MUSCLE (3.8) multiple sequence alignment

TBLA0A07260              -------MDADI-LNPL--IEVLFHSEGTDTLNGPLKKLFEKL-KLLKFVLLAPPTDILL
KNAG0M01160              --------MPEL-LNPL--VDAVFNCQ--DVEASPLRKVYSSL-HDIPFILLVPPTFALW
TPHA0J00330              ----MAYFMPVL-KNPL--INAVFNCP--DPHASPFKKLYNEL-RDKDFLLLVPNDFILL
Kpol_1037.25             -MGELSYHMPVL-LNPL--INAVFNCP--DPINSPLRKLFERI-KYKNFMLIVPPNEILL
KAFR0L00400              ---MSQYESEIARYGPFQSIAAVFERL--DSEKVTTKESFIVL-----------------
KLLA0D01133g             ----MPYHLPVL-LNPL--LNAIFNCP--SPKTSSLKQMFSRL-DDERFFILVPSTETLL
CAGL0L07634g             MTTHSNFQLPPL-LNPL--LNAICNCG--EPNSSPLKKLYTQLGKKDKYLILVPPTELLL
NDAI0D00800              ---MSQYHLPTL-LNPL--LNAVFNCP--DPSHSPFKKLFTTL-KNQQFILLVPPTSTLL
NCAS0H00820              ---MEQYHLPTL-LNPL--LNSIFNCP--NPSNSPLKKLYASL-KDKSFILLVPPTETLL
KLTH0C11242g             ----MPYYLPVL-LNPL--INAVFNCP--TPQNSPLRKVFTRI-EKQRFALVTPTPEILL
Kwal_56.22424            ----MPYYLPVL-LNPL--INAVFNCP--TPLNSSLKKVFSAI-EKVRFVLIAPPTELLL
Smik_13.157              ---MSISHLPTL-LNPL--INAIFNCP--EPEKSPLKKLFATL-KTCRFILLAPPSEYLL
Suva_13.160              ---MSIYHLPTL-LNPL--INAIFNCP--EPEKSPLKKLFANL-QTRRFILLAPPSHLLL
Skud_13.152              ---MSVYHLPTL-LNPL--INAIFNCP--EPEKSPLKKLFANL-KTRRFILLAPPLRFLL
YML002W                  ----MDSHQLEL--------------P---------------------------------
ZYRO0C07810g             ----MAYHIPVL-LNPL--VNSVFNCS--NPSDSQFKKLFGKL-KTERFILLVPPTEKLL
TDEL0G04490              ----MPYHLPVL-LNPL--VNAVFNCP--NPSTSNLKKLFSNL-KDRKFILLVPPCDRLL
Sklu_YGOB_Anc_6.20b      ----MPYHLPIL-LNPL--VNSVFNCP--TPSTSPLKKIFASL-RDQRFILVVPNVNILL
ACR006C                  ----MPYHLPVL-LNPL--VNAVFNCP--APGASPLKKLFNNA-KDKKFILVVPRTEVLL
Ecym_3024                ----MPYHLPVL-LNPL--VNAVFNCP--TPTTSPLKKLFNNV-KGQRFILLVPSTDVLL
                                                                                     

TBLA0A07260              NYLDSSNITPRNPYNGSNAKPLEDLCMNSYDFIASHILLYDSKV--------IKND----
KNAG0M01160              YYDDR-----------NTKFPLHELCH-SPEFVSSHILTRYSGKDNKPIDTDLSRLRAVR
TPHA0J00330              YYKDS-----------TSNISFRELCY-TYDFVAAHILILDKNSSTDKISSSNQKNG---
Kpol_1037.25             HYRDP-----------EKGLTLKELCY-EFEFVASHIILDTDNSSNNLQVKGKNSNETLD
KAFR0L00400              -------------------ISLESMGY--------NIFIKEND-----------------
KLLA0D01133g             QFQDL-----------ESGLELAELCY-HYDFVASHIVVIKDPTKDVPDQRSIYN-----
CAGL0L07634g             YYSDK-----------ESNSELHDLCY-TPNFASAHILLLDATDTEVNNGDEAVLIKNIE
NDAI0D00800              NYTDS-----------YYKLSLNELCYHNSDFLGSHILTWSNAIDSNKDSTTTNDD----
NCAS0H00820              NYTDT-----------KTKIQLEDLCYHNVDFIGAHILLPPKDS--ISSSSSTIDDGYTR
KLTH0C11242g             EYEDL-----------ESGSSLQDLCY-SASFVSDHILLLGGGG--------CSHE----
Kwal_56.22424            EYEDL-----------ESGLPLQDLCY-ATGFVSDHIVLLDGRE--------GLQE----
Smik_13.157              NYHDV-----------KTKLPLHELCY-NAEFINSHILLMTENS----FINTNSRD----
Suva_13.160              NYHDV-----------KTKLPLHELCY-NADFINSHILLTTENS----YINTTLRD----
Skud_13.152              NYHDV-----------KTKLPLHELCY-NVDFINSHILLTTENS----YLNTTLRD----
YML002W                  ------------------------------------------------------------
ZYRO0C07810g             YHVDA-----------ESGSSMNDLCQ-NYDFVASHILLLQQDTYSDGGFNLSASQ----
TDEL0G04490              DCNDK-----------LSGSPLQELCY-SYEFVASHVLLIDEQNAEYMTTAPPSQ-----
Sklu_YGOB_Anc_6.20b      HYQDL-----------DTGSSLQDLCY-TYEFVANHIIILKKDS--------KYSD----
ACR006C                  QYQDA-----------TTYVPLTELCY-NYEFVASHTLVQLQEA--------RVTE----
Ecym_3024                QYQDL-----------DSGLPLSELCY-NYDFVASHILIQLQES--------KVTE----
                                                                                     

TBLA0A07260              ----QCVMESINGKTITIKRVTGNGALNNGEMLVITPSKNYNTPKKMLKIIKMDLWHNFN
KNAG0M01160              E---AKF-CTFNGKIINGLFSKQ---------SLYTTD--GFSFRSTRRILKYETLDHFQ
TPHA0J00330              ----DVYLKSLNGKEVLLRQS-----------LCIPIK--GYFSKRKSQMRDATLLTNFN
Kpol_1037.25             ----NRY-KSLNNNQLLIKNNNI---------IPLDFN--NSTQKKKYKIIDIKILPNFN
KAFR0L00400              ----STY-RSVDGKLQEVRVRHN---------LVKWKN-------QTFQINESDLL----
KLLA0D01133g             ----TDF-TTLNGRKLSIRYRNS---------TIVTGD--GFTERRKITIKEINLLPTFN
CAGL0L07634g             KRYDVHFIKAMDQSWKFINWKNR---------VIYEFNKLGDQIKNRAKILDIESIPIFN
NDAI0D00800              ----EEF-DNLNGNKFIIKWKHN---------IIFTRG--NFSNDQRFKILKIHPLTNFN
NCAS0H00820              LASIEQF-DTLNGDNILVKWRNN---------FLVLLS--GSPNRQKIKIERIQVLPNFN
KLTH0C11242g             ----EEY-KTLSGKTITLRNQQK---------ALFTGE--GFDARRRCQVLETELLSNFN
Kwal_56.22424            ----EEY-KTLSGKTILLRSQQG---------IIFTAA--AFDTRRRCRIQRAELLTNFN
Smik_13.157              ----SHY-ETLDGKTVVIQWKNN---------VIHALN--GFQVRRRLKILGTKILPNFN
Suva_13.160              ----DHY-ETLDGKTVVVQWKNN---------VIHTLN--GFPLRRRLKILDTKILPNFN
Skud_13.152              ----SHY-ETLDGKAVVIQWKNN---------IIHALN--GFPIRQRLKILETKVLPNFN
YML002W                  ------------------------------------------------------------
ZYRO0C07810g             ----TEY-KTLNDKRVAVRSSSG---------EILTTE--GFPLRRRARIQNVELITNFN
TDEL0G04490              ----VKF-DTLNGKKVIVRSQNR---------IILTSD--GFQVKKRCHITKTDLFVNFN
Sklu_YGOB_Anc_6.20b      ----QEF-KTLNGKTVLIRSQNG---------IVLTGD--GFPSKRRCKITNTELFINFN
ACR006C                  ----LEF-QTINGKSVVIRPQSG---------IIT-----AQPSAKKCRIQRCELLRSFN
Ecym_3024                ----QEY-RTLNGNSVIIRSQAG---------IVM-----SKPELRKCRVKSYEVLRNFN
                                                                                     

TBLA0A07260              SYLQGM-ENYPIWYIDYPL--YPNIIK-NEFLTAFDRKLIETEQ--YSDIAQP-VNDLEN
KNAG0M01160              NYLQGS-STFILIYIDQPLIDTNRLLK-CEDLDCFPNLTINTTP----STRSL-ANLSSA
TPHA0J00330              DYLHGS-GHFGIMHIDYPL-GVSDWTL-IDELKG-----FEESRELPFHSQDKDKPGLLQ
Kpol_1037.25             EYLSGS-EKYTIIYTDYPF--SNSWLPKIEIESFYISKKESNNIKAAQITNHK-SPLSQD
KAFR0L00400              -LLEDK-RQCLVLWINDVK--AADAID----------------------TDGG-KPSLVG
KLLA0D01133g             DYLKGS-NYTPILHISMPL--CGDLVP-LDELQV-----FSKVAGNKYSKQEQ-APLPFD
CAGL0L07634g             NYMKTTDNTITIMYIDDVF--LNGTLE-CNLRSDIDLLRSPSMRSIPTAKRPS-LINKKS
NDAI0D00800              DYFHGS-KEFFLIFIDKPI--TVSSLIANDSLKC-----LLPNTRDLKSQEKE-TPLVQD
NCAS0H00820              DYLQGS-TYFILVHIDKPL--MKDVIRLNDELECFDTLTLHDND--GDSSPDA-RPLIQD
KLTH0C11242g             EYFQGS-STYPIIHVDFPL--TGRLAR-RDEWPG-----FKAYR-FASTDTTS-ANSSLA
Kwal_56.22424            EYLKGD-TTFPIIHVDFPL--TGRLAR-RDEWQC-----FRVTK-NQEHTNGP-KNSGKL
Smik_13.157              DYFEGA-TDFVIIYIEQPL--SCESVP-NDYLQC-----FHSYKKIPKSVYSV-HNLSLD
Suva_13.160              DYFKGA-EYFAILYIDQPL--GCEFVP-NDYLHC-----FNSYEETSKTARNA-PNLLMD
Skud_13.152              DYFEGA-ADFAILFIDQPL--NCEVAP-NDYLKC-----FDSYEEVPKNAQSV-SNLPVN
YML002W                  ------------------------------------------------------------
ZYRO0C07810g             DYLNGS-EKFALVHIDHPL--IGTLIRKIDIPRGLAQGNFNGVD-------AK-GSLVRD
TDEL0G04490              EYLLQE-YKFPILCIDEPI--CAESVR-TQRVQI-----SQTLGSGKRETKDG-SSPTLD
Sklu_YGOB_Anc_6.20b      DYLKGS-KYFPLIHIDKPL--MSDAVK-NDELQV-----FGVRS----TNTSS-LPLSTD
ACR006C                  DYLLGR-TAFALLYIDRPL--VGEIEL-ITPLRV-----FGPQE------QPL-QYQRIT
Ecym_3024                DYLSNV-IYFPLLHIDRPL--VGALVR-NDELQV-----FGSYE----MHNPS-KSKTIN
                                                                                     

TBLA0A07260              T---TKDQNHKIRNISKLE--PDISQSDRGGFTKLIKDDRVIWQPLINSYRATTKHIEQA
KNAG0M01160              E---VPPQRNPLLNSM-IH--AQYNWK----FRAVF----QNYRKEI-------------
TPHA0J00330              RTEENKADRVKFIQLFQER--KDWTIE----LEKYL----KKYQAME-------------
Kpol_1037.25             L---AQKTKSSFRHIINIH--KEWNNI----FDSYI----IDFKNKQ-------------
KAFR0L00400              G-------------LFHRHQSQDFSAD----MSGLI----NDWIRFV-------------
KLLA0D01133g             E---EQKKVLYFEQRIQSI--SDVAER----VALTFHLTKARIKKAI-------------
CAGL0L07634g             TDYENSKSKATFDSILRVN--KHWSSK----FEQHF----QKFRLLA-------------
NDAI0D00800              L---SQQSKSSFENDLNKN--EAWNLK----FGILS----NNYKIES-------------
NCAS0H00820              M---SQHERSQFENIINTN--DTWNKR----FKDWM----NEYKDST-------------
KLTH0C11242g             A---STEPKASLEQMLRAH--PSYGDK----LSAIIRTQRAALSSST-------------
Kwal_56.22424            S---HGDNNISLEQLLRIN--PEYGES----LNDIVKAQRISLNSSV-------------
Smik_13.157              S---SQQERSSFENILHIH--PTRLTQ----LGEMF----SNYRTLA-------------
Suva_13.160              T---SQLERSSFENILHIH--PAWLTQ----LGQLF----SNYRRAA-------------
Skud_13.152              S---YEQERSSFDNILHIH--SARLAQ----LGQLF----SNYRRLA-------------
YML002W                  ------------------------------------------------------------
ZYRO0C07810g             L---TQKSWSSFENILRLH--PDWSNI----LNGYF----NRYRSTP-------------
TDEL0G04490              S---SQGSKSSFDNILRIH--PDWALK----FNELF----AEYRSTP-------------
Sklu_YGOB_Anc_6.20b      L---TQREVSSFEQLFRLH--PQLGDR----FSGLFKEQRQEINANF-------------
ACR006C                  Q---TADAPLPLEQFLRLH--PQLGNQ----LDEVFKDAKERMRYIA-------------
Ecym_3024                T---ISENHIPFEKFIRLY--PQLGAQ----LDGYFQRDRQRIRNEV-------------
                                                                                     

