MUSCLE (3.8) multiple sequence alignment

KLLA0E18569g             ----------------------------MSNYHSRNLRRVAGVLCQELNSTGDSD-----
Agos_YGOB_Anc_2.532      -----------------------------MHAHAAAHAAALAAFPPTLHG----------
Ecym_7256                ----------------------------MEYPAEILALYINDAFPEQLACRNGCT-----
TBLA0G02220              ------------------------------MDVRRLVQLVDNAFPKSISTKQGIT-----
KNAG0C05820              ---------------------------MDENDLTLFLQTVDRQFPTVIGCDLNGTAVS--
Suva_13.244              -------------------------------MFQQFLSICMEEFPQTLDYTGSDDENGDS
YMR069W                  MRSSVYSENTYNCIRTSKEHLTERRRVAMAPMFQHFLNLCVEKFPESIEHKDTDGNGNFT
Skud_13.225              -------------------------------MFKKFLSICIDEFPETLEYTESNENATVV
Smik_13.248              -------------------------------MFHQFLKICMQDFPETLEYTNTDGNNGTA
TDEL0A03060              ---------------------------MEQESLNDVVKYANQNFPTTINAAGIQ------
ZYRO0B01980g             ----------------------------------------MPNWPG--------------
Kpol_1018.34             -----------------------------MSELLHLVDVAENIFPETLELLNDNSSTSNQ
CAGL0K02981g             ---------------------MTNNELYGTNVNDSFLHHVLDCFPKVITTKSNLPKDIED
TPHA0C04180              -----------------------------MDDIVKFVKIVDSHYPDEIYVNKNLTK----
KAFR0A01850              --------------------------MENIEIFNGFLKIVSDEFPKELRTKGQN------
NDAI0I02270              ---------------------------MHTSTSDALLNIVCEEFPTILQSADGVTT----
NCAS0D02640              -----------------------------MHAFEAFSHMILEEFPLTLEVTLQEQLKC--
SAKL0A09460g             ---------------------------MVDYPANVLLPYVLDSFPTSITLKDGSL-----
KLTH0D06820g             ---------------------------MVDYPASELFPHVTQCFPLVLTLPNGQQQ----
Kwal_26.8016             ---------------------------MADYPADYLVPHVTDSFPTTLTLASGQR-----
                                                                                     

KLLA0E18569g             ----VVCEVFSN---------------RVHSGDPNYLGSTL---------------PKCL
Agos_YGOB_Anc_2.532      ----LARA----------------------PAAPARLPAAA----------RRRLAADLT
Ecym_7256                ----LSRDIII----------------------TDRLSVAA----------RQKFAKQLT
TBLA0G02220              ----LERKIYII----GDSENNSLLSDQNNNSNDDEIYWYF--KDRKNPTVENIIKTQIF
KNAG0C05820              ----LKRRIHYIEGVGDDDDESHNKIMSYPGGLPPLPPTTDDNPTAKEDNTCERCLRIFL
Suva_13.244              TTTLLRRQMMYM--PEDDGD-------DGGIDTPECMNYKLH-KAD-----GDQTLHSCV
YMR069W                  TAI-LEREIIYI--PEDDTD------SIDSVDSLKCINYKLH-KSR-----GDQVLDACV
Skud_13.225              TTTVLKREIMYI--PEENGE-------VDSIDGPQCTNYNLH-KSH-----GDHVLDSCV
Smik_13.248              TTTVLKREMLFI--PEGDSN------SQDNIEIPTCVNYRLH-KSR-----GNHILDSCV
TDEL0A03060              ----LTRKLLAI--DTEE----------YPVETDQCISYVHS-PRE-----AEKLLWQLL
ZYRO0B01980g             ----FKREI--------------------------CISNSN-----------DKILEKQL
Kpol_1018.34             KKV-LHRQLIAI--DSKN---------NQIDVRNNVLSYYKD-NVK-----CDVVLNKLL
CAGL0K02981g             VQ--LQRKVLVI--DGDDY-------CLANKALTNEVVLRSKHIKE-----SKNILSSLL
TPHA0C04180              ----LVKKIIVVDSETEDIK------NSAELYNGRYLTYSQN-KEE-----CEIEFSKIL
KAFR0A01850              ----LKRKILYI--ASED---------EENKESDSVINEQDD-LTKFTEGIGSKLLDSFL
NDAI0I02270              ----WRRRIHHK--PSHDEV------SIPIEHSSEVYNLSSD-PQQ-----RSDVLNKFL
NCAS0D02640              ----LKRKILII--EPDN--------CTSGKNSQDVVYMKCS-TDQ-----GDKMLDQFL
SAKL0A09460g             ----ATRKVLVIDEPSSGIA-----------PSGQVCTWSGD-RQS-----SNSLLIQFL
KLTH0D06820g             ----LTRAVYGI--PSDATQHEERREPRAAGPKPEPGPTPAS-ECDSVPRPPADLLDQLL
Kwal_26.8016             ----IQRAVYGV--------------PMDTVRSRAEIPDPC-------------LLEQLL
                                                                                     

KLLA0E18569g             AIIKQNLSTFYELHGSSIYNYTDDDKGKGNEKWIRFKWDEMLDKDLVYIVLFKRDTT---
Agos_YGOB_Anc_2.532      ALVAAGLAPLYRAHARLLYPRLRDPA-----AWPRCKRAELLDPAALHILYR--DPAG--
Ecym_7256                AIIERTLGCFYDVHAHLLYPRLTRSR-----PWQAHKRAELQGLGTCHVLYRKENPGG--
TBLA0G02220              QLIDENLGKLYKKKSKKIY---ENDL-----DWSINKREEMFTSNMIYITYWDCKQN---
KNAG0C05820              EILDNNLGPVYARLSRKIY---GNSK-----HWRENKWLEMLSAQLVYVSYWVSDS----
Suva_13.244              QLVDEHLGAKYRRASRTMY---GNRL-----PWKANKLAEMKSAGLVYVCYWGNDAQGER
YMR069W                  QLIDKHLGAKYRRASRIMY---GNRK-----PWKANKLAEMKSAGLVYVCYWDNG-----
Skud_13.225              QLVDEHLGDKYRRASRTMY---GNRI-----PWKANKLAEMKSAGLLYVSYWGNG-----
Smik_13.248              QLIDEHLGAKYRRASRTMY---GNRK-----PWKANKLAEMKSPNLVYVSYWDNG-----
TDEL0A03060              EILDENLGQKYAGSSRALY---HNTR-----PWRVNKWREMLTPGLVYVIYSTAATTTAT
ZYRO0B01980g             QLIEINLGSYYNKYNKTIY---KNNK-----RWQSNKWQEMCSENLFHVSYWNVESN---
Kpol_1018.34             DILDNNLGPIYLEKSSKIY---CNEK-----PWKENKIVEMKSEGLLYVIYNDDITK---
CAGL0K02981g             ELLDQNLGQKYEISSKEMY---GNKK-----PWKENKIEEMNTEGMIYVSYWTKVDDEHT
TPHA0C04180              TILDNNLGDIYTIKNKKLY---GNSK-----PWKENKIQEMKTEGLIYVVYHLEDEKK--
KAFR0A01850              EILDNNLGNKYEKISREIY---DNND-----SWKKNKLVEMKSPGLIYVSYWKEEAEKK-
NDAI0I02270              NILDVNLGAKYTKVSKTIY---ENDK-----SWKSNKLEEMLSPGLIYVSYWDEKYQ---
NCAS0D02640              DILDVNLGEKYTKVSKKIY---ENAR-----PWKVNKLEEMRSPGLVYVSYWDEESD---
