MUSCLE (3.8) multiple sequence alignment

TPHA0J00360        MSSRKKNLLKVIVLGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVIDDGSQAAT
TBLA0A07180        MSTRKKQILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVAI-DNDTTAT
KAFR0G02670        MSSKKKTILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEINV-DGDRTAT
CAGL0E02607g       MIARKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVL-DDDKVVT
KLLA0D01265g       -MSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIV-NDDKVAT
Smik_13.158        MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTV-DGDKVAT
Suva_13.161        MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTV-DGDKVAT
Skud_13.153        MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTV-DGDKVAT
YML001W            MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTV-DGDKVAT
Kpol_1037.28       MSSRKKNILKVIVLGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTV-DDDKAAT
KNAG0M01220        MSFRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTV--DDKVAT
ZYRO0C07700g       MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTV--DDKVAT
TDEL0G04450        MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVL-DDDKVAT
ACR003C            MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTV-DGDKVAT
Ecym_3028          MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTV-DGDKVAT
SAKL0E01386g       MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTV-DEDKVAT
KLTH0C11132g       MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKFSQQYKATIGADFLTKEVTM-DGDKVAT
Kwal_56.22440      MSARKKNILKVIILGDSGVGKTSLMHRYVSDKFSQQYKATIGADFLTKEVSM-DGDKVAT
NDAI0D00840        MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTI-DDDKIAT
NCAS0H00850        MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTI-DDDKVAT
                      .** :****:****************.**:****************: :   .  .*

TPHA0J00360        MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNPKSFDNIKSWRDEFLIHANVSSPETF
TBLA0A07180        MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNPKSFENIKSWRDEFLIHANVSSPETF
KAFR0G02670        MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNTKSFENIKSWRDEFLVHANVSSPESF
CAGL0E02607g       MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESF
KLLA0D01265g       MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETF
Smik_13.158        MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVSSPETF
Suva_13.161        MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPETF
Skud_13.153        MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPETF
YML001W            MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPETF
Kpol_1037.28       MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNSKSFENIKSWRDEFLIHANVSSPETF
KNAG0M01220        MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETF
ZYRO0C07700g       MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVLSPETF
TDEL0G04450        MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNVKSFENIKSWRDEFLVHANVSSPETF
ACR003C            MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENVKSWRDEFLVHANVPSPESF
Ecym_3028          MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNSKSFENIKAWRDEFLVHANVPSPETF
SAKL0E01386g       MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPESF
KLTH0C11132g       MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETF
Kwal_56.22440      MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETF
NDAI0D00840        MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLIHANISTPETF
NCAS0H00850        MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETF
                   ********************************** .**:*:*:*.****:***: :**:*

TPHA0J00360        PFVILGNKIDIEDSKQKISAKQGQEMAKELGNIPLFLTSAKDSINVDVAFEEITRGALQQ
TBLA0A07180        PFVILGNKVDTKDSKKSVTLKAAQELSKSLGNIPLFQTSAKNSINVDSAFEEIARGALEQ
KAFR0G02670        PFVILGNKIDIEETKKVISVKSAQDLAKSLGNIPLFLTSAKSSINVDPAFEEIARSALQQ
CAGL0E02607g       PFVILGNKVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQ
KLLA0D01265g       PFVILANKVDVEESKKVVSSRSAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQ
Smik_13.158        PFVILGNKIDAEESKKVVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAFEEIARSALQQ
Suva_13.161        PFVILGNKIDAEESKKVVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAFEEIARSALQQ
Skud_13.153        PFVILGNKIDAEESKKVVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAFEEIARSALQQ
YML001W            PFVILGNKIDAEESKKIVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAFEEIARSALQQ
Kpol_1037.28       PFVILGNKIDVEDSKKIVTQKSAQELAKELGDVPLFLTSAKNAINVDQAFEEIARSALQQ
KNAG0M01220        PFVILGNKVDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQQ
ZYRO0C07700g       PFVILGNKVDVEESKKTVSVKSAQELAKSLGNVPLFLTSAKNAINVDTAFEEIARSALQQ
TDEL0G04450        PFVILGNKIDVEESKKVVNTKSAQDLAKSLGNVPLFFTSAKNAINVDTAFEEIGRSALQQ
ACR003C            PFVILGNKIDVEESKKVVTTRTSQELAKSLGNIPFFLTSAKNAINVDDAFEEIARSALQQ
Ecym_3028          PFVILGNKIDVEESKKVVTTRSSQELAKSLGNIPFFLTSAKNAINVDDAFEEIARSALQQ
SAKL0E01386g       PFVILGNKIDVEESKKVVNTRSAQELAKSLGNVPLFLTSAKGSINVETAFEEIARSALQQ
KLTH0C11132g       PFVILGNKLDVEESKKVVSNRSAQDMAKSLGNIPLFLTSAKGSINVDTAFEEIARNALQQ
Kwal_56.22440      PFVILGNKLDVEESKKVVSNRSAQDMAKSLGNIPLFLTSAKGSINVDTAFEEIARNALQQ
NDAI0D00840        PFVILGNKIDVEESKKIVSSNSATELAKSLGDIPLFFTSAKDSINIENAFEEIARSALQQ
NCAS0H00850        PFVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQQ
                   *****.**:* .::*: :. . . : :..**: *:* ****.:**:: ***** ..**:*

TPHA0J00360        NQNDADAFKDDFNDAINIQLDDESSSCAC
TBLA0A07180        NKADADAYEDDFNDAINIQLDGEPSSCAC
KAFR0G02670        NQNDADAFEEDFNDAINIQLDGEADSCAC
CAGL0E02607g       NQNDAHAFEDDFNDAINIQLEGESNSCSC
KLLA0D01265g       SQSDADAYEDDLSEAINIQLDGEPSSCNC
Smik_13.158        NQADTEAFEDDYNDAINIRLDGENNSCSC
Suva_13.161        NQADTEAFEDDYNDAINIRLDGENNSCSC
Skud_13.153        NQADTEAFEDDYNDAINIRLDGENNSCSC
YML001W            NQADTEAFEDDYNDAINIRLDGENNSCSC
Kpol_1037.28       NQADADAFEDDFNDAINIQLDGEPSSCSC
KNAG0M01220        NQNDADAFEEDFNDAINIQLDGEPNSCSC
ZYRO0C07700g       NQADADAFEEDFNDAINIQLDGEPSACSC
TDEL0G04450        NQADADAFEEDFNDAINIQLDGEPSSCSC
ACR003C            SQADAGAYEDDFNDAINIQLDGEPSSCNC
Ecym_3028          SQADADAYEDDFNDAINIQLDGEPSSCSC
SAKL0E01386g       SQADADAFEDDFNDAINIQLDGEPSSCNC
KLTH0C11132g       SQADADAFEDDFNDAINIQLDGEPSSCSC
Kwal_56.22440      SQADADAFEDDFNDAINIQLDGEPSSCSC
NDAI0D00840        NQNDVDAFDEDFNDAINIRLDGEPNSCSC
NCAS0H00850        NQSDADAFDDDFNDAINIQLDDEPNSCSC
                   .: *. *:.:* .:****.*:.* .:* *

FASTA FORMAT for MUSCLE Version 3.6

>TPHA0J00360
MSSRKKNLLKVIVLGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVIDDGSQAAT
MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNPKSFDNIKSWRDEFLIHANVSSPETF
PFVILGNKIDIEDSKQKISAKQGQEMAKELGNIPLFLTSAKDSINVDVAFEEITRGALQQ
NQNDADAFKDDFNDAINIQLDDESSSCAC
>TBLA0A07180
MSTRKKQILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVAI-DNDTTAT
MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNPKSFENIKSWRDEFLIHANVSSPETF
PFVILGNKVDTKDSKKSVTLKAAQELSKSLGNIPLFQTSAKNSINVDSAFEEIARGALEQ
NKADADAYEDDFNDAINIQLDGEPSSCAC
>KAFR0G02670
MSSKKKTILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEINV-DGDRTAT
MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNTKSFENIKSWRDEFLVHANVSSPESF
PFVILGNKIDIEETKKVISVKSAQDLAKSLGNIPLFLTSAKSSINVDPAFEEIARSALQQ
NQNDADAFEEDFNDAINIQLDGEADSCAC
>CAGL0E02607g
MIARKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVL-DDDKVVT
MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESF
PFVILGNKVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQ
NQNDAHAFEDDFNDAINIQLEGESNSCSC
>KLLA0D01265g
-MSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIV-NDDKVAT
MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETF
PFVILANKVDVEESKKVVSSRSAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQ
SQSDADAYEDDLSEAINIQLDGEPSSCNC
>Smik_13.158
MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTV-DGDKVAT
MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVSSPETF
PFVILGNKIDAEESKKVVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAFEEIARSALQQ
NQADTEAFEDDYNDAINIRLDGENNSCSC
>Suva_13.161
MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTV-DGDKVAT
MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPETF
PFVILGNKIDAEESKKVVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAFEEIARSALQQ
NQADTEAFEDDYNDAINIRLDGENNSCSC
>Skud_13.153
MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTV-DGDKVAT
MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPETF
PFVILGNKIDAEESKKVVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAFEEIARSALQQ
NQADTEAFEDDYNDAINIRLDGENNSCSC
>YML001W
MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTV-DGDKVAT
MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPETF
PFVILGNKIDAEESKKIVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAFEEIARSALQQ
NQADTEAFEDDYNDAINIRLDGENNSCSC
>Kpol_1037.28
MSSRKKNILKVIVLGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTV-DDDKAAT
MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNSKSFENIKSWRDEFLIHANVSSPETF
PFVILGNKIDVEDSKKIVTQKSAQELAKELGDVPLFLTSAKNAINVDQAFEEIARSALQQ
NQADADAFEDDFNDAINIQLDGEPSSCSC
>KNAG0M01220
MSFRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTV--DDKVAT
MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETF
PFVILGNKVDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQQ
NQNDADAFEEDFNDAINIQLDGEPNSCSC
>ZYRO0C07700g
MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTV--DDKVAT
MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVLSPETF
PFVILGNKVDVEESKKTVSVKSAQELAKSLGNVPLFLTSAKNAINVDTAFEEIARSALQQ
NQADADAFEEDFNDAINIQLDGEPSACSC
>TDEL0G04450
MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVL-DDDKVAT
MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNVKSFENIKSWRDEFLVHANVSSPETF
PFVILGNKIDVEESKKVVNTKSAQDLAKSLGNVPLFFTSAKNAINVDTAFEEIGRSALQQ
NQADADAFEEDFNDAINIQLDGEPSSCSC
>ACR003C
MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTV-DGDKVAT
MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENVKSWRDEFLVHANVPSPESF
PFVILGNKIDVEESKKVVTTRTSQELAKSLGNIPFFLTSAKNAINVDDAFEEIARSALQQ
SQADAGAYEDDFNDAINIQLDGEPSSCNC
>Ecym_3028
MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTV-DGDKVAT
MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNSKSFENIKAWRDEFLVHANVPSPETF
PFVILGNKIDVEESKKVVTTRSSQELAKSLGNIPFFLTSAKNAINVDDAFEEIARSALQQ
SQADADAYEDDFNDAINIQLDGEPSSCSC
>SAKL0E01386g
MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTV-DEDKVAT
MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPESF
PFVILGNKIDVEESKKVVNTRSAQELAKSLGNVPLFLTSAKGSINVETAFEEIARSALQQ
SQADADAFEDDFNDAINIQLDGEPSSCNC
>KLTH0C11132g
MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKFSQQYKATIGADFLTKEVTM-DGDKVAT
MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETF
PFVILGNKLDVEESKKVVSNRSAQDMAKSLGNIPLFLTSAKGSINVDTAFEEIARNALQQ
SQADADAFEDDFNDAINIQLDGEPSSCSC
>Kwal_56.22440
MSARKKNILKVIILGDSGVGKTSLMHRYVSDKFSQQYKATIGADFLTKEVSM-DGDKVAT
MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETF
PFVILGNKLDVEESKKVVSNRSAQDMAKSLGNIPLFLTSAKGSINVDTAFEEIARNALQQ
SQADADAFEDDFNDAINIQLDGEPSSCSC
>NDAI0D00840
MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTI-DDDKIAT
MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLIHANISTPETF
PFVILGNKIDVEESKKIVSSNSATELAKSLGDIPLFFTSAKDSINIENAFEEIARSALQQ
NQNDVDAFDEDFNDAINIRLDGEPNSCSC
>NCAS0H00850
MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTI-DDDKVAT
MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETF
PFVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQQ
NQSDADAFDDDFNDAINIQLDDEPNSCSC