TBLA0A07260              EGLPQAIDENQTDV-NIEMVRDINCDLFEQLKDEKRY---NFLSHDNLMELIYEFIEIKL
KNAG0M01160              ---------TQSESMLIPGFRKTIDKIYDGL--DNSF---HTI--PTIRQLIQEYVEQNV
TPHA0J00330              ---------PLQNI-GSELFHDIVNMIYNTLKEEQRF---QRF--TNLYDIAYEYIESLL
Kpol_1037.25             ---------LNLTS-LPIYFREIVDKAYQKMKFEEIF---LSF-HNDLYNLIFEYLESSF
KAFR0L00400              ---------SDPQK-SITDVVFGINNVIKSLPDENSV---KIF-------------EARL
KLLA0D01133g             ---------SVIGI-RTE-WLNTRDSIRQIISLDKRL---NHL--EDLDAMIYDYVELKL
CAGL0L07634g             ---------NQDDL-PIDVFHNIIEEMHEEMVSDNLF---KNI--VDLRNIIYEYVELNL
NDAI0D00800              ---------SELEP-NHKLFRELVNEAFIEIDSKKFFQKKKNFTSDQLFQLTHDYMERHL
NCAS0H00820              ---------TAEEP-NETLFKQIVAVAYNELKSNKIF---KGF--GHLRRLIHEYLEINL
KLTH0C11242g             ---------YNADN-LAAHFMQTCEKALAAIQEDQSF---RAF--PNLRLQIHEYVEMNL
Kwal_56.22424            ---------TGTTH-LASHFVQTCKKALDVVRAYPAF---QVL--PNLPICVHEYIELNL
Smik_13.157              ---------PSDDP-SEKIFECIVQQAFEGMKSDSLF---KKF--PNLYDLIHEYFELNL
Suva_13.160              ---------LNDDP-SKKMFEELVEQAFDGMKSDSLF---KNF--SNLYDLIHDYFELNL
Skud_13.152              ---------PNDDP-SKKMFEDIVQQSFDGMKSDSLF---KNF--SNLYDLIHDYFELNL
YML002W                  ---------DGLNN----------------------------------------------
ZYRO0C07810g             ---------LTEGP-YEELFRMIVKQVHAKMVNDELF---RKI--PHLYDLIFDYVELNL
TDEL0G04490              ---------EGDDP-HIELFHDIIRRAYSAMRSDALF---ASM--PDLSDLIYDYVELNL
Sklu_YGOB_Anc_6.20b      ---------KGLDS-LVDFFDKFNYEAFELIRHERRF---ENH--SKLHQTVHNYVELNL
ACR006C                  ---------LSLKE-LVRLFHELVEKVYCLIKLDKNF---RNY--LNLLEMVQGYVELNM
Ecym_3024                ---------DQLDK-LIKIFKDLVIDVYGVIKEDKNF---RNY--MELLNVTQEYVELNM
                                                                                     

TBLA0A07260              HDDIWGRISFKF-------TESDFDFSKLSNISVNKLLLNFYSTNNFKNFKLHDIVMMEK
KNAG0M01160              YDDVWQVLINRNNAE-GEKEKQSESSDIFRFISLDQLD-TDFYKAKFSKFYLKDIVQLEK
TPHA0J00330              YQDIWNKLQEHYRDK-------ILDFRLVSQLSLDMLD-TTFYNRTFKNFQLIDIVNMEA
Kpol_1037.25             YNSIWDHIDRNMIDN-QF-LHTEM----MDFLSIDQLE-LELYNQNFQKFNLVNVIKVER
KAFR0L00400              YSSIWNKLVHQTSEP-QN-IDKFYGC----YISFHELNINDYYSLPFNKFSLRDVVFIEN
KLLA0D01133g             FTDIQQQLSEIVEDQ-E--LEHRFDFKALRSISLNQVP-TNFYPKDEKSFSLASVVELEK
CAGL0L07634g             FDDIWKMILRMNKEV-E--IDLNP----FGNISIYQVD-SEFLSTEYSKFFLENVITAER
NDAI0D00800              YDEIWSRIWKMMMNSVKNYADDQKAQHLIKHFSIVEID-PNFY----DIFPLKFVPMLEK
NCAS0H00820              YDHLWLQITTLCA------LDDETKGTRIKNISIEEID-DKFY----EMFPLDFITKLEK
KLTH0C11242g             YDDFWAQLTNSLKDS-E--IENQSDFSILRNISISQVP-SFLYPTDRQKFDIRCVTQVEK
Kwal_56.22424            YDDYWAQLTNSLRDS-E--IESSSDYSLLKHISVSQVP-SFLYPSNPEKFDLRLITQAEK
Smik_13.157              YDDIWSRLTSHFKSY-E--VGTEE----YKYFSINHLL-ADFYSKDFREFKLQDVTFIEK
Suva_13.160              YEDIWSRLTIHFKGY-E--VNTEN----CEYFSVNQLL-TDYYSKDFESFKLSDITFIER
Skud_13.152              YDDIWSRLVTHFKGY-E--VDTEK----YKYFSVNQLL-ADFFSKDFKEFKLSDITFIER
YML002W                  ------------------------------------------------------------
ZYRO0C07810g             FDDVWIRIVNSYRKD-E--IDTEP----LKFLSINELE-TELYQKKYEKFRLQDVTTMEK
TDEL0G04490              YDDIWVRITHHFKDS-E--VESNG----LRYLSLHQLE-TGLYPDKFEEFNLKSVVSMEN
Sklu_YGOB_Anc_6.20b      YDDIWKQITQLYRDD-E--IEATYDYNLLKYIAISQVP-TPFYPEKQSKFSLKKVTHFEK
ACR006C                  YEDVWRKLVQLNGKN-E--PDRVPGYYITRSISLNQLS-TSIYPEELDKFNLSPVTEIEK
Ecym_3024                YEDIWLKLVQLNGSK-E--PDRVSGYSSTKYISLNNVA-TILYPEGTNSFDLRVVTEVEK
                                                                                     

TBLA0A07260              KISRAVTYFQKFINGITFQEKSTALIKTLQILTIN-------------------KLTDAD
KNAG0M01160              NISKATKSFENLSVTHTYVEKCRVLVETLQILSKPVKRVGGYQ-----------VPITAD
TPHA0J00330              CMVQAVSVFKGIKSANSYSKKVDVIFKTLNIITGKNSDDTIRDNTLPKL-----PLIDAD
Kpol_1037.25             CVKDATDQFKKIIDSKSHSEKCQILIDALQKLTSYDDVHYEP------------LMVDAD
KAFR0L00400              VVDLACKEFVKLRESLSFDEKIDILLSTFNILTSK----------------LPQLEIDAD
KLLA0D01133g             SVNDALEYLKSIDLKTTHSGKLEVLSTTMRLLSRE----------------INGISTDAD
CAGL0L07634g             NIKEASKSLQKIESASNYKSKANILILTLRTLTGNKENDGYSSKNDDGNLSFFPLAIDAD
NDAI0D00800              NLKHSVTCINKLKSTKSYTEKSTILIESLQIITDSNTGGEESKDKN-----KSGYLIDAD
NCAS0H00820              NMVRSTNSINKLNGKNSFNEKSENLIATLQILTNMDNPIGELNQENEK---GANNLIDAD
KLTH0C11242g             NLREAVECLRRLPVTNSHSSKAKVIVETLQTVSRSLEINDKV------------ISVDAD
Kwal_56.22424            NVKGAVESFRKIAVTNCHSAKAKVIIETLQTLSRSLLVDDRA------------VTIDAD
Smik_13.157              RVHLASKHFQKLTLTHSYTEKSKILVETLQELSGTTDMGSHQLDVPGR---LNNLAMDAD
Suva_13.160              RVSVASKHFQKLALSHSYAEKSKILVETLQHLSGTTDMGSHKPDLSNG---FNNLTMDAD
Skud_13.152              RVNVASKHFQKLTLTHSYAEKSKILVETLQQLSGPTEISSHQQELPNG---LNSLTMDAD
YML002W                  ------------------------------------------------------MTMDAD
ZYRO0C07810g             NIDLAINSFVGLPLTHTHAEKADCLINTLQSLSNTREQDMDIQT-------LP-ITMDAD
TDEL0G04490              NIELAMNSFSRLPLAHAHADKAMYLIDTLRNLSRVDKSIQE----------VSPVAIGAD
Sklu_YGOB_Anc_6.20b      SLEQATDCFKRLAFSSSHSEKTKIIMDTLQTLTDYSEFPDAD---------IEDVTIDAD
ACR006C                  RVVQATECFSKLTLTNSHHEKARILISTFQKLTTKTSQATLD------------PMIDAD
Ecym_3024                RVVKATDCFAKLSLTNSHNEKAKIVVSTFQILTTKMEYTSID------------PTIDAD
                                                                                   **

TBLA0A07260              TLIGLLSIVICRLKVR--NLKSHLFYLQNFAADPNTIKFGILGYSISTLEAITYYFDHI-
KNAG0M01160              TLVSLFILLIKRTKMK--NIRCHLYYLQNFHQDENSIKFGLLGYAISTLEAVICYLETIE
TPHA0J00330              TLVSLFALLLCRAGVE--DVFLHVQYLQSFYKDENTVKFGALGYTLSTIEATLSYFYELS
Kpol_1037.25             TLMNLFLLVICRSKVP--FLRNHLYYLQNFSTDENNVKFGLLGYGISTFEATLCYLKDF-
KAFR0L00400              NLLNFMLIIINRVKLN--NLNEHFHYLQNFNFKQNK-DFGILNYAISTLGAVLYYID---
KLLA0D01133g             TLLSLFVLLICRSQVT--GLVRTLTYLTNFEISETSIKFGLQGYVLSTFEAALSFF----
CAGL0L07634g             RLMNLFVLVTCRAQIK--NLKCHLSYLQNFYNNDSDTKFGILGYALSTLEAVVCYFEQL-
NDAI0D00800              NLLNLLTLVILQSNITLHDLKANLYYLKYFSTDESSSSFGILNYTIATFHMVSHVL----
NCAS0H00820              TLINLLILIICRSEINIVDLKRNIFYLKKFNYDENLINFGILSYTISTFEIVIYSF----
KLTH0C11242g             TLVSLLVVVVCQAEVK--DLKSHLFYLQEFAKDSNSITFGILAYGMSTLEAVLSYF----
Kwal_56.22424            TLVSLFVVVVCHAQVK--DLRSHLFYLQEFTKDTNLVTFGILAYGMSTLEAVLCYF----
Smik_13.157              TLISLFVLVICRSEQK--HLKSHLYYLQNFSNNSSSSKFGILGYAVSTLEAVVCYFEDFK
Suva_13.160              TLISLFVLVVCRSEQK--HIRSHLYYLQNFSNNSSSSKFGILGYAISTLEAVVCYFENFN
Skud_13.152              TLLSLFVLVVCRSEQK--HLKSHLYYLQNFSNNPSSTKFGILGYAISTLEAVVCYFEDFD
YML002W                  TLISLFVLVVCRSEQK--HLKSHLYYLQNFSNNSSSTKFGILGYAVSTLEAVVCYFEDFN
ZYRO0C07810g             TLISFFVLVVCRTQVK--NIKSHLFYLKKFSKDENSIKFGILGYAISTLEAVVFYFDGL-
TDEL0G04490              TLLSLFVLVICRTQLR--NLKGQLFYLQNFAKNETSITFGVLGYAISTLEAAVCYFDEL-
Sklu_YGOB_Anc_6.20b      TLIGLMVLVVCRSQVK--NLKSHLFYLQNFSLDENTIKFGVVAYALSTLEAVLCYFEDA-
ACR006C                  TLLGLMVVVVCRAQVK--NLKSHLDYLREFAQNSDDVKFGLLGYSLSTLEAVVGYFDIG-
Ecym_3024                TLIGLMLVVLCRSQVK--NLKSHLEYLREFAPRPDDVKFGLTGYSLSTIEAVLAYFEAG-
                          *:.:: ::  .       :   . **  *        **   * ::*:      :    