SAKL0A09460g             KVLDLNLGSKYRSVSATLY---GNTR-----SWTENKLEEMQTIGLVYVGYFQGV-----
KLTH0D06820g             SLVTANLGPMYTRHARAIY---GAGRQ----SWPARKRAEMETPGLVYVVYSDSHS----
Kwal_26.8016             ALVDSNLGPVYAQHAKALY---GDQCG----SWKERKRQEMVTPGLVYVVYRAVDEETGK
                          ::   *.  *      :*             *   *  *:      ::           

KLLA0E18569g             -------KIVGFTSVALSDPLNPELD-----------------------------HSKLN
Agos_YGOB_Anc_2.532      -------RLACFISLLL---------------------------------------PGPA
Ecym_7256                -------AIAGFVSLLFCD--EPHWPAGNGSRAAASTAERERGPSGRSAEPAFEETPPPP
TBLA0G02220              -------SVALFLSILSCE--ETYIL------------------------------ENND
KNAG0C05820              -------EPVLYTSFMLTE--ENGIS-----------------------------SIEST
Suva_13.244              -------ALGAFASFMLTE--ETGLV-------------------------EGDTAHEQS
YMR069W                  -------VLGAFTSFMLTE--ETGLV-------------------------EGDALHEVS
Skud_13.225              -------ALGAFASFMLTE--ETGLV-------------------------EGDAAHEVS
Smik_13.248              -------ALAAFASFMLTE--ETGLV-------------------------EGDAAHEVS
TDEL0A03060              QRRNAPFSPLLFLSFMLTE--EDGLV--------------------------ADDPTEVW
ZYRO0B01980g             -------ELVCFCSIMPCE--ESIVE------------------------------GEMS
Kpol_1018.34             -------EPLLFMSFMITD--DPSLV--------------------VPTDNDSNELSNST
CAGL0K02981g             -------VPLLFLSFMLTE--EENLT-----------------------------HNDPV
TPHA0C04180              -------TVSLYLSFTLTK--ESGFL----------------------------PDIDVF
KAFR0A01850              -------TCALFLSFMLTE--EDFVV------------------------------DDIR
NDAI0I02270              -------EPLLFLSFMLTE--GDGFI-------------------GTHSNDDDENEHNDQ
NCAS0D02640              -------EPMLFLSFMLTE--EDGFT------------------------------EDDK
SAKL0A09460g             -------SPLMFLSFLLTD--EPDFL------------------------------PDPV
KLTH0D06820g             -------QPLVFMSLLLTD--EPELG------------------------------QELA
Kwal_26.8016             EG-----LPLAFLSLLLTD--EPELG------------------------------PAPA
                                    : *.                                             

KLLA0E18569g             RP-CLFLYEIHLMGEYQSRGLGSLIFNGLLIPLARDL------------TCPSIELCVFT
Agos_YGOB_Anc_2.532      DP-VLYILELHVAAPFRRRGLAAALLDAATRTARAA-------------GLTRLELTVFT
Ecym_7256                PCKVVYVMEIHVSPSFQNQGLGSCMLL-CARQLVQHMQPSFP-------QLKGLELTVFT
TBLA0G02220              QGEVLYLYEIHITKEYQRQGIGERLIKDYLIEKLIKPLKIERQDN----NFIGLELTVFS
KNAG0C05820              DR-VVYLYEIQLIEAIRRQKLGQAIVS-YLTECALESP-----------EVAAVALTVFS
Suva_13.244              VP-VIYLYEVH--XXHRGRGLGRRLLAKALCEGVAARVRRTCD------DLFGVALTVFG
YMR069W                  VP-VIYLYEVHVASAHRGHGIGRRLLEHALCDGVARHTRRMCD------NFFGVALTVFS
Skud_13.225              VP-VIYLYEIHVAHAHRGHGLGRRLLERALCEGVARRVRRVRC------DFFGVALTVFG
Smik_13.248              VP-VIYLYEVHVACVHRGHGIGRRLLERALCEGVARHVRCLYE------EFFGVALTVFS
TDEL0A03060              T--VLYLYELQLLPRVRRLGLAARLLGDHLAQCGRQLCTRSRAGRFSKTRFFGLELTVFA
ZYRO0B01980g             N--IIYLYEIHVAPEWRNQKFGKSILNALKEKLCPKA------------HLSGIELTVFS
Kpol_1018.34             AA-VIYLYEIQLLELIRNQKLGTILITNYLKKTIEILNKDYQK------NIIALELTVFS
CAGL0K02981g             SS-VIFLYEIQISKELRKQGLGQYFLSNCLFQCAKRLLDNDSLNLEF--PFAGIELTVFA
TPHA0C04180              SP-VIYLYEIQLTPEVRNNGLGTKLIAGYLKDCLVDVHENIHK------DIIGIELTVFS
KAFR0A01850              KFSVIYLYEIQLIEKYRGCQLGTRLIKGLSNVCQIAQVKIRPAF-----PLIGIQLTVFS
NDAI0I02270              LMSVIYLYEIQILPQLRGQGIGTKLLSVHLHQCCSSLVTKYGKDFLPY-PLVGIELTVFS
NCAS0D02640              LLSVVYLYEIQILPSLRNRKLGTRLLAEHLQDACSRLRSENGELLEY--PLIGIELTVFS
SAKL0A09460g             K--VVYLYEIQLLPEVQGQRLGTQMLQVYLKNTVHSLSRLDP-------LLKGIELTVFS
KLTH0D06820g             AR-VLYLFEIHVSDIIRGQGLGTHLLRDCLGGTLASLSRASP-------SVLGAELTVFS
Kwal_26.8016             A--VVYLMEIHVADIIRGLGLGGTLLREGVAGTVRGARRAHP-------FIQGTELTVFT
                             ::: *::     .   :.  :.                             * ** 

KLLA0E18569g             ANDVACRWY-KRLGFQLTVEFSEHLIGM--------------------------------
Agos_YGOB_Anc_2.532      ANRPALALY-ARAGFR-----PRRALH---------------------------------
Ecym_7256                GNRQALALY-RRQGFKTATNT---------------------------------------
TBLA0G02220              ENNDAQNFYFNKIQMQYTFGSPRDEIINVMKRITRSFDEKLGEHCEDNKLPSLNDKKKQL
KNAG0C05820              DNEKALKFY-ERLNFTYTIDSPRDEVTEKPRR---RTAARTALDPARDSDV---------
Suva_13.244              DNTRARRLY-ESXXXXXXXXXXXXXXXXXXXXXXXGRA----------------------
YMR069W                  DNTRARRLY-EALGFYRAPGSPAPASPTIRHTRHGGGR----------------------
Skud_13.225              DNTRARRLY-EAIGFCRAPGSPAPAAPALRPTRHGRKR----------------------
Smik_13.248              DNTRARRLY-EALGFYRAPGSPAAGAPTTRPTRHGGER----------------------
TDEL0A03060              DNAPAIRLY-ESLGMQLAADSP--------------------------------------
ZYRO0B01980g             SNERAINFY-RNNGFTLSYDSPSDK-----RR---RTRT---------------------
Kpol_1018.34             NNINAINFY-KKIGMLYTPDSPRDKIILPQKR---RTRSTTIALESKNNEPSSRLTTSKP
CAGL0K02981g             DNLPAINLY-QKLGMTHTPESPKDVLYDQNTR--RRTRNSRKINNKN--ESP--------
TPHA0C04180              DNTNAIRFY-ETIGMKLTPDSPNDKTINYGHRIKTRSQNSSKKGSSSDKPTS--------
KAFR0A01850              DNKRAIKFY-ERIGMKFTYGSPKDEVDKIESR---KTRTSVN-------RKT--------
NDAI0I02270              DNIKAINFY-KSIGMKLTPDSPTDEVYQIEKR---QTRNLRRINNAGTREVT--------
NCAS0D02640              DNENAIKFY-KSIGMELTPDSPRDRVAHLERR---RTRGMAQ--NIST-SVG--------
SAKL0A09460g             DNDAALHLY-YSIGMALAPGSPTDEIATSQRR----TRHS---------TTD--------
KLTH0D06820g             ENQRALRLY-LALGMHVAAWSPQDRRAQVRRR----TRAI---------AYD--------
Kwal_26.8016             DNEGALRLY-LRLGMQIAAWSPQDTCIEVHRR----TRAT---------RYE--------
                          *  *   *                                                   

KLLA0E18569g             -SRVIGAS----------------------
Agos_YGOB_Anc_2.532      -------PDLTIMVCRL-------------
Ecym_7256                -EFFLSNSELTVMYCSI-------------
TBLA0G02220              YRKSIRKPEYYILVFPV-------------
KNAG0C05820              -KVTIKKPTYYLLYLEVVNHV---------
Suva_13.244              -AAVARDPLYYVYCLRLA------------
YMR069W                  -VVVPCDPLYYVYCLHMP------------
Skud_13.225              -VVVARDPLYYVYCLHMP------------
Smik_13.248              -VVVPRDPLYYVYCLHMP------------
TDEL0A03060              -TVLDTDSLYRLYVLQL-------------
ZYRO0B01980g             -GIRIIRPTYYIMCYVLR------------
Kpol_1018.34             IKKIIKKPDYYLLFLPIPESNKIQLNCQCK
CAGL0K02981g             -RILIKKPLYYMYWKPIL------------
TPHA0C04180              -LSVVKKPDYYLYYLPL-------------
KAFR0A01850              -LKVVRKPIYYLLYLPV-------------
NDAI0I02270              -KQIIKKPVYYLYYLPIDL-----------
NCAS0D02640              -RTIVQKPIYYLFYLPLSI-----------
SAKL0A09460g             -LQTVSRPDYYLMFLPV-------------
KLTH0D06820g             -SSLVTRPAYYILFWPAAS-----------
Kwal_26.8016             -SRKVTRPTYYLLFWPHEA-----------
                                .                      

FASTA FORMAT for MUSCLE Version 3.6

>KLLA0E18569g
----------------------------MSNYHSRNLRRVAGVLCQELNSTGDSD-----
----VVCEVFSN---------------RVHSGDPNYLGSTL---------------PKCL
AIIKQNLSTFYELHGSSIYNYTDDDKGKGNEKWIRFKWDEMLDKDLVYIVLFKRDTT---
-------KIVGFTSVALSDPLNPELD-----------------------------HSKLN
RP-CLFLYEIHLMGEYQSRGLGSLIFNGLLIPLARDL------------TCPSIELCVFT
ANDVACRWY-KRLGFQLTVEFSEHLIGM--------------------------------
-SRVIGAS----------------------
>Agos_YGOB_Anc_2.532
-----------------------------MHAHAAAHAAALAAFPPTLHG----------
----LARA----------------------PAAPARLPAAA----------RRRLAADLT
ALVAAGLAPLYRAHARLLYPRLRDPA-----AWPRCKRAELLDPAALHILYR--DPAG--
-------RLACFISLLL---------------------------------------PGPA
DP-VLYILELHVAAPFRRRGLAAALLDAATRTARAA-------------GLTRLELTVFT
ANRPALALY-ARAGFR-----PRRALH---------------------------------
-------PDLTIMVCRL-------------
>Ecym_7256
----------------------------MEYPAEILALYINDAFPEQLACRNGCT-----
----LSRDIII----------------------TDRLSVAA----------RQKFAKQLT
AIIERTLGCFYDVHAHLLYPRLTRSR-----PWQAHKRAELQGLGTCHVLYRKENPGG--
-------AIAGFVSLLFCD--EPHWPAGNGSRAAASTAERERGPSGRSAEPAFEETPPPP
PCKVVYVMEIHVSPSFQNQGLGSCMLL-CARQLVQHMQPSFP-------QLKGLELTVFT
GNRQALALY-RRQGFKTATNT---------------------------------------
-EFFLSNSELTVMYCSI-------------
>TBLA0G02220
------------------------------MDVRRLVQLVDNAFPKSISTKQGIT-----
----LERKIYII----GDSENNSLLSDQNNNSNDDEIYWYF--KDRKNPTVENIIKTQIF
QLIDENLGKLYKKKSKKIY---ENDL-----DWSINKREEMFTSNMIYITYWDCKQN---
-------SVALFLSILSCE--ETYIL------------------------------ENND
QGEVLYLYEIHITKEYQRQGIGERLIKDYLIEKLIKPLKIERQDN----NFIGLELTVFS
ENNDAQNFYFNKIQMQYTFGSPRDEIINVMKRITRSFDEKLGEHCEDNKLPSLNDKKKQL
YRKSIRKPEYYILVFPV-------------
>KNAG0C05820
---------------------------MDENDLTLFLQTVDRQFPTVIGCDLNGTAVS--
----LKRRIHYIEGVGDDDDESHNKIMSYPGGLPPLPPTTDDNPTAKEDNTCERCLRIFL
EILDNNLGPVYARLSRKIY---GNSK-----HWRENKWLEMLSAQLVYVSYWVSDS----
-------EPVLYTSFMLTE--ENGIS-----------------------------SIEST
DR-VVYLYEIQLIEAIRRQKLGQAIVS-YLTECALESP-----------EVAAVALTVFS
DNEKALKFY-ERLNFTYTIDSPRDEVTEKPRR---RTAARTALDPARDSDV---------
-KVTIKKPTYYLLYLEVVNHV---------
>Suva_13.244
-------------------------------MFQQFLSICMEEFPQTLDYTGSDDENGDS
TTTLLRRQMMYM--PEDDGD-------DGGIDTPECMNYKLH-KAD-----GDQTLHSCV
QLVDEHLGAKYRRASRTMY---GNRL-----PWKANKLAEMKSAGLVYVCYWGNDAQGER
-------ALGAFASFMLTE--ETGLV-------------------------EGDTAHEQS
VP-VIYLYEVH--XXHRGRGLGRRLLAKALCEGVAARVRRTCD------DLFGVALTVFG
DNTRARRLY-ESXXXXXXXXXXXXXXXXXXXXXXXGRA----------------------
-AAVARDPLYYVYCLRLA------------
>YMR069W
MRSSVYSENTYNCIRTSKEHLTERRRVAMAPMFQHFLNLCVEKFPESIEHKDTDGNGNFT
TAI-LEREIIYI--PEDDTD------SIDSVDSLKCINYKLH-KSR-----GDQVLDACV
QLIDKHLGAKYRRASRIMY---GNRK-----PWKANKLAEMKSAGLVYVCYWDNG-----
-------VLGAFTSFMLTE--ETGLV-------------------------EGDALHEVS
VP-VIYLYEVHVASAHRGHGIGRRLLEHALCDGVARHTRRMCD------NFFGVALTVFS
DNTRARRLY-EALGFYRAPGSPAPASPTIRHTRHGGGR----------------------
-VVVPCDPLYYVYCLHMP------------
>Skud_13.225
-------------------------------MFKKFLSICIDEFPETLEYTESNENATVV
TTTVLKREIMYI--PEENGE-------VDSIDGPQCTNYNLH-KSH-----GDHVLDSCV
QLVDEHLGDKYRRASRTMY---GNRI-----PWKANKLAEMKSAGLLYVSYWGNG-----
-------ALGAFASFMLTE--ETGLV-------------------------EGDAAHEVS
VP-VIYLYEIHVAHAHRGHGLGRRLLERALCEGVARRVRRVRC------DFFGVALTVFG
DNTRARRLY-EAIGFCRAPGSPAPAAPALRPTRHGRKR----------------------
-VVVARDPLYYVYCLHMP------------
>Smik_13.248
-------------------------------MFHQFLKICMQDFPETLEYTNTDGNNGTA
TTTVLKREMLFI--PEGDSN------SQDNIEIPTCVNYRLH-KSR-----GNHILDSCV
QLIDEHLGAKYRRASRTMY---GNRK-----PWKANKLAEMKSPNLVYVSYWDNG-----
-------ALAAFASFMLTE--ETGLV-------------------------EGDAAHEVS
VP-VIYLYEVHVACVHRGHGIGRRLLERALCEGVARHVRCLYE------EFFGVALTVFS
DNTRARRLY-EALGFYRAPGSPAAGAPTTRPTRHGGER----------------------
-VVVPRDPLYYVYCLHMP------------
>TDEL0A03060
---------------------------MEQESLNDVVKYANQNFPTTINAAGIQ------
----LTRKLLAI--DTEE----------YPVETDQCISYVHS-PRE-----AEKLLWQLL
EILDENLGQKYAGSSRALY---HNTR-----PWRVNKWREMLTPGLVYVIYSTAATTTAT
QRRNAPFSPLLFLSFMLTE--EDGLV--------------------------ADDPTEVW
T--VLYLYELQLLPRVRRLGLAARLLGDHLAQCGRQLCTRSRAGRFSKTRFFGLELTVFA
DNAPAIRLY-ESLGMQLAADSP--------------------------------------
-TVLDTDSLYRLYVLQL-------------
>ZYRO0B01980g
----------------------------------------MPNWPG--------------
----FKREI--------------------------CISNSN-----------DKILEKQL
QLIEINLGSYYNKYNKTIY---KNNK-----RWQSNKWQEMCSENLFHVSYWNVESN---
-------ELVCFCSIMPCE--ESIVE------------------------------GEMS
N--IIYLYEIHVAPEWRNQKFGKSILNALKEKLCPKA------------HLSGIELTVFS
SNERAINFY-RNNGFTLSYDSPSDK-----RR---RTRT---------------------
-GIRIIRPTYYIMCYVLR------------
>Kpol_1018.34
-----------------------------MSELLHLVDVAENIFPETLELLNDNSSTSNQ
KKV-LHRQLIAI--DSKN---------NQIDVRNNVLSYYKD-NVK-----CDVVLNKLL
DILDNNLGPIYLEKSSKIY---CNEK-----PWKENKIVEMKSEGLLYVIYNDDITK---
-------EPLLFMSFMITD--DPSLV--------------------VPTDNDSNELSNST
AA-VIYLYEIQLLELIRNQKLGTILITNYLKKTIEILNKDYQK------NIIALELTVFS
NNINAINFY-KKIGMLYTPDSPRDKIILPQKR---RTRSTTIALESKNNEPSSRLTTSKP
IKKIIKKPDYYLLFLPIPESNKIQLNCQCK
>CAGL0K02981g
---------------------MTNNELYGTNVNDSFLHHVLDCFPKVITTKSNLPKDIED
VQ--LQRKVLVI--DGDDY-------CLANKALTNEVVLRSKHIKE-----SKNILSSLL
ELLDQNLGQKYEISSKEMY---GNKK-----PWKENKIEEMNTEGMIYVSYWTKVDDEHT
-------VPLLFLSFMLTE--EENLT-----------------------------HNDPV
SS-VIFLYEIQISKELRKQGLGQYFLSNCLFQCAKRLLDNDSLNLEF--PFAGIELTVFA
DNLPAINLY-QKLGMTHTPESPKDVLYDQNTR--RRTRNSRKINNKN--ESP--------
-RILIKKPLYYMYWKPIL------------
>TPHA0C04180
-----------------------------MDDIVKFVKIVDSHYPDEIYVNKNLTK----
----LVKKIIVVDSETEDIK------NSAELYNGRYLTYSQN-KEE-----CEIEFSKIL
TILDNNLGDIYTIKNKKLY---GNSK-----PWKENKIQEMKTEGLIYVVYHLEDEKK--
-------TVSLYLSFTLTK--ESGFL----------------------------PDIDVF
SP-VIYLYEIQLTPEVRNNGLGTKLIAGYLKDCLVDVHENIHK------DIIGIELTVFS
DNTNAIRFY-ETIGMKLTPDSPNDKTINYGHRIKTRSQNSSKKGSSSDKPTS--------
-LSVVKKPDYYLYYLPL-------------
>KAFR0A01850
--------------------------MENIEIFNGFLKIVSDEFPKELRTKGQN------
----LKRKILYI--ASED---------EENKESDSVINEQDD-LTKFTEGIGSKLLDSFL
EILDNNLGNKYEKISREIY---DNND-----SWKKNKLVEMKSPGLIYVSYWKEEAEKK-
-------TCALFLSFMLTE--EDFVV------------------------------DDIR
KFSVIYLYEIQLIEKYRGCQLGTRLIKGLSNVCQIAQVKIRPAF-----PLIGIQLTVFS
DNKRAIKFY-ERIGMKFTYGSPKDEVDKIESR---KTRTSVN-------RKT--------
-LKVVRKPIYYLLYLPV-------------
>NDAI0I02270
---------------------------MHTSTSDALLNIVCEEFPTILQSADGVTT----
----WRRRIHHK--PSHDEV------SIPIEHSSEVYNLSSD-PQQ-----RSDVLNKFL
NILDVNLGAKYTKVSKTIY---ENDK-----SWKSNKLEEMLSPGLIYVSYWDEKYQ---
-------EPLLFLSFMLTE--GDGFI-------------------GTHSNDDDENEHNDQ
LMSVIYLYEIQILPQLRGQGIGTKLLSVHLHQCCSSLVTKYGKDFLPY-PLVGIELTVFS
DNIKAINFY-KSIGMKLTPDSPTDEVYQIEKR---QTRNLRRINNAGTREVT--------
-KQIIKKPVYYLYYLPIDL-----------
>NCAS0D02640
-----------------------------MHAFEAFSHMILEEFPLTLEVTLQEQLKC--
----LKRKILII--EPDN--------CTSGKNSQDVVYMKCS-TDQ-----GDKMLDQFL
DILDVNLGEKYTKVSKKIY---ENAR-----PWKVNKLEEMRSPGLVYVSYWDEESD---
-------EPMLFLSFMLTE--EDGFT------------------------------EDDK
LLSVVYLYEIQILPSLRNRKLGTRLLAEHLQDACSRLRSENGELLEY--PLIGIELTVFS
DNENAIKFY-KSIGMELTPDSPRDRVAHLERR---RTRGMAQ--NIST-SVG--------
-RTIVQKPIYYLFYLPLSI-----------
>SAKL0A09460g
---------------------------MVDYPANVLLPYVLDSFPTSITLKDGSL-----
----ATRKVLVIDEPSSGIA-----------PSGQVCTWSGD-RQS-----SNSLLIQFL
KVLDLNLGSKYRSVSATLY---GNTR-----SWTENKLEEMQTIGLVYVGYFQGV-----
-------SPLMFLSFLLTD--EPDFL------------------------------PDPV
K--VVYLYEIQLLPEVQGQRLGTQMLQVYLKNTVHSLSRLDP-------LLKGIELTVFS
DNDAALHLY-YSIGMALAPGSPTDEIATSQRR----TRHS---------TTD--------
-LQTVSRPDYYLMFLPV-------------
>KLTH0D06820g
---------------------------MVDYPASELFPHVTQCFPLVLTLPNGQQQ----
----LTRAVYGI--PSDATQHEERREPRAAGPKPEPGPTPAS-ECDSVPRPPADLLDQLL
SLVTANLGPMYTRHARAIY---GAGRQ----SWPARKRAEMETPGLVYVVYSDSHS----
-------QPLVFMSLLLTD--EPELG------------------------------QELA
AR-VLYLFEIHVSDIIRGQGLGTHLLRDCLGGTLASLSRASP-------SVLGAELTVFS
ENQRALRLY-LALGMHVAAWSPQDRRAQVRRR----TRAI---------AYD--------
-SSLVTRPAYYILFWPAAS-----------
>Kwal_26.8016
---------------------------MADYPADYLVPHVTDSFPTTLTLASGQR-----
----IQRAVYGV--------------PMDTVRSRAEIPDPC-------------LLEQLL
ALVDSNLGPVYAQHAKALY---GDQCG----SWKERKRQEMVTPGLVYVVYRAVDEETGK
EG-----LPLAFLSLLLTD--EPELG------------------------------PAPA
A--VVYLMEIHVADIIRGLGLGGTLLREGVAGTVRGARRAHP-------FIQGTELTVFT
DNEGALRLY-LRLGMQIAAWSPQDTCIEVHRR----TRAT---------RYE--------
-SRKVTRPTYYLLFWPHEA-----------