EIS---------------RQQQNADHHIQQHQQRQQHQQRQQHQQHTIL-----QNVPN
TNNVGADLLASQ--HFNAT-AVSSNKEDVMVNPGGRELPMPLHQQQ-YIYPY-YQYANNS
SNSTSV---------ATANNTSA---------------SPVI---HSNSNNSNNS---AS
DPS-----AANNNNNNNNN-------------------NIHTNQFAAAA-----------
---------------------------GNMNANAAAA--AYYAFPPSNMPIPQQEQQYMF
NPASYIGHYYSAV-------NNNNN---NNNNGN---NGGSNPP---------------N
PVPPPPHHQQQQHHHH---SSGHNNLNNSTVNTNN--GPPHHPTIITDQFQFQLQQNAPS
SLNLNIN--------------------PAQPLHLPPGWKVNTMPQPHPAA----------
----------------------------PSNHPSVAAPPSNSVALHALP-TSS-----ST
HRYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYL
LDELK---KNNIIFNYNKTSTNSNDNNNS--------------------------TSTRT
SASASSGGGGGGGGGAAAAAAPENEDGSSYDPNIKTLINDGVLNKDDVKRVLNNLIVSHN
K-----------------------------------------------------------
------------------------------------------------------------
-----
>Smik_13.249
--------------------------------------------------------MNAE
HHLQ---------------HQQQQQQQHQHQHQHQHQQQQQQQHQQHAIL-----QNVPN
TTNVGNEPQASQ--PFNPT-STSSNKDDVTVNSGARELPMPLHQQQ-YIYPY-YQYTGNA
SGNNNA---------AAGNNTSA---------------SPIV---HNNSNNSNNSNIAAA
PDY-----TAVNSNTSNNS---------------NNNNNIHTNQFAAAA-----------
---------------------------NINTSAAAAA---YYTFPTANMPIPQQDQQYMF
NPASYIGHYYSAV-------NNSNN---GNNAAN---NSGSNPP----------------
---HPAPPPPPPHHHHHHRSNPHNNLNNGTVNSNN--APQHHPTIITDQFQFQLQQNHPS
NLNLNIN--------------------PAQPLHLPPGWKINTMPQPHPAT----------
----------------------------TPNHPPAPVPPSNSVALNSVT-APS-----SD
HKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYL
LDELK---KNNIIFNYNNSSINSNNSN---------------------------------
-----NNNSASGSGGGSAAAAPENEDGNSYDPNIKTLINDGVLNKDDVKRVLNNLIVSHN
K-----------------------------------------------------------
------------------------------------------------------------
-----
>YMR070W
--------------------------------------------------------MNAD
HHLQ---------------QQQQQRQQHQQQQHQQQQHQHQHQQQQHTIL-----QNVSN
TNNIGSDSLASQ--PFNTT-TVSSNKDDVMVNSGARELPMPLHQQQ-YIYPY-YQYTSNN
SNNNNV---------TAGNNMSA---------------SPIV---HNNSNNSNNSNISAS
DYT-----VANNSTSNNN---------NNNNNNNNNNNNIHPNQFTAAA-----------
---------------------------NMNSNAAAAA---YYSFPTANMPIPQQDQQYMF
NPASYISHYYSAV-------NSNNN---GNNAAN---NGSNN-----------------S
SHSAPAPAPGPPHHHHHHSNTHNNLNNGGAVNTNN--APQHHPTIITDQFQFQLQQNPSP
NLNLNIN--------------------PAQPLHLPPGWKINTMPQPRPTT----------
----------------------------APNHPPAPVPSSNPVASNLVP-APS-----SD
HKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYL
LDELK---KNNIIFNYNNSSSSNNNNDNN--------------------------NNNNS
N---SASGSGGAGAAAAAATAPENEDGNGYDTNIKTLINDGVLNKDDVKRVLNNLIVSHN
K-----------------------------------------------------------
------------------------------------------------------------
-----
>NCAS0A04800
----------------------------------------------------------MM
KHYY---------------NNQLLPNQNDIDNIDDTEILNTAPGVVAGPV-----EFIPF
NTQPDNNNISNV--SEGTSWTRSAPPPQQQQPPPAYHQKKASNDTFQQNYPF-PPQQQHV
YMQPFPPQ-------QQGMNASA---------------YPPP---PENNTSNNNIHYFEM
DPN-----TSNNNNSINNPSFVMGDGYMVPRWLPVTSPQSGNTLDRNIS-----------
---------------------------STSLRRLMYTSSSGSSTQLNQIPFIQQELDNIQ
SPNTDTNNNTNAFTTTNKQIPNSNT---NKYRTYSEMTFHMMPPGSQ------------Q
APNFQLVGTAGPTTNEEDPIEAPQPLPPWFMYNNSSTANKNVTVFAPDQMTAPDMTTTPQ
LAEYND---------------------PTTATLSPPTSSLNYLPPKSAPPMTNNAMREFH
----------------------------QHISMTGASGPFMASSSSSSSFSVE-----RD
TPSVYQCHMCVKSFRRHSWLKRHLLAHSSQRHYSCPKCVSKHKRKDNLLQHLKLKHTAFV
LEQLR---QDNIDIKTAKD-----------------------------------------
-----EGEEDQGTASNT---------------NIKTLLVEGRLNKEDVKKVLNRLIDSAN
QEQQPASLKEESE-----------------------------------------------
------------------------------------------------------------
-----
>NDAI0K01860
MTSPSFNVHLLPHREEENSYDDPINSSNNNDFRNVEYSTYDNTQSSFLERKIWVQSDYQQ
LPMEGISRQSTGQSWFQGHPSQQPQQPQLFQPQTQPQQQLPRPIYNNTVIP----LSDSQ
QQQQQQDDLIQQSQFYNLRQNQIQSESAIYLQNNNGNLEDRSSSPN-INNNI-SSSGSNN
GNLGMSIPRWAPQKLTSLYPAQS---------------NQTF---DPQQFSQSNCNHPVP
NQF-----ASQLGYSTDNTVSYANPSSTLQQSESLLSNSFHSNIPPTRTISLPQQSKFRS
LSETVESQTLRSTPAYPPAQLFKKYYESNDNPTTTAASASATTNTSTTTNNTNNNNLHEQ
LPIQEQGHVKVNISQPLQQSQQKQN---QHQNQSSWASFPNSTTIRPCQENIVLSSSSSS
SSDRFARSTVDNIIATTSNNNNNNNNNNNNNNSNNIPGYAGSTSGSDDGSHNINPRQHHF
QNPHHQHILSTTSQPPPPCQSRIHISEEEGTFLNMVPMNNYGIPLPSPLTTSLDTIGSSV
GSSSFHPMSSSSGVSG------------NINDTTASNSNSSSNSTSTSMNNNNNSNN-II
NNNVFQCSYCVKSFKRFSWLKRHLLAHSPERHYSCPWCLSKHKRKDNLLQHLKLKHTEMV
LQQLR---LENIEISTIEETMEDRRVDVH-------------------------------
-----ERSKSVDTGTSGVNDDIDIKNVKQPGTNIKTLLYDGRLNKEDVKKVLNKLLDGTN
STFSDSTDGVVDNVRPRRGHSYSVADSRSRKSRN--------------------------
------------------------------------------------------------
-----
>SAKL0A09482g
-----------------------------------------------------------M
LSVQ---------------KRTQVPVDHHLEMDFNAQHVF---------------AKHEN
ELLESDIHRQAR-----------------------------------YQQQL-NQYNT--
---------------QYLSATQP---------------QFVF----SQVQPQGIAISNYR
NPY-----YDHNDWNAQQR----------------FVKSAGTENSVGNS-----------
---------------------------TFNNSGSSSGSSIGSSISSSISSNGSIGNPVGN
VPSGIPSQA-------------------WNKAPALYAPFPWN-----------------V
NSAPPIPQQQQQQQKQQQNPQQQKQQQNPQPSYQEWNRGVFSN-----------------
---------------------------PEYPLSVYPVDSRGYSDPPHITSQHVA------
----------------------------SHQRPPAAVQPHQGQNP-------------AD
PENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQV
LQELQSAGVHPIVSNITLINLAST------------------------------------
-----AGQNGVPSLVPVHGDMSMMT-------SIKTMIDDGTLNKDDVKRVLNMLINRSG
MSM---------------------------------------------------------
------------------------------------------------------------
-----
>NDAI0H01400
-----------------------------------MNDAGKRLMGNSDFTTGQYTAKQEP
QSNF---------------QSQNAQNNGPSQFENRSQQPLGQGFQ----------RNNPL
VQHPPINTLGKE--SGMFMNNSSINRSISNTSPMLYHWTKPTNTDEEKKADD-NSDNGVP
KQTSLI---------QQPYQRQSYPSDY----------TPIY---HQQQPRFVGQQSVPP
PPP-----PSTNHALPIQQDF------QATIGHPQQAPVYGRVPLRNMN-----------
---------------------------QTVIQAVPLHSQYFTAYGMPQIPTGQQEPLLIS
NAPPISYMPTIPTTVPVTT-FQRQN---SNALPNMYIDNGQKVPVQPEQ----------I
ASKQYIPSTLNNVVHSHTNSNIYYTSPNYQMVPEDISRSHHSQNFITSQTVVTQPNFKTG
QLPFSYPNIVA----------------PKEERRNDSSFSIDNTNPNPDNANSNTTT----
----------------------------IINNNNSNAVAIATILSMGEF---------DI
ESQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNNL
INELK---LRNFISSQTAAASVAFVTSAAPSIM---------------------------
-----SINDGMNNTVAGTVDNAVSTPGYETGITIKDLISEGLINKEDVKRLLNILIDEYN
N-----------------------------------------------------------
------------------------------------------------------------
-----
>TBLA0G02230
------------------------------------------------------------
MNNK---------------SNNEGNANSNEFRSNRNQFPR---------------VGETS
RTSPWQYHMQNE------------------------------------------------
--------------------------------------GPLP------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------Y
SSNYLIPNNKDCQGVGNGNVQRVEGNNGNREPPKN-------------------------
------------------------------------------------------------
----------------------------QIYNIYYNVRPTEQELQVLLYNSS------MN
EMAYHKCPQCEKRFKRKSWLKRHMLSHSEERQYSCPWCISRHKRKDNLLQHMKLKHTDEV
LKKLK---MTCYL-----------------------------------------------
-----EGDDGEEMMNRD---------------NIRTMLYEGLLDKDEVKKVLNELLEE--
------------------------------------------------------------
------------------------------------------------------------
-----
>TDEL0A03070
------------------------------------------------------------
MNNW---------------PHQQGRRSGEQDERSQRPMPLNLP------------PRYSY
TQYPHAFPVVNA-----------------------------------TVPQQ-YLYVPG-
---------------SVPPPPQA---------------QLQF------------------
------------------------------------------------------------
-----------------------------------------------------PIYPYYP
QPA--------------------------------------------------------A
GGGAAAPPPRMRLKLEQPPMPMPMSIPGQRAVAVA-------------------------
------------------------------------------------------------
----------------------------SLSSNSADDEEQR-----------------EA
QGYVHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYV
LQELR---LNNVYVST--------------------------------------------
-----EGSCKN---------------------NIRTLLYEGRLNKDEVKKVLNSLIDRHN
NNQ---------------------------------------------------------
------------------------------------------------------------
-----
>ZYRO0B02002g
------------------------------------------------------------
MDIY---------------ESERLPLPQPLYYRNPAAGA----------------ADAAT
RAMPGELPTMN---WKIPS----------------------------ITRQN-HQHNHAP
IITRFP---------ITPSGHQT---------------PSAF---TAR----------SV
VPP-----HATPMVQINSA-----------------------------------------
----------------------------------------------------------FA
LPGDSAGGR-----------NDRSN---GTAATS---NIPSMMP---------------T
VAGTTAGHQGPSLPLPHVAATMGQAGAGVMAASVG--AM---------------------
------------------------------------------------------------
----------------------------RIAAVNATQQQQAQQQQQQKMQLPR------L
NGLSHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYV
LEKLR---NQNVGI----------------------------------------------
-----DGEVRND--------------------NIRTLLCEGRLNKEDVKKVLNGLIDSYN
G-----------------------------------------------------------
------------------------------------------------------------
-----