TBLA0A07260              -SHSHKADLIAFCDKLHNLYDTI-----------LNNIKSLDNDILSYRSQNGESLLSLC
KNAG0M01160              TDKERLDCIEKNDANLEEFLTLLTRSKC--VSNEGLDLSKYSH-NFRYRNGDGNSTLSLC
TPHA0J00330              NSDESRIQLQKLSLLED-FLIKI-RSQH--DD--LIPINQFKD-YFRYRTQYGESILSLL
Kpol_1037.25             QAGEKFNKQVLNCIRNKELISKI-SSEA--DHSTF-QVKLYKD-CFKFRNEMGESILALC
KAFR0L00400              NNLDKFKRYTDAIQDSKI----------------------SEE-KLKYRNENGESYLCHC
KLLA0D01133g             -HQDTVDSLTKKCASNKKIWASI-QKHS--KV----EAELLSS-NLRIRTDSGESLLSIC
CAGL0L07634g             KEKENYRKLIDFCNSNERLVKVLSSTKKYETNAALYFLRKYEG-SLRYRDSLGQSLLALC
NDAI0D00800              ENVIDWDRLKEKSDLIEELI----MTDD--LSTLSSTFENDKKTLLMYRNSNGESLLALS
NCAS0H00820              ENIVEYDKLKSYSE----IIEKL-IKVD--DLKKVPKTIKWEQ-FLTFRSDTGESILFSC
KLTH0C11242g             ESREKLKLLEKHCSSNASYWEAL-ADGK--LPLGSLNPSEVKD-ILRTRTPAGLSCLSIC
Kwal_56.22424            ESPEKVASLEKYCRANLSHWKSI-SEGS--IDLNADTTVPLDD-LLKIRTSDGQSCLAVC
Smik_13.157              KNSDNMAKANVLLQKTKRLVNML-SCEN--VTNKVENLATYKD-ILPYRNGQGQSILSIC
Suva_13.160              KNNNNVAKANLLCIKTRDLLDKL-SCEN--PTNEVNDLATYKD-ILAYRNEQGQSILSLC
Skud_13.152              KNNENLAKANVSYQKTRELLDKL-SSEN--PTNEIENLATYED-NLQYRNEQGQSILSIC
YML002W                  KNTGNVAKANTLCEKTKNLLDKL-SCEN--PTNEVEDLATYKD-ILTYRNEQGQSILSIC
ZYRO0C07810g             KGTKKLQKLQDDSNKAKELYILI-SDKS--TGQAVLDISQFRS-NLEFRTPQGESVLSQC
TDEL0G04490              KGSKKMSRLESECENARSLVDKL-SSES--SS--V-NLIHYQK-TLSYRTEQGESLLSIC
Sklu_YGOB_Anc_6.20b      ENSGKIRSLEFNCRRNKQFWDHL-SCKA--VS--FDSLKSYRD-ILRIRTAGGESCLSVC
ACR006C                  GSSIKLERLITQCQRNKIFWNLI-EQGI--PI----NLKEHEE-VLISRTPSCESVLSLC
Ecym_3024                DGTEKLKKLISLSEANRVFWDLI-RSGV--AV----SLSSYKN-SLISRSSNCESSLSIC
                                                                      :  *     * *   

TBLA0A07260              IINNKMDIFLELL--TTYEHSFPIEDILDDSDLNGSSLLMQACKYNNYVASEILVTILKN
KNAG0M01160              IINFKNDIFFELL-SENYESYFAFEDLLEDQTTEGTTLLMQSLQHSNHEITEYLTDIMLK
TPHA0J00330              IANKKNEALCEAL--LNFEDIFPLDDLLYDTDVSGSTLLIKCLKERNLEAAEILIEIFQN
Kpol_1037.25             IKHKKNETLFEIL--LNFEDMFPLEDILDDEDIEGTTLLMKALKVENEVGAKLIVDVLQS
KAFR0L00400              IITKDNDTLRELLFSSEYIKNFPMEDILDDQTIDGSTLLMVAVKCLNTTAASILINIIIN
KLLA0D01133g             IQSHNNEVLTTLL--ANFESEFPLEDILDDRDFALSTLLIQALQVQNSQAAAILSEIILK
CAGL0L07634g             IIHGRNDFLYHIL--NEYETLFPIEDLLADESIDGSTLLIQAVKHDNQYSASLLLNILKD
NDAI0D00800              IINKQNKKFTQYL--IEYEDILNMDIISNDQSMDSSTLLLQAIRSNNFEAAIILVKLLFQ
NCAS0H00820              ITNNQTEKFLDLL--VDYEEIFSMDNILDDANVEGTTLLMQALIYRNFKISMVLINLLLR
KLTH0C11242g             LQNRQPNLFLHLA--TKFEHCFPLEDLLNDETVEGSNLLIQMLDNGCSSLSGNFIEMLFR
Kwal_56.22424            LQHRRTEEFELIK--NTREAWFPLEDLLHDETTDGSNLLIHMLESGCDRLAVMLINTLIS
Smik_13.157              ISNNKNHILLDIL--SEYDSIFPLEDLLEDETIDGSTLLIESIKSGNLEAAKILIRIMML
Suva_13.160              ITNNKNDILLDVL--SEYEALFPIEDILEDETIDGSTLLIESIKVGNLEATKILIRIMLF
Skud_13.152              ITNTKNCILLDVL--TEYEDLFPMEDILEDETLDGSTLLIESIKTGNIEAAKILIGIMLL
YML002W                  ITNHKNYILLDIL--SEYENDFPVEDLLEDETIDGSTLLIESIKAGNLEAAKVLIKIMLF
ZYRO0C07810g             IINDKNGLLYELL--KNYEDIFPLEDILDDETVDGSTLLIQALKCDNSEAAQMIVEVLQN
TDEL0G04490              IANGKNDILQELL--SD-ERSFPLEDILEDQTTEGCTLLMQSLKCGNGDAASLIVDLIKS
Sklu_YGOB_Anc_6.20b      IQKGNFSGIECLL--QNFEHELPLEDILDDQTINGSTLLMQTLETGNTRMADVLLEILCQ
ACR006C                  IQYGRQDVFYDII--ANYQSHFTLEDILQDVNQSNCSLLIQALQAGNKDITEAVIDLLIA
Ecym_3024                IHAGRLDLIKEIL--LNYQEQIKLEDLLFDVNQANSTLLIQALETGHDEIAELLIDVMIS
                         :       :            : .: :  *      .**:          :  .   :  

TBLA0A07260              SC-NEEELRIFLNKTDKFNRSVAHYFNMKNSILILTEFGNLIDWELKDI-KKLTPLLTIF
KNAG0M01160              NS-TEEELYYYCGKRDKYKRNIGHY--ICGQQTLLQKIGKYIKWDSKDC-TGQTPLCVIF
TPHA0J00330              SC-TNSELLNYYNKTDKTKRTLAHY--ITDEIEILEKIGKYINWTLKDL-KGRTALFTIF
Kpol_1037.25             SC-SEDELIKYFNRTDNNQRIAAHY--ITNQIDVLKRIGLFFNWKIKDD-KGYTPLTTIC
KAFR0L00400              NG-TPDEIRTYVNSVDENNRNVGHF--ITNQYYLLCKIGPYLNWNCKDKRTGQTPLFNIF
KLLA0D01133g             SC-TESEVRSYLNSPNLHNRITAHY--IMQDISLLESVGRYFNWEHKDI-NGHTPLFAVF
CAGL0L07634g             NC-TEIELIAYINRHDINKRTAGHF--LTNELEVLKLMGKYINWVQKDN-AGQTPLFTIF
NDAI0D00800              NCRNQKELISYINQVDIHNRNIGHY--LVINLTILKIIGQFINWKQKDV-NGRTPLFTIF
NCAS0H00820              NC-SNKQIMEYINKIDKFNRNVGHY--LINELEILKIIGKYVNWKQRDL-VGRTPLFTIF
KLTH0C11242g             SC-TKTELESFLNHVNRYQRSSGHY--LMHALDLIVKVGKFINWEQRDC-NGHTPLFAII
Kwal_56.22424            NC-TKDELIAFLNHTNKYQRSCGHY--LMHAPQLIDLVGDILNWEQRDC-NGHTPLFAIV
Smik_13.157              NC-TEEELISYINRTDKYSRTVAHY--LTHEIDILKSIGNYVDWKRKNS-GGQTPLFSIF
Suva_13.160              NC-TDEELVTYVNKTDKYARSVAHY--LTHEMDILKSIGSYINWKQKNS-SGQTPLFSIF
Skud_13.152              NC-SEGELVSYVNKADKYARTVAHY--LTHEMDILKSIGSYVDWKRKNS-SGQTPLFSIF
YML002W                  NC-TEEELVSYINKTDKYARTVAHY--LTHEMDILKSIGNYIDWKRKNS-SGQTPLFSIF
ZYRO0C07810g             SC-TEQELREYVNRADKNRRTVAHY--LTHEMNILESIGKYINWKSQDS-NGHTPLFTIF
TDEL0G04490              SC-TQEEMFAYFNRSDKDKRTAAHY--LTHEINILEQIGNFFDWDVKDS-SGHTALFTIF
Sklu_YGOB_Anc_6.20b      SC-TINELREYLNRRNRWKRTAAHY--LTQDLQMADKIGIFFDWEAKDI-SGHTPLFAIF
ACR006C                  NC-TNTEMYAYINKCDIAGRTVGHY--LPQNYEIVDRLGKFVDWKRKDL-NMHTPLFTVC
Ecym_3024                NC-TNNEFYEYVNRSNSAGRTVAHY--LPQAFSIIEKIGLYLDWRKKDV-NMHTPLFIIC
                         .  .  :.  : .  :   *  .*:  :     :   .*  ..*  .:     *.*  : 

TBLA0A07260              KVHKVN--YNESFIKILFRVVLTWYK-IHNKPFNLKAHVDQNGNNLLHVMKDYINCLIEN
KNAG0M01160              RSYDQA--FYDVMVETSFAIAVEWYSTVKNSKFCFRDHTDSKGNTLLHIIKCNISFLLQS
TPHA0J00330              RSYDQT--TYSSTIKIALDQALLWYK-NNDIIFKVSDHTDLFGDSLLHILKSQVSLLLKF
Kpol_1037.25             RTYDQE--CYEQMIETAFFEAQKWYE-NRNQKLNFKDHNDSKENTLLHILKCDIQVLLKY
KAFR0L00400              RSYDQSIKSYKKMSRRSFR-----FA-MDSGDFQLKKHIDNSNNTLLHILKTNIQMILPH
KLLA0D01133g             RSYDAV--NYDEIVTKVLDQVVKWYA-NNNKPFNFKIHEDPKGNTLLHVMKSGIESLLKL
CAGL0L07634g             RSYDQD--NYDEMVSQSMEYATNWYG-LNGKNFNYLDHVDKKGNTLLHILKCNLPILLAD
NDAI0D00800              RSYDQS--NYDELVCQVFQIAIKWYA-ANNLKFQMNDHDDSNGNSLLHILQNNISILLDY
NCAS0H00820              RGYDQP--NYDEVISTVFDITLNWYA-ENGLKFQMSDHYDLKDNSILHILRSNIDILFTY
KLTH0C11242g             RTYDHT--DYDAMVLEAYKSARLWCT-LKGKQFRLSKHQDNKGNTLLHVIKSNVSVVLDD
Kwal_56.22424            RAYDRP--DYFDMVSAAYRAAVGQSK-VRNSRFRVSNHTDDKGNTLLHVIKSDVSILLAD
Smik_13.157              RSYDQP--NYEAMVKIAFNIANTWYR-KQNRSFDYRDHTDNKGNDLLHVLKTDASILLQL
Suva_13.160              RSYDQP--NYEEMVKVAFNIASSWYQ-RHNTSFGYSDHTDNKGNSLLHVLKTDVSILLQL
Skud_13.152              RTYDQP--NYEEMVKIAFNIANSWYQ-KHNSSFDYLDHTDSKGNSLLHILKSDVSILLQL
YML002W                  RSYDQP--NYEEMVKTAFDIANTWYR-KHNSLFDYLDHTDNKGNSLLHVLKTNIPILLQL
ZYRO0C07810g             RCYDQQ--NYEAMISAAFRSAVRWYQ-ANGEDFQFSDHEDNKGNTLLHIIKNNVSILLDY
TDEL0G04490              RSYDQP--NYDDMIRASFRCAAEWYA-CRMRPFCFTVHEDRKENTLLHILKRSISILLEY
Sklu_YGOB_Anc_6.20b      RSYDHP--DYAQMVTNAFRTASKWYE-IRGENFNFSAHKDTKGNTLLHVMKTNIEILLEQ
ACR006C                  RAYDHP--SYLELLSKCFQHCFDFYS-TRGKRFSFADHEDPLGNTLLHIIKDGIQLALST
Ecym_3024                RAYDQL--HYSEMLSRSFEYVFEYCR-RRGEDFSFTDHEDPMGNSLLHIMKGGIQSILSQ
                         . :.                            :    * *   : :**::.      :  

TBLA0A07260              PELCET-ININANNNKGLSPFMVYFKTNRYDNIRIIL----KNPTLITSEGQ-LPFLITS
KNAG0M01160              PD-----VDINKVNSQGLSPLTNNAMYDRGENVEALL----KDPRLIFSSFD----FLKQ
TPHA0J00330              ED-----LDINIPNLKGMTPLMTYVKYNRIDNIKTIL----EDGRLIIKKLQ-KDKYLNC
Kpol_1037.25             DN-----ININAHNLKYITPLMTYVKYNRVSNIQEII----RDERLILGKYQ-KHTFLDC
KAFR0L00400              AS-----LFINSPNSLGMTPLMVFCKYRRLYNIQILLSSKFKDRVSIFETQQVHNAWSNC
KLLA0D01133g             PD-----VNVNKPDSKGLTPLMIYSRYNRITNIETIM----KDERLLCDLVQ-QPLVMTS
CAGL0L07634g             KH-----INVNATNRSGQTPLMTSIRYKRTENIRDLL----CDPRLRVDITQ-KNNALTA
NDAI0D00800              AKDQNIPINLNKMNCKGFTPLMMYFKYKRYDNIRMII----KEEKLIFNKFQ-SPNFIDC
NCAS0H00820              SKRNHFEIDINKRNYKGFTPLMIYVKYHRLSNVKLIL----GDDRLLFNRYQ-RELYTTC
KLTH0C11242g             PL-----VNVNSFNKKGLTPIMVYARYNRLDNIKSIL----RDKRLIIQKCQ-NGSYLTC
Kwal_56.22424            PF-----IDVNATNAKGLTPLMVYVRYNRIGNVRTIL----QDQRLIIGKHQ-SGAYLSC
Smik_13.157              TK-----LDINGENYKGLTPLMVYVKYKRLNNIEAII----KDQRLVLEKIQ-KSTFFTC
Suva_13.160              TK-----LNINGENYKGLTPLMVYVKYKRLSNIDAIT----KDHRLILEKVQ-NSTFFTC
Skud_13.152              SK-----LDINGRNYKGLTPLMIYVKYKRISNIDAIT----KDSRLILEKVQ-NSTFFTC
YML002W                  TK-----LDINEENYKGLTPLMVYVKYKRLSNIDAIT----KDRRLILEKVQ-NSTFFTC
ZYRO0C07810g             DN-----VDINCTNKKGLTPLMIYTRYNRFDNVKTII----RDQRIILDKLQ-HPSFLNS
TDEL0G04490              ES-----VDVNARNRKGLTPLMVYAKYNRLDNTKSIL----TDKRVILGKIQ-HPLLLCS
Sklu_YGOB_Anc_6.20b      EN-----IDVNEVNKKGLTPLMVYVKYNRLDNVKCIL----RDNRLIMEKHQ-KSLFLNC
ACR006C                  PG-----ANVNKCNTRGMTPLMVYAKYNRIENIREIL----NDKRLILSKLQ-DPQSLKA
Ecym_3024                PN-----INVNKSNIKGMTPLMLYAKYNRIENIRDIL----EDKRLIVSKIQ-NPQTLKA
                                  :*  :    :*:       *  *   :      :        :        

TBLA0A07260              TNLY-NSKVNHLLATHFLRT-LDFAYICLHSLR-FNDPSSSTSGTSLAWLVDISIL---E
KNAG0M01160              YPNTKSAPILS---HYCLDNEAPFRNIIASHFD-FRI--SNK------RSVVLTSRSKED
TPHA0J00330              LDYGKNFTVFNLLAAKLSKD-VIFENAYISYAR-YEK--SH-------WYLCISVQ---K
Kpol_1037.25             YDFVKNTIIFEDLGVRSVRN-SMFNLFSAYSLR-VEN--SN-------WVLYFTFK--DT
KAFR0L00400              FSLTNDDQILNLLGKFAIKNYSIFGNCFTHSLKQFLH--KSKHGNKNQYSVKITLK----
KLLA0D01133g             LDFTKNPKVTKTILDATFNR----EPVVIHSLR-FEE--RK-------WKIGI------F
CAGL0L07634g             FDFSKDDEITHLLGEHELLN-SPWLAVYAHTLK-YTN--SR-------WNLSLTVK---L
NDAI0D00800              FDYSVDSSIMNDIGEFLLSNGQLFGKIIVLSLK-KQM--STVPSLPRGLYINYTIL-IDE
NCAS0H00820              FDYATDSTISNELGKHALQNNTVFGRIYIHSLKVRSS--TN-------ATFSLTFP-LPD
KLTH0C11242g             FDYIKNPVVLGELGKHAFFL-PQSYQIRAHNIK-FEG--DE-------WVLWMTLV-GSV
Kwal_56.22424            FDYVKNPAVLKELGKYASYL-PFEFSINVHSVK-REG--DE-------WVLWITVT-GGE
Smik_13.157              FDYAKDHTVLSKVGERGAKD-SLFGLIYFHSLR-YHN--LN-------AAVNITFA--SD
Suva_13.160              FDYAKDRLVLSKIGERGAND-SIFGLIYLHSLR-YHN--LN-------ATVNVTSV--SK
Skud_13.152              FDYAKDHSVLSKIGERGARD-SLFGLVYLHSLR-YHN--LN-------ATTNITTA--SN
YML002W                  FDYAKDHSVLSKIGERGVKD-SLFGLIYFHSLR-YHN--LN-------ATTNITSV--SN
ZYRO0C07810g             FDYARNPLVLKELVSQAIKT-TAFELAFVHHLK-YEA--PS-------WFFHITVKIGAG
TDEL0G04490              IDYAKNPLILHEIAKQSAMD-TAFGKCFVHTLK-YES--SS-------WLVNITVQ--AD
Sklu_YGOB_Anc_6.20b      FDYVKNPVIQAELGFHAAEK-TKFGEVVAHTFR-FEN--NR-------WFLWITLK-GKD
ACR006C                  IDYVKNPIILNLIGTAMAKN-SLYGCLSVHNIK-YEE--NA-------WYLWITSS---L
Ecym_3024                IDYVKNPMILNLIGTHIAKN-SLYGLLSADGIK-FED--NC-------WYLWITVK---F
                              .  :                                                   

TBLA0A07260              KESEFPTSHPSICRTKTLKLKTIKSLLHHFI--RKYKYSSLPLKSALEFCNDLIKSNNSI
KNAG0M01160              AQELI--------GSEAFELKNLKALFRLLL--KQHPFTFFPLEELLDELSVVEKTASS-
TPHA0J00330              DDLEY--------TTNIIKLKKYYNLINAMQ--KIYKSDFIPYSDMLDCLKKIIEGHN--
Kpol_1037.25             NQDSY--------ITKSVSLKILFNIIKKYN--KLYPLHFIPHKEVLLRLTGIVKNN---
KAFR0L00400              FEKKY--------KTIRFNIKTIKALINMVLTSNSHVSSFLPLYKVFNELNGIAS-----
KLLA0D01133g             SEGIF----------KKYSLDLIQYYLRYLK--IMYPCSFHPVQLLTNELRLLGIYG---
CAGL0L07634g             KDAP---------KTTNFTLKTLRGILRVVI--KNNMTVFLPVQELVEDLISFNRIR---
NDAI0D00800              ADKST--------LTKTMKFTSLVKFLKIMK--RKYAISFLPLDTLLNESQSFLDKKSKN
NCAS0H00820              KENET--------GTVNIKVKAIISLLKVIR--KKSQISLLPLDRIIKVLVKLTSKENNK
KLTH0C11242g             PNAPA--------KVIQRSLKFIQSFLISFS--KTNSMTFIPAESLAEELSLLAKMK---
Kwal_56.22424            KQVPV--------KVFKRSLRFIQAFLTLFS--DAHPMTFVPVDELLRELRALSQSR---
Smik_13.157              TEKPF--------SNTVINMKTIQGLLRSIL--KDNPFTFLPLNIYIDEISQLSRSD---
Suva_13.160              TEEPF--------VTAVINMKTIQGLLRSIV--KDNPFTFLPIDNYIDGISHLNRSD---
Skud_13.152              TDKPF--------LTTVINMKTIQGLLRSIL--KDNQFTFLPLNSYIDEISHLNRSD---
YML002W                  AEKPF--------ATTVINMKTIQGLLRSIL--KDNPFTFLPLNTYIDEISHLNRSD---
ZYRO0C07810g             ADEEY--------KTVKLHIKTLQNLFQVLL--KMHFASFLPLEKALEDLSNLYKSR---
TDEL0G04490              RKGNF--------ETVEFHLKTVQNFFRTVL--RTCPMTFLPLDSTLNQLASLGKAR---
Sklu_YGOB_Anc_6.20b      RETDF--------QTVKHNIRAIQGLLQVYL--RRNPMSFLPIDAVLEDLHEIGKTG---
ACR006C                  SPESY--------KTSSYALKDIQSLLQIYN--KKHPMSFLPIDHHLETLKTLGKSG---
Ecym_3024                SDNSY--------STLRQSVKNIQGLLQFYN--KKHPMNFLPIDHILSILKNIGKPG---
                                            .      :              *          .       

TBLA0A07260              SWTSNRHFLPLSLLIDKLEIQYNLKLISNCLNFLFITTD--FDFTLLFDELKLQAFLKIN
KNAG0M01160              --------RS---LMKSSFCSKVLKKLTYCLDSMVEMEL--LPTAALQSVALLERHIAKE
TPHA0J00330              --------IL---PIRRLKIKNYLNFLSHGLSALLYFEK--IDPLTLLDENLIIKWISSK
Kpol_1037.25             -------PNN---GIQKLKNRAFLNLISNYFGTLIETDD--FDTELFKNPESLTKWIKAG
KAFR0L00400              -------------MISTKSKILFINNLNVILDTILFLEL--VPREGFILEARLKDYLRNQ
KLLA0D01133g             --------VP---GVLRLQSYHTFKKLDMLFSYVNTRGK----LWLGKDEEELKVLLDVP
CAGL0L07634g             --------FS---ELMRIKVLEMLPFISFCLSALVHIKV--LDLNVFQTEENAIKWVKMN
NDAI0D00800              NNNLRTIPLR---YIEKLRIRRFLKRLNTCLDVLLHFDDSTIATPLLLSETELLEWISIE
NCAS0H00820              II------VR---KIEMLRNQSLLRRLTDCLDTLLFFDIGIDYLSLITDETKLLGWVTNE
KLTH0C11242g             --------II---SINRLETKHFLRRASVVLSLICRQEE--FEHIFNNPSGSLVNAAEHV
Kwal_56.22424            --------IL---ILNKMDTKRFLKRCSVTLSMVSQERL--FADAFTDSNLNLSSSRGLG
Smik_13.157              --------VT---IIGKADVMSLLHKLSNCFNVLLFLKK--VPKSLFTDEASILYWMRIN
Suva_13.160              --------LT---IIGKADVRSLLHKLTNCFNVLLFLKK--VPQNLFTDEASVLYWMRIN
Skud_13.152              --------LT---IIGKADVRSLLHKLTNCFNVLLFLKK--VPQNLFTDEASVLYWMRIN
YML002W                  --------LT---IIGKTDVTSLLHQLTNCFNVLLFLKK--IPENLFTDEASILYWMRIN
ZYRO0C07810g             --------MP---SIAKLETLYFFYMLTDCFDVLLRHDN---LNKLVLRESRLVSWIRSQ
TDEL0G04490              --------LS---SIGKLETVCYLRSLTNCFNVLINSQE--LPKDILANESKLLSWIKVQ
Sklu_YGOB_Anc_6.20b      --------LV---SVGKLEVHRFLCELTLVLKLICQKEE--FKKALYLPASDLVNWIRES
ACR006C                  --------II---SVINLENSMLLEALTFSLSIIQQRED--YKNVFSYTESELSTWLRAS
Ecym_3024                --------IL---PVINLENSIFLGLLTQLLSVIGQRNE--YMAVLRYNESDLSTWLRTN
                                       :        :      :  :                          

TBLA0A07260              NKKLKESNSSNKFSHKNNSDQTTELSKAYQPEDINAIQTFIKFNLGELENFKNTITTIKD
KNAG0M01160              KVTVDEE-----------KLKRRSKDKKMQPESIGTITTFLKYILESLLKLKGTIIELRK
TPHA0J00330              LQQQEKS------------IDDHSSFKPLSAEDINNIKAFCDFSFQEIGKTNNVIQSFLK
Kpol_1037.25             KRKHKKE----------------NYYKRMTLDDINMIKSFVQFNINELGKLNRTLAILKK
KAFR0L00400              RKIKTVA----------------TKSKKLQIEDINMISNFLKFNLNELNAFKNGVKKILR
KLLA0D01133g             TPYLSES----------------ERFIKLEPEEINGIQTFLKYNLAEFQKLRNCLIILKK
CAGL0L07634g             GSVDKKT----------------NQTSDITPEDISMIQNFLKFNITEIERTKNKLEIAEK
NDAI0D00800              ESKLRRSSTTPSAKSKLENAMGEKKKKELKPENINIIQNFLKFNLNELNTISMNLKVLSK
NCAS0H00820              NTKLKHN-----------VNKTHGEKKSLKPEDINIIQSFLKFNVKELYNVLLNVKTLEK
KLTH0C11242g             QEQEANS-----------------TYGMIEPEEVASIQKIMKFNRTEILAIKSGALMLKK
Kwal_56.22424            SSESFTQ-----------------NMKMMEPEEVRSIQSILKFNLSEISALKTAMLLMKK
Smik_13.157              TSKRNQK------------QPSKENYKTMEPEEINMIQSFLRFNFDEISSFKASLSILRK
Suva_13.160              TSRRNQK------------PPSKDNPKTMEPEEINMIQSFLRFNFDEILSFKASLNILRK
Skud_13.152              TSKRNQK------------PPSKDNPKTMEPEEINMIQSFLRFNFDEISSFKASLNILRK
YML002W                  TSKRNQK------------PSGKENPKTMEPEEINMIQSFLRFNFDEISSFKASLNILRK
ZYRO0C07810g             DKKCNNS-------------KKLQKQKNVEPEEIGIMASFLRFNRGELSAVKLKLMTMKK
TDEL0G04490              YKAFRNG-------------TTHIFSKKVEPEEMSIIQGFLRFNQAELSTLRSKLHVMKK
Sklu_YGOB_Anc_6.20b      GRKRTNV------------------SRRIEPEEINSIQSFLRFNLSELSLIRDKISILQK
ACR006C                  MVKQKPN-----------------KRDKIEPEEIHSIQNFLKFSLTEFNYLREKFTVLKK
Ecym_3024                NFKPRAN-----------------KDERIEPEEVSSIQSFLKFNLSEFSEIKEKFTILRK
                                                        :.:  :  :  :   .:            

TBLA0A07260              VSILIKYKIMDLNSSQFFFQKNTLKIGINNLSEILKYYSTQKPLITNAYTSRKFYDYNSY
KNAG0M01160              FSILSKLKSKDISESKNIVCTLGA----EVSSKKI-------GRAMVRYSTIDNKFLGEQ
TPHA0J00330              LSIFGEIKNTDLNTSYDILERLGSYFSNNEI-----------SRTLGDLQSISPHVHSSM
Kpol_1037.25             LCTFLALKINDVNESYKLFRNFGALLQQKDISN---------QMKKIDGLIKPKYFQSIF
KAFR0L00400              QMNSINLKLFDQRISYMDLL----------------------HCPDVVVHLNNPLWNLNY
KLLA0D01133g             LAIVQQIKHRDVITMRNSFL---S--LGNQMSQKG-------VAKSFENTNCAWSYDLSY
CAGL0L07634g             LSLFSRLKSKDLLNSNENYVTIVS-----QLSSKR-------FRSTLKYSAEDTKLLSVR
NDAI0D00800              LVIFMNLKTLDIHDAQIRFNGLVKGLNNKEVPSII-------EKSFNVIDSSRYDDDKGV
NCAS0H00820              LLNFIHLKSIDVKESRLAFVHLVKSIKNDQIAQAT-------NRSLEPIIEMQSLENQYY
KLTH0C11242g             LAIFGILKGKDLERSHTMFQ---S--HGNNFTKII-------GRSTNVFGSLKHSLPQC-
Kwal_56.22424            LAVFEGLKGKDLSEACMTFG---A--KCKYVTQGK-------IQSFDHFLNVQAPNLFDF
Smik_13.157              ILIFISLKSNDFKDVNDNLN---E--MGKSIYNAK-------AADAFAGNLTNHNMFNDY
Suva_13.160              ILIFLSLKSSDFEDAYASLL---K--MGTKVTNGK-------AADAFTTIIKNHKMFSDL
Skud_13.152              ILIFLSLKSNDFEDTYDSLR---E--MGRKIINGE-------AADAFARIFTNHNMFSDL
YML002W                  VLIFINLKSDDFEDAYKGLN---E--MGRKLINSE-------ASSAFKGIITNHNMFSEL
ZYRO0C07810g             LLIFLKLKNTDLTHSYQFLSLFGT--EYNLAQDRL-------LFKDLEINCCAFGEEATM
TDEL0G04490              LAIFLRLKSSDVEQSVELLLPLGS--EG--MGDLY-------PLTDHKFSCTTVYGNDSM
Sklu_YGOB_Anc_6.20b      LSIFSELKAQDINQARCMLF---S--QSVRLEDTA-------ISQAFGISGLSEKDSEDL
ACR006C                  LIIFEHYKSHDIECSQRILY---S--QGEIIASVV-------PSKRLRTSPFDNEFNDGI
Ecym_3024                LVVFQSLKAQDIECAQRIIY------QQMEIVSNS-------VGPSVEKTFIGSNENYSL
                                *  *                                                 

TBLA0A07260              DYKVEFLNKLLENLIFFEKLVCKLYYDFEDLSNGTIKTWWYHYGRLLDYEAQYNKHYP--
KNAG0M01160              SF-----DLLVFQIHFFESCLSSIINSIDHLLHLKIPEWWKCYGQLLELSKEDPSVLA--
TPHA0J00330              VY-----YELSQDILFMKKCTLILTSKLASFIKDKLSIWLKKNTKLLEHRKEYSIKFL--
Kpol_1037.25             LI-------LLDQISFLEICTIHMSDNFNDLIKNDIPEWHSVHFILSNLKKQYKRDF---
KAFR0L00400              NI-------LISNFQILENSIDNTLHFLKVFQNEKIRKWWKLNNELINLTKLAS------
KLLA0D01133g             YE-------FTRNLEYLEHSVVTLLNNFESLL-AKTTLWWKHFGELMELKKEWKKNFP--
CAGL0L07634g             AE-----KALLSKITYLKICAQKLHNHILSITTTMISNWWHIYGELLNAHKHYTRAFP--
NDAI0D00800              LL-----ESLHEDISFFNECTLKLIHDVENIIKIKIPNWWKLYGELLELNKYYHKNFPNC
NCAS0H00820              NN-----TLIRDELDFLKACTLILTGNIEDILRTQIPNWWKLYGELLELNKHYNKLFP--
KLTH0C11242g             EF-----GYLANNTALLELSSRLLVQKIDKILNHDIPHWWKTYGELVSLRHEYNKNFP--
Kwal_56.22424            EG-------IANNIALCELCSSLLCKHIGQVLNDDIPKWWHTYGELLSLRREYKKSFP--
Smik_13.157              SL-----AKLLEHVRFLEECTIQLSNLVQLILLEKIPNWWKHYGELITLHKNYRKAFP--
Suva_13.160              SL-----DELLEHVQFLEECTIQLFNSIQTILFDRIPNWWKHYGEFLTLHKNYRKAFP--
Skud_13.152              AL-----AELLEHVSFLEQCTIQLSTFVQTILFDKITKWWKHYGEFLALQKNYRKAFP--
YML002W                  SL-----AALLENVRFLEQCTIQLSSFVQIILFEKIPNWWKHYGEFLALHKSYRKAFP--
ZYRO0C07810g             T--------FVREIAFLENCTGKLLDRVEQLLSVDIPEWWKLYGDVLEMHKVYKQKFP--
TDEL0G04490              IL-------LVEDIDLMLKCTIRLYDHINNLLQVKIPEWWKLYGELLNFRKQYAQNFP--
Sklu_YGOB_Anc_6.20b      SA-----TILTSNIDFLKECTNKLVGKIDQLLQGKLTRWWKLYAELLDARNQYNKNFP--
ACR006C                  DP-------FEQAVDFMCMCLDSLTSKIVEVLDSKVSTWWTLYGEITNLQKEYQRNFP--
Ecym_3024                DS-------FQQAIEFIAMCLETLSSKIQYVLDSKVTLWWRLYGELSSLRREYQRNFP--
                                  :                 .  .       *      .              

TBLA0A07260              -------------------------------NRKIDINNNFESFNTMFDKRVNFDSITHF
KNAG0M01160              -------------------RESDHKQTPNASNNVGTSTTDHTSGMGVLGTFIE-GKRIKN
TPHA0J00330              -------------------------------QSNEETGNLSENTSVFRYAWNV-TYRKEE
Kpol_1037.25             -------------------------------SDFDSRN---GLNENILSRYTK-NKREAA
KAFR0L00400              -----------------------------------------NSDDDLLRSFFN-RK----
KLLA0D01133g             -------------------------------NDKAPPS---SANRNFIDTYIE-GKRSKF
CAGL0L07634g             -------------------------------ELANVTT---ENRDLALHRMISNPKRIKL
NDAI0D00800              VVHARRTDLLSGNNANTNTNTNTNTNTNSPQRLHHHSEHQNNSNNGVFANLIE-NQKNKL
NCAS0H00820              --------------------PNHYNNTLATDNQHSAEVSNDVNNGGVFGGLIE-NQRNKA
KLTH0C11242g             -------------------------------DDVRPRV---AENTGFISSYIE-TKRVRL
Kwal_56.22424            -------------------------------DANRPHV---SENSGLFGSYIE-TKRTKL
Smik_13.157              -------------------------------SVVKPKSTTDTSGHIQLGGFIE-TKREQS
Suva_13.160              -------------------------------SAVKPKSTAGTSSHIPLGGFIE-TKREQS
Skud_13.152              -------------------------------SVVKPKSATDTPSHIPLGSFIE-TKREQS
YML002W                  -------------------------------NMVKPKSASDTSSRAPLGGFIE-TKREQS
ZYRO0C07810g             -------------------------------NISRN-----DSGTGIIASFFE-GKREKM
TDEL0G04490              -------------------------------HLVKNGET--STDAGIIGKILE-GKKEKL
Sklu_YGOB_Anc_6.20b      -------------------------------NSVKPHL---DDNKGLFGTYVE-GKRSKL
ACR006C                  -------------------------------EKGKPNSASSEDSKGFFVSYME-DKRQKL
Ecym_3024                -------------------------------SDFKSSDVSGEESKGFFESYIE-GKRQKT
                                                                                     

TBLA0A07260              ERNIILNIKNTSTLLRRFNNKIKFLHENLAIELNNFMNFKNKFIREYIIKFSTIEVIKIL
KNAG0M01160              QERTRAAISDLQRRLKLLDNEIDTNNTLVVIEYCIFINFQSKFIHSAMLEKWVKLNINLL
TPHA0J00330              ERRLKFAMLELERDLKKLGTEIRVKHEELAEEFSDYVRMKSKFNSNLLVRKFVSLNLAHL
Kpol_1037.25             EKRISEEIIENTTLFDKVTAHIWYAHENLAEEFNKFLTFKSRFFKDVILNMIIPSAIATL
KAFR0L00400              -EKLSIEIDDKIRSINELNCDIFVSHELLAVEINNFMKFKPLFITRTLV-------VWAH
KLLA0D01133g             RNKLSNQLKMSSLNLKKIGGEIKTTHESIAVGINLFIEFKEQFYHDHIVKSIVDQRIREN
CAGL0L07634g             EERLSEKIKDITEQLNSVGHDIKQMHELAAEEVSRFIDLKTKFTLEYALQSYLTISKQEH
NDAI0D00800              ERKTSHHIDETISLLESLGSGLLNKHEHLAEELNRYMEFKNRFFGRNIMKNFVGEDIKLL
NCAS0H00820              VKKLKTDIDQLKYSLEILGNEIFRKHEMLAEELNKYMEFKGVFFKKAIIRNWRRGDLEAV
KLTH0C11242g             EQGLVGRINRSSKNLLRFSLMLRRSNESLAVELNNFINFKAEFWVSATIKEHAAMNIKWL
Kwal_56.22424            EQSYAARINHTSVRLSEISTKINQDNERLAVELNNFINFKNEFLKSA-IKEHADTNIKRL
Smik_13.157              EQRLAVQIKVSSKSLKELGSEIFVAHEKLAEELSNYMEFRKACLNQRNIVAFAATNISVL
Suva_13.160              EQRLSVQIKASSKILKELGSEIFSAHENLAEELSNYMEFRKACLDQRTIVAFAIKNISVL
Skud_13.152              EQRLAVQIKASSKILKELGSEIFTAHEKLAEELSNYMEFRKACLDQRTIVAFATTNIGIF
YML002W                  EQRLAVQIKASSKMLKELGSEIFVAHERLAEELSNYMEFRKACLDQRSLVAFATTNISVL
ZYRO0C07810g             ESKLSSDLADCKKRMRRVGDRISSTHEILAEELSKYMEFKSNFFINGILRRAVRENINIL
TDEL0G04490              EKRLSFSIAETRRSMNQAGAIIAHDHESLAEQLSKFMEFKGAYICRGVIKRWVRENIKEL
Sklu_YGOB_Anc_6.20b      EEKLSAQIKSCLERLQTLTYEVKQEHEALAEELSIYLEFKTNYLRTGIIQDFTVGKINTL
ACR006C                  ESKLQSRLSVCSENLQHLDAELKHCHELLAEEISFFISSKNFAYMNFMVKAYVNRRIKQH
Ecym_3024                EDKLQARLRVCITKLQTLSGELKKDHENLAEEISFFVTFKNFAYESFVMKTYANICIKHH
                                :      :      :   :   .     ::  .        :           

TBLA0A07260              KDNIIYMDSIIARFQIATDYMKKN------
KNAG0M01160              KKSLLDSKEKRIRKEAVRSKASDNS-----
TPHA0J00330              KEQSNLVQRIAMKLNTK-------------
Kpol_1037.25             KDQVLNIENIHNKQFENN------------
KAFR0L00400              RNCL--------------------------
KLLA0D01133g             KQIMQQLIDTMKGHV---------------
CAGL0L07634g             IEKDRLHWEFQENKTVFKQ-----------
NDAI0D00800              EEHVLVLNENMNKNNEMFLTS---------
NCAS0H00820              NDDLITFTEKTCSILRDLGIPL--------
KLTH0C11242g             QEQLVCLEEALYDYKDKFASKPVNTLHIIP
Kwal_56.22424            REQLVCSEEALYDYKHKIRHVTYK------
Smik_13.157              QENI--------------------------
Suva_13.160              QECI--------------------------
Skud_13.152              QEYI--------------------------
YML002W                  QECV--------------------------
ZYRO0C07810g             KGRLVEMRKRALYRSRKGENNI--------
TDEL0G04490              KERLIHIQRDLRNISGQKLRS---------
Sklu_YGOB_Anc_6.20b      KDTMRHFKRSLKNYKEQGYT----------
ACR006C                  KNMLLAIEEFIST-----------------
Ecym_3024                RNILQVIEEFRKYNSTKAKN----------
                                                       

FASTA FORMAT for MUSCLE Version 3.6

>TBLA0A07260
-------MDADI-LNPL--IEVLFHSEGTDTLNGPLKKLFEKL-KLLKFVLLAPPTDILL
NYLDSSNITPRNPYNGSNAKPLEDLCMNSYDFIASHILLYDSKV--------IKND----
----QCVMESINGKTITIKRVTGNGALNNGEMLVITPSKNYNTPKKMLKIIKMDLWHNFN
SYLQGM-ENYPIWYIDYPL--YPNIIK-NEFLTAFDRKLIETEQ--YSDIAQP-VNDLEN
T---TKDQNHKIRNISKLE--PDISQSDRGGFTKLIKDDRVIWQPLINSYRATTKHIEQA
EGLPQAIDENQTDV-NIEMVRDINCDLFEQLKDEKRY---NFLSHDNLMELIYEFIEIKL
HDDIWGRISFKF-------TESDFDFSKLSNISVNKLLLNFYSTNNFKNFKLHDIVMMEK
KISRAVTYFQKFINGITFQEKSTALIKTLQILTIN-------------------KLTDAD
TLIGLLSIVICRLKVR--NLKSHLFYLQNFAADPNTIKFGILGYSISTLEAITYYFDHI-
-SHSHKADLIAFCDKLHNLYDTI-----------LNNIKSLDNDILSYRSQNGESLLSLC
IINNKMDIFLELL--TTYEHSFPIEDILDDSDLNGSSLLMQACKYNNYVASEILVTILKN
SC-NEEELRIFLNKTDKFNRSVAHYFNMKNSILILTEFGNLIDWELKDI-KKLTPLLTIF
KVHKVN--YNESFIKILFRVVLTWYK-IHNKPFNLKAHVDQNGNNLLHVMKDYINCLIEN
PELCET-ININANNNKGLSPFMVYFKTNRYDNIRIIL----KNPTLITSEGQ-LPFLITS
TNLY-NSKVNHLLATHFLRT-LDFAYICLHSLR-FNDPSSSTSGTSLAWLVDISIL---E
KESEFPTSHPSICRTKTLKLKTIKSLLHHFI--RKYKYSSLPLKSALEFCNDLIKSNNSI
SWTSNRHFLPLSLLIDKLEIQYNLKLISNCLNFLFITTD--FDFTLLFDELKLQAFLKIN
NKKLKESNSSNKFSHKNNSDQTTELSKAYQPEDINAIQTFIKFNLGELENFKNTITTIKD
VSILIKYKIMDLNSSQFFFQKNTLKIGINNLSEILKYYSTQKPLITNAYTSRKFYDYNSY
DYKVEFLNKLLENLIFFEKLVCKLYYDFEDLSNGTIKTWWYHYGRLLDYEAQYNKHYP--
-------------------------------NRKIDINNNFESFNTMFDKRVNFDSITHF
ERNIILNIKNTSTLLRRFNNKIKFLHENLAIELNNFMNFKNKFIREYIIKFSTIEVIKIL
KDNIIYMDSIIARFQIATDYMKKN------
>KNAG0M01160
--------MPEL-LNPL--VDAVFNCQ--DVEASPLRKVYSSL-HDIPFILLVPPTFALW
YYDDR-----------NTKFPLHELCH-SPEFVSSHILTRYSGKDNKPIDTDLSRLRAVR
E---AKF-CTFNGKIINGLFSKQ---------SLYTTD--GFSFRSTRRILKYETLDHFQ
NYLQGS-STFILIYIDQPLIDTNRLLK-CEDLDCFPNLTINTTP----STRSL-ANLSSA
E---VPPQRNPLLNSM-IH--AQYNWK----FRAVF----QNYRKEI-------------
---------TQSESMLIPGFRKTIDKIYDGL--DNSF---HTI--PTIRQLIQEYVEQNV
YDDVWQVLINRNNAE-GEKEKQSESSDIFRFISLDQLD-TDFYKAKFSKFYLKDIVQLEK
NISKATKSFENLSVTHTYVEKCRVLVETLQILSKPVKRVGGYQ-----------VPITAD
TLVSLFILLIKRTKMK--NIRCHLYYLQNFHQDENSIKFGLLGYAISTLEAVICYLETIE
TDKERLDCIEKNDANLEEFLTLLTRSKC--VSNEGLDLSKYSH-NFRYRNGDGNSTLSLC
IINFKNDIFFELL-SENYESYFAFEDLLEDQTTEGTTLLMQSLQHSNHEITEYLTDIMLK
NS-TEEELYYYCGKRDKYKRNIGHY--ICGQQTLLQKIGKYIKWDSKDC-TGQTPLCVIF
RSYDQA--FYDVMVETSFAIAVEWYSTVKNSKFCFRDHTDSKGNTLLHIIKCNISFLLQS
PD-----VDINKVNSQGLSPLTNNAMYDRGENVEALL----KDPRLIFSSFD----FLKQ
YPNTKSAPILS---HYCLDNEAPFRNIIASHFD-FRI--SNK------RSVVLTSRSKED
AQELI--------GSEAFELKNLKALFRLLL--KQHPFTFFPLEELLDELSVVEKTASS-
--------RS---LMKSSFCSKVLKKLTYCLDSMVEMEL--LPTAALQSVALLERHIAKE
KVTVDEE-----------KLKRRSKDKKMQPESIGTITTFLKYILESLLKLKGTIIELRK
FSILSKLKSKDISESKNIVCTLGA----EVSSKKI-------GRAMVRYSTIDNKFLGEQ
SF-----DLLVFQIHFFESCLSSIINSIDHLLHLKIPEWWKCYGQLLELSKEDPSVLA--
-------------------RESDHKQTPNASNNVGTSTTDHTSGMGVLGTFIE-GKRIKN
QERTRAAISDLQRRLKLLDNEIDTNNTLVVIEYCIFINFQSKFIHSAMLEKWVKLNINLL
KKSLLDSKEKRIRKEAVRSKASDNS-----
>TPHA0J00330
----MAYFMPVL-KNPL--INAVFNCP--DPHASPFKKLYNEL-RDKDFLLLVPNDFILL
YYKDS-----------TSNISFRELCY-TYDFVAAHILILDKNSSTDKISSSNQKNG---
----DVYLKSLNGKEVLLRQS-----------LCIPIK--GYFSKRKSQMRDATLLTNFN
DYLHGS-GHFGIMHIDYPL-GVSDWTL-IDELKG-----FEESRELPFHSQDKDKPGLLQ
RTEENKADRVKFIQLFQER--KDWTIE----LEKYL----KKYQAME-------------
---------PLQNI-GSELFHDIVNMIYNTLKEEQRF---QRF--TNLYDIAYEYIESLL
YQDIWNKLQEHYRDK-------ILDFRLVSQLSLDMLD-TTFYNRTFKNFQLIDIVNMEA
CMVQAVSVFKGIKSANSYSKKVDVIFKTLNIITGKNSDDTIRDNTLPKL-----PLIDAD
TLVSLFALLLCRAGVE--DVFLHVQYLQSFYKDENTVKFGALGYTLSTIEATLSYFYELS
NSDESRIQLQKLSLLED-FLIKI-RSQH--DD--LIPINQFKD-YFRYRTQYGESILSLL
IANKKNEALCEAL--LNFEDIFPLDDLLYDTDVSGSTLLIKCLKERNLEAAEILIEIFQN
SC-TNSELLNYYNKTDKTKRTLAHY--ITDEIEILEKIGKYINWTLKDL-KGRTALFTIF
RSYDQT--TYSSTIKIALDQALLWYK-NNDIIFKVSDHTDLFGDSLLHILKSQVSLLLKF
ED-----LDINIPNLKGMTPLMTYVKYNRIDNIKTIL----EDGRLIIKKLQ-KDKYLNC
LDYGKNFTVFNLLAAKLSKD-VIFENAYISYAR-YEK--SH-------WYLCISVQ---K
DDLEY--------TTNIIKLKKYYNLINAMQ--KIYKSDFIPYSDMLDCLKKIIEGHN--
--------IL---PIRRLKIKNYLNFLSHGLSALLYFEK--IDPLTLLDENLIIKWISSK
LQQQEKS------------IDDHSSFKPLSAEDINNIKAFCDFSFQEIGKTNNVIQSFLK
LSIFGEIKNTDLNTSYDILERLGSYFSNNEI-----------SRTLGDLQSISPHVHSSM
VY-----YELSQDILFMKKCTLILTSKLASFIKDKLSIWLKKNTKLLEHRKEYSIKFL--
-------------------------------QSNEETGNLSENTSVFRYAWNV-TYRKEE
ERRLKFAMLELERDLKKLGTEIRVKHEELAEEFSDYVRMKSKFNSNLLVRKFVSLNLAHL
KEQSNLVQRIAMKLNTK-------------
>Kpol_1037.25
-MGELSYHMPVL-LNPL--INAVFNCP--DPINSPLRKLFERI-KYKNFMLIVPPNEILL
HYRDP-----------EKGLTLKELCY-EFEFVASHIILDTDNSSNNLQVKGKNSNETLD
----NRY-KSLNNNQLLIKNNNI---------IPLDFN--NSTQKKKYKIIDIKILPNFN
EYLSGS-EKYTIIYTDYPF--SNSWLPKIEIESFYISKKESNNIKAAQITNHK-SPLSQD
L---AQKTKSSFRHIINIH--KEWNNI----FDSYI----IDFKNKQ-------------
---------LNLTS-LPIYFREIVDKAYQKMKFEEIF---LSF-HNDLYNLIFEYLESSF
YNSIWDHIDRNMIDN-QF-LHTEM----MDFLSIDQLE-LELYNQNFQKFNLVNVIKVER
CVKDATDQFKKIIDSKSHSEKCQILIDALQKLTSYDDVHYEP------------LMVDAD
TLMNLFLLVICRSKVP--FLRNHLYYLQNFSTDENNVKFGLLGYGISTFEATLCYLKDF-
QAGEKFNKQVLNCIRNKELISKI-SSEA--DHSTF-QVKLYKD-CFKFRNEMGESILALC
IKHKKNETLFEIL--LNFEDMFPLEDILDDEDIEGTTLLMKALKVENEVGAKLIVDVLQS
SC-SEDELIKYFNRTDNNQRIAAHY--ITNQIDVLKRIGLFFNWKIKDD-KGYTPLTTIC
RTYDQE--CYEQMIETAFFEAQKWYE-NRNQKLNFKDHNDSKENTLLHILKCDIQVLLKY
DN-----ININAHNLKYITPLMTYVKYNRVSNIQEII----RDERLILGKYQ-KHTFLDC
YDFVKNTIIFEDLGVRSVRN-SMFNLFSAYSLR-VEN--SN-------WVLYFTFK--DT
NQDSY--------ITKSVSLKILFNIIKKYN--KLYPLHFIPHKEVLLRLTGIVKNN---
-------PNN---GIQKLKNRAFLNLISNYFGTLIETDD--FDTELFKNPESLTKWIKAG
KRKHKKE----------------NYYKRMTLDDINMIKSFVQFNINELGKLNRTLAILKK
LCTFLALKINDVNESYKLFRNFGALLQQKDISN---------QMKKIDGLIKPKYFQSIF
LI-------LLDQISFLEICTIHMSDNFNDLIKNDIPEWHSVHFILSNLKKQYKRDF---
-------------------------------SDFDSRN---GLNENILSRYTK-NKREAA
EKRISEEIIENTTLFDKVTAHIWYAHENLAEEFNKFLTFKSRFFKDVILNMIIPSAIATL
KDQVLNIENIHNKQFENN------------
>KAFR0L00400
---MSQYESEIARYGPFQSIAAVFERL--DSEKVTTKESFIVL-----------------
-------------------ISLESMGY--------NIFIKEND-----------------
----STY-RSVDGKLQEVRVRHN---------LVKWKN-------QTFQINESDLL----
-LLEDK-RQCLVLWINDVK--AADAID----------------------TDGG-KPSLVG
G-------------LFHRHQSQDFSAD----MSGLI----NDWIRFV-------------
---------SDPQK-SITDVVFGINNVIKSLPDENSV---KIF-------------EARL
YSSIWNKLVHQTSEP-QN-IDKFYGC----YISFHELNINDYYSLPFNKFSLRDVVFIEN
VVDLACKEFVKLRESLSFDEKIDILLSTFNILTSK----------------LPQLEIDAD
NLLNFMLIIINRVKLN--NLNEHFHYLQNFNFKQNK-DFGILNYAISTLGAVLYYID---
NNLDKFKRYTDAIQDSKI----------------------SEE-KLKYRNENGESYLCHC
IITKDNDTLRELLFSSEYIKNFPMEDILDDQTIDGSTLLMVAVKCLNTTAASILINIIIN
NG-TPDEIRTYVNSVDENNRNVGHF--ITNQYYLLCKIGPYLNWNCKDKRTGQTPLFNIF
RSYDQSIKSYKKMSRRSFR-----FA-MDSGDFQLKKHIDNSNNTLLHILKTNIQMILPH
AS-----LFINSPNSLGMTPLMVFCKYRRLYNIQILLSSKFKDRVSIFETQQVHNAWSNC
FSLTNDDQILNLLGKFAIKNYSIFGNCFTHSLKQFLH--KSKHGNKNQYSVKITLK----
FEKKY--------KTIRFNIKTIKALINMVLTSNSHVSSFLPLYKVFNELNGIAS-----
-------------MISTKSKILFINNLNVILDTILFLEL--VPREGFILEARLKDYLRNQ
RKIKTVA----------------TKSKKLQIEDINMISNFLKFNLNELNAFKNGVKKILR
QMNSINLKLFDQRISYMDLL----------------------HCPDVVVHLNNPLWNLNY
NI-------LISNFQILENSIDNTLHFLKVFQNEKIRKWWKLNNELINLTKLAS------
-----------------------------------------NSDDDLLRSFFN-RK----
-EKLSIEIDDKIRSINELNCDIFVSHELLAVEINNFMKFKPLFITRTLV-------VWAH
RNCL--------------------------
>KLLA0D01133g
----MPYHLPVL-LNPL--LNAIFNCP--SPKTSSLKQMFSRL-DDERFFILVPSTETLL
QFQDL-----------ESGLELAELCY-HYDFVASHIVVIKDPTKDVPDQRSIYN-----
----TDF-TTLNGRKLSIRYRNS---------TIVTGD--GFTERRKITIKEINLLPTFN
DYLKGS-NYTPILHISMPL--CGDLVP-LDELQV-----FSKVAGNKYSKQEQ-APLPFD
E---EQKKVLYFEQRIQSI--SDVAER----VALTFHLTKARIKKAI-------------
---------SVIGI-RTE-WLNTRDSIRQIISLDKRL---NHL--EDLDAMIYDYVELKL
FTDIQQQLSEIVEDQ-E--LEHRFDFKALRSISLNQVP-TNFYPKDEKSFSLASVVELEK
SVNDALEYLKSIDLKTTHSGKLEVLSTTMRLLSRE----------------INGISTDAD
TLLSLFVLLICRSQVT--GLVRTLTYLTNFEISETSIKFGLQGYVLSTFEAALSFF----
-HQDTVDSLTKKCASNKKIWASI-QKHS--KV----EAELLSS-NLRIRTDSGESLLSIC
IQSHNNEVLTTLL--ANFESEFPLEDILDDRDFALSTLLIQALQVQNSQAAAILSEIILK
SC-TESEVRSYLNSPNLHNRITAHY--IMQDISLLESVGRYFNWEHKDI-NGHTPLFAVF
RSYDAV--NYDEIVTKVLDQVVKWYA-NNNKPFNFKIHEDPKGNTLLHVMKSGIESLLKL
PD-----VNVNKPDSKGLTPLMIYSRYNRITNIETIM----KDERLLCDLVQ-QPLVMTS
LDFTKNPKVTKTILDATFNR----EPVVIHSLR-FEE--RK-------WKIGI------F
SEGIF----------KKYSLDLIQYYLRYLK--IMYPCSFHPVQLLTNELRLLGIYG---
--------VP---GVLRLQSYHTFKKLDMLFSYVNTRGK----LWLGKDEEELKVLLDVP
TPYLSES----------------ERFIKLEPEEINGIQTFLKYNLAEFQKLRNCLIILKK
LAIVQQIKHRDVITMRNSFL---S--LGNQMSQKG-------VAKSFENTNCAWSYDLSY
YE-------FTRNLEYLEHSVVTLLNNFESLL-AKTTLWWKHFGELMELKKEWKKNFP--
-------------------------------NDKAPPS---SANRNFIDTYIE-GKRSKF
RNKLSNQLKMSSLNLKKIGGEIKTTHESIAVGINLFIEFKEQFYHDHIVKSIVDQRIREN
KQIMQQLIDTMKGHV---------------
>CAGL0L07634g
MTTHSNFQLPPL-LNPL--LNAICNCG--EPNSSPLKKLYTQLGKKDKYLILVPPTELLL
YYSDK-----------ESNSELHDLCY-TPNFASAHILLLDATDTEVNNGDEAVLIKNIE
KRYDVHFIKAMDQSWKFINWKNR---------VIYEFNKLGDQIKNRAKILDIESIPIFN
NYMKTTDNTITIMYIDDVF--LNGTLE-CNLRSDIDLLRSPSMRSIPTAKRPS-LINKKS
TDYENSKSKATFDSILRVN--KHWSSK----FEQHF----QKFRLLA-------------
---------NQDDL-PIDVFHNIIEEMHEEMVSDNLF---KNI--VDLRNIIYEYVELNL
FDDIWKMILRMNKEV-E--IDLNP----FGNISIYQVD-SEFLSTEYSKFFLENVITAER
NIKEASKSLQKIESASNYKSKANILILTLRTLTGNKENDGYSSKNDDGNLSFFPLAIDAD
RLMNLFVLVTCRAQIK--NLKCHLSYLQNFYNNDSDTKFGILGYALSTLEAVVCYFEQL-
KEKENYRKLIDFCNSNERLVKVLSSTKKYETNAALYFLRKYEG-SLRYRDSLGQSLLALC
IIHGRNDFLYHIL--NEYETLFPIEDLLADESIDGSTLLIQAVKHDNQYSASLLLNILKD
NC-TEIELIAYINRHDINKRTAGHF--LTNELEVLKLMGKYINWVQKDN-AGQTPLFTIF
RSYDQD--NYDEMVSQSMEYATNWYG-LNGKNFNYLDHVDKKGNTLLHILKCNLPILLAD
KH-----INVNATNRSGQTPLMTSIRYKRTENIRDLL----CDPRLRVDITQ-KNNALTA
FDFSKDDEITHLLGEHELLN-SPWLAVYAHTLK-YTN--SR-------WNLSLTVK---L
KDAP---------KTTNFTLKTLRGILRVVI--KNNMTVFLPVQELVEDLISFNRIR---
--------FS---ELMRIKVLEMLPFISFCLSALVHIKV--LDLNVFQTEENAIKWVKMN
GSVDKKT----------------NQTSDITPEDISMIQNFLKFNITEIERTKNKLEIAEK
LSLFSRLKSKDLLNSNENYVTIVS-----QLSSKR-------FRSTLKYSAEDTKLLSVR
AE-----KALLSKITYLKICAQKLHNHILSITTTMISNWWHIYGELLNAHKHYTRAFP--
-------------------------------ELANVTT---ENRDLALHRMISNPKRIKL
EERLSEKIKDITEQLNSVGHDIKQMHELAAEEVSRFIDLKTKFTLEYALQSYLTISKQEH
IEKDRLHWEFQENKTVFKQ-----------
>NDAI0D00800
---MSQYHLPTL-LNPL--LNAVFNCP--DPSHSPFKKLFTTL-KNQQFILLVPPTSTLL
NYTDS-----------YYKLSLNELCYHNSDFLGSHILTWSNAIDSNKDSTTTNDD----
----EEF-DNLNGNKFIIKWKHN---------IIFTRG--NFSNDQRFKILKIHPLTNFN
DYFHGS-KEFFLIFIDKPI--TVSSLIANDSLKC-----LLPNTRDLKSQEKE-TPLVQD
L---SQQSKSSFENDLNKN--EAWNLK----FGILS----NNYKIES-------------
---------SELEP-NHKLFRELVNEAFIEIDSKKFFQKKKNFTSDQLFQLTHDYMERHL
YDEIWSRIWKMMMNSVKNYADDQKAQHLIKHFSIVEID-PNFY----DIFPLKFVPMLEK
NLKHSVTCINKLKSTKSYTEKSTILIESLQIITDSNTGGEESKDKN-----KSGYLIDAD
NLLNLLTLVILQSNITLHDLKANLYYLKYFSTDESSSSFGILNYTIATFHMVSHVL----
ENVIDWDRLKEKSDLIEELI----MTDD--LSTLSSTFENDKKTLLMYRNSNGESLLALS
IINKQNKKFTQYL--IEYEDILNMDIISNDQSMDSSTLLLQAIRSNNFEAAIILVKLLFQ
NCRNQKELISYINQVDIHNRNIGHY--LVINLTILKIIGQFINWKQKDV-NGRTPLFTIF
RSYDQS--NYDELVCQVFQIAIKWYA-ANNLKFQMNDHDDSNGNSLLHILQNNISILLDY
AKDQNIPINLNKMNCKGFTPLMMYFKYKRYDNIRMII----KEEKLIFNKFQ-SPNFIDC
FDYSVDSSIMNDIGEFLLSNGQLFGKIIVLSLK-KQM--STVPSLPRGLYINYTIL-IDE
ADKST--------LTKTMKFTSLVKFLKIMK--RKYAISFLPLDTLLNESQSFLDKKSKN
NNNLRTIPLR---YIEKLRIRRFLKRLNTCLDVLLHFDDSTIATPLLLSETELLEWISIE
ESKLRRSSTTPSAKSKLENAMGEKKKKELKPENINIIQNFLKFNLNELNTISMNLKVLSK
LVIFMNLKTLDIHDAQIRFNGLVKGLNNKEVPSII-------EKSFNVIDSSRYDDDKGV
LL-----ESLHEDISFFNECTLKLIHDVENIIKIKIPNWWKLYGELLELNKYYHKNFPNC
VVHARRTDLLSGNNANTNTNTNTNTNTNSPQRLHHHSEHQNNSNNGVFANLIE-NQKNKL
ERKTSHHIDETISLLESLGSGLLNKHEHLAEELNRYMEFKNRFFGRNIMKNFVGEDIKLL
EEHVLVLNENMNKNNEMFLTS---------
>NCAS0H00820
---MEQYHLPTL-LNPL--LNSIFNCP--NPSNSPLKKLYASL-KDKSFILLVPPTETLL
NYTDT-----------KTKIQLEDLCYHNVDFIGAHILLPPKDS--ISSSSSTIDDGYTR
LASIEQF-DTLNGDNILVKWRNN---------FLVLLS--GSPNRQKIKIERIQVLPNFN
DYLQGS-TYFILVHIDKPL--MKDVIRLNDELECFDTLTLHDND--GDSSPDA-RPLIQD
M---SQHERSQFENIINTN--DTWNKR----FKDWM----NEYKDST-------------
---------TAEEP-NETLFKQIVAVAYNELKSNKIF---KGF--GHLRRLIHEYLEINL
YDHLWLQITTLCA------LDDETKGTRIKNISIEEID-DKFY----EMFPLDFITKLEK
NMVRSTNSINKLNGKNSFNEKSENLIATLQILTNMDNPIGELNQENEK---GANNLIDAD
TLINLLILIICRSEINIVDLKRNIFYLKKFNYDENLINFGILSYTISTFEIVIYSF----
ENIVEYDKLKSYSE----IIEKL-IKVD--DLKKVPKTIKWEQ-FLTFRSDTGESILFSC
ITNNQTEKFLDLL--VDYEEIFSMDNILDDANVEGTTLLMQALIYRNFKISMVLINLLLR
NC-SNKQIMEYINKIDKFNRNVGHY--LINELEILKIIGKYVNWKQRDL-VGRTPLFTIF
RGYDQP--NYDEVISTVFDITLNWYA-ENGLKFQMSDHYDLKDNSILHILRSNIDILFTY
SKRNHFEIDINKRNYKGFTPLMIYVKYHRLSNVKLIL----GDDRLLFNRYQ-RELYTTC
FDYATDSTISNELGKHALQNNTVFGRIYIHSLKVRSS--TN-------ATFSLTFP-LPD
KENET--------GTVNIKVKAIISLLKVIR--KKSQISLLPLDRIIKVLVKLTSKENNK
II------VR---KIEMLRNQSLLRRLTDCLDTLLFFDIGIDYLSLITDETKLLGWVTNE
NTKLKHN-----------VNKTHGEKKSLKPEDINIIQSFLKFNVKELYNVLLNVKTLEK
LLNFIHLKSIDVKESRLAFVHLVKSIKNDQIAQAT-------NRSLEPIIEMQSLENQYY
NN-----TLIRDELDFLKACTLILTGNIEDILRTQIPNWWKLYGELLELNKHYNKLFP--
--------------------PNHYNNTLATDNQHSAEVSNDVNNGGVFGGLIE-NQRNKA
VKKLKTDIDQLKYSLEILGNEIFRKHEMLAEELNKYMEFKGVFFKKAIIRNWRRGDLEAV
NDDLITFTEKTCSILRDLGIPL--------
>KLTH0C11242g
----MPYYLPVL-LNPL--INAVFNCP--TPQNSPLRKVFTRI-EKQRFALVTPTPEILL
EYEDL-----------ESGSSLQDLCY-SASFVSDHILLLGGGG--------CSHE----
----EEY-KTLSGKTITLRNQQK---------ALFTGE--GFDARRRCQVLETELLSNFN
EYFQGS-STYPIIHVDFPL--TGRLAR-RDEWPG-----FKAYR-FASTDTTS-ANSSLA
A---STEPKASLEQMLRAH--PSYGDK----LSAIIRTQRAALSSST-------------
---------YNADN-LAAHFMQTCEKALAAIQEDQSF---RAF--PNLRLQIHEYVEMNL
YDDFWAQLTNSLKDS-E--IENQSDFSILRNISISQVP-SFLYPTDRQKFDIRCVTQVEK
NLREAVECLRRLPVTNSHSSKAKVIVETLQTVSRSLEINDKV------------ISVDAD
TLVSLLVVVVCQAEVK--DLKSHLFYLQEFAKDSNSITFGILAYGMSTLEAVLSYF----
ESREKLKLLEKHCSSNASYWEAL-ADGK--LPLGSLNPSEVKD-ILRTRTPAGLSCLSIC
LQNRQPNLFLHLA--TKFEHCFPLEDLLNDETVEGSNLLIQMLDNGCSSLSGNFIEMLFR
SC-TKTELESFLNHVNRYQRSSGHY--LMHALDLIVKVGKFINWEQRDC-NGHTPLFAII
RTYDHT--DYDAMVLEAYKSARLWCT-LKGKQFRLSKHQDNKGNTLLHVIKSNVSVVLDD
PL-----VNVNSFNKKGLTPIMVYARYNRLDNIKSIL----RDKRLIIQKCQ-NGSYLTC
FDYIKNPVVLGELGKHAFFL-PQSYQIRAHNIK-FEG--DE-------WVLWMTLV-GSV
PNAPA--------KVIQRSLKFIQSFLISFS--KTNSMTFIPAESLAEELSLLAKMK---
--------II---SINRLETKHFLRRASVVLSLICRQEE--FEHIFNNPSGSLVNAAEHV
QEQEANS-----------------TYGMIEPEEVASIQKIMKFNRTEILAIKSGALMLKK
LAIFGILKGKDLERSHTMFQ---S--HGNNFTKII-------GRSTNVFGSLKHSLPQC-
EF-----GYLANNTALLELSSRLLVQKIDKILNHDIPHWWKTYGELVSLRHEYNKNFP--
-------------------------------DDVRPRV---AENTGFISSYIE-TKRVRL
EQGLVGRINRSSKNLLRFSLMLRRSNESLAVELNNFINFKAEFWVSATIKEHAAMNIKWL
QEQLVCLEEALYDYKDKFASKPVNTLHIIP
>Kwal_56.22424
----MPYYLPVL-LNPL--INAVFNCP--TPLNSSLKKVFSAI-EKVRFVLIAPPTELLL
EYEDL-----------ESGLPLQDLCY-ATGFVSDHIVLLDGRE--------GLQE----
----EEY-KTLSGKTILLRSQQG---------IIFTAA--AFDTRRRCRIQRAELLTNFN
EYLKGD-TTFPIIHVDFPL--TGRLAR-RDEWQC-----FRVTK-NQEHTNGP-KNSGKL
S---HGDNNISLEQLLRIN--PEYGES----LNDIVKAQRISLNSSV-------------
---------TGTTH-LASHFVQTCKKALDVVRAYPAF---QVL--PNLPICVHEYIELNL
YDDYWAQLTNSLRDS-E--IESSSDYSLLKHISVSQVP-SFLYPSNPEKFDLRLITQAEK
NVKGAVESFRKIAVTNCHSAKAKVIIETLQTLSRSLLVDDRA------------VTIDAD
TLVSLFVVVVCHAQVK--DLRSHLFYLQEFTKDTNLVTFGILAYGMSTLEAVLCYF----
ESPEKVASLEKYCRANLSHWKSI-SEGS--IDLNADTTVPLDD-LLKIRTSDGQSCLAVC
LQHRRTEEFELIK--NTREAWFPLEDLLHDETTDGSNLLIHMLESGCDRLAVMLINTLIS
NC-TKDELIAFLNHTNKYQRSCGHY--LMHAPQLIDLVGDILNWEQRDC-NGHTPLFAIV
RAYDRP--DYFDMVSAAYRAAVGQSK-VRNSRFRVSNHTDDKGNTLLHVIKSDVSILLAD
PF-----IDVNATNAKGLTPLMVYVRYNRIGNVRTIL----QDQRLIIGKHQ-SGAYLSC
FDYVKNPAVLKELGKYASYL-PFEFSINVHSVK-REG--DE-------WVLWITVT-GGE
KQVPV--------KVFKRSLRFIQAFLTLFS--DAHPMTFVPVDELLRELRALSQSR---
--------IL---ILNKMDTKRFLKRCSVTLSMVSQERL--FADAFTDSNLNLSSSRGLG
SSESFTQ-----------------NMKMMEPEEVRSIQSILKFNLSEISALKTAMLLMKK
LAVFEGLKGKDLSEACMTFG---A--KCKYVTQGK-------IQSFDHFLNVQAPNLFDF
EG-------IANNIALCELCSSLLCKHIGQVLNDDIPKWWHTYGELLSLRREYKKSFP--
-------------------------------DANRPHV---SENSGLFGSYIE-TKRTKL
EQSYAARINHTSVRLSEISTKINQDNERLAVELNNFINFKNEFLKSA-IKEHADTNIKRL
REQLVCSEEALYDYKHKIRHVTYK------
>Smik_13.157
---MSISHLPTL-LNPL--INAIFNCP--EPEKSPLKKLFATL-KTCRFILLAPPSEYLL
NYHDV-----------KTKLPLHELCY-NAEFINSHILLMTENS----FINTNSRD----
----SHY-ETLDGKTVVIQWKNN---------VIHALN--GFQVRRRLKILGTKILPNFN
DYFEGA-TDFVIIYIEQPL--SCESVP-NDYLQC-----FHSYKKIPKSVYSV-HNLSLD
S---SQQERSSFENILHIH--PTRLTQ----LGEMF----SNYRTLA-------------
---------PSDDP-SEKIFECIVQQAFEGMKSDSLF---KKF--PNLYDLIHEYFELNL
YDDIWSRLTSHFKSY-E--VGTEE----YKYFSINHLL-ADFYSKDFREFKLQDVTFIEK
RVHLASKHFQKLTLTHSYTEKSKILVETLQELSGTTDMGSHQLDVPGR---LNNLAMDAD
TLISLFVLVICRSEQK--HLKSHLYYLQNFSNNSSSSKFGILGYAVSTLEAVVCYFEDFK
KNSDNMAKANVLLQKTKRLVNML-SCEN--VTNKVENLATYKD-ILPYRNGQGQSILSIC
ISNNKNHILLDIL--SEYDSIFPLEDLLEDETIDGSTLLIESIKSGNLEAAKILIRIMML
NC-TEEELISYINRTDKYSRTVAHY--LTHEIDILKSIGNYVDWKRKNS-GGQTPLFSIF
RSYDQP--NYEAMVKIAFNIANTWYR-KQNRSFDYRDHTDNKGNDLLHVLKTDASILLQL
TK-----LDINGENYKGLTPLMVYVKYKRLNNIEAII----KDQRLVLEKIQ-KSTFFTC
FDYAKDHTVLSKVGERGAKD-SLFGLIYFHSLR-YHN--LN-------AAVNITFA--SD
TEKPF--------SNTVINMKTIQGLLRSIL--KDNPFTFLPLNIYIDEISQLSRSD---
--------VT---IIGKADVMSLLHKLSNCFNVLLFLKK--VPKSLFTDEASILYWMRIN
TSKRNQK------------QPSKENYKTMEPEEINMIQSFLRFNFDEISSFKASLSILRK
ILIFISLKSNDFKDVNDNLN---E--MGKSIYNAK-------AADAFAGNLTNHNMFNDY
SL-----AKLLEHVRFLEECTIQLSNLVQLILLEKIPNWWKHYGELITLHKNYRKAFP--
-------------------------------SVVKPKSTTDTSGHIQLGGFIE-TKREQS
EQRLAVQIKVSSKSLKELGSEIFVAHEKLAEELSNYMEFRKACLNQRNIVAFAATNISVL
QENI--------------------------
>Suva_13.160
---MSIYHLPTL-LNPL--INAIFNCP--EPEKSPLKKLFANL-QTRRFILLAPPSHLLL
NYHDV-----------KTKLPLHELCY-NADFINSHILLTTENS----YINTTLRD----
----DHY-ETLDGKTVVVQWKNN---------VIHTLN--GFPLRRRLKILDTKILPNFN
DYFKGA-EYFAILYIDQPL--GCEFVP-NDYLHC-----FNSYEETSKTARNA-PNLLMD
T---SQLERSSFENILHIH--PAWLTQ----LGQLF----SNYRRAA-------------
---------LNDDP-SKKMFEELVEQAFDGMKSDSLF---KNF--SNLYDLIHDYFELNL
YEDIWSRLTIHFKGY-E--VNTEN----CEYFSVNQLL-TDYYSKDFESFKLSDITFIER
RVSVASKHFQKLALSHSYAEKSKILVETLQHLSGTTDMGSHKPDLSNG---FNNLTMDAD
TLISLFVLVVCRSEQK--HIRSHLYYLQNFSNNSSSSKFGILGYAISTLEAVVCYFENFN
KNNNNVAKANLLCIKTRDLLDKL-SCEN--PTNEVNDLATYKD-ILAYRNEQGQSILSLC
ITNNKNDILLDVL--SEYEALFPIEDILEDETIDGSTLLIESIKVGNLEATKILIRIMLF
NC-TDEELVTYVNKTDKYARSVAHY--LTHEMDILKSIGSYINWKQKNS-SGQTPLFSIF
RSYDQP--NYEEMVKVAFNIASSWYQ-RHNTSFGYSDHTDNKGNSLLHVLKTDVSILLQL
TK-----LNINGENYKGLTPLMVYVKYKRLSNIDAIT----KDHRLILEKVQ-NSTFFTC
FDYAKDRLVLSKIGERGAND-SIFGLIYLHSLR-YHN--LN-------ATVNVTSV--SK
TEEPF--------VTAVINMKTIQGLLRSIV--KDNPFTFLPIDNYIDGISHLNRSD---
--------LT---IIGKADVRSLLHKLTNCFNVLLFLKK--VPQNLFTDEASVLYWMRIN
TSRRNQK------------PPSKDNPKTMEPEEINMIQSFLRFNFDEILSFKASLNILRK
ILIFLSLKSSDFEDAYASLL---K--MGTKVTNGK-------AADAFTTIIKNHKMFSDL
SL-----DELLEHVQFLEECTIQLFNSIQTILFDRIPNWWKHYGEFLTLHKNYRKAFP--
-------------------------------SAVKPKSTAGTSSHIPLGGFIE-TKREQS
EQRLSVQIKASSKILKELGSEIFSAHENLAEELSNYMEFRKACLDQRTIVAFAIKNISVL
QECI--------------------------
>Skud_13.152
---MSVYHLPTL-LNPL--INAIFNCP--EPEKSPLKKLFANL-KTRRFILLAPPLRFLL
NYHDV-----------KTKLPLHELCY-NVDFINSHILLTTENS----YLNTTLRD----
----SHY-ETLDGKAVVIQWKNN---------IIHALN--GFPIRQRLKILETKVLPNFN
DYFEGA-ADFAILFIDQPL--NCEVAP-NDYLKC-----FDSYEEVPKNAQSV-SNLPVN
S---YEQERSSFDNILHIH--SARLAQ----LGQLF----SNYRRLA-------------
---------PNDDP-SKKMFEDIVQQSFDGMKSDSLF---KNF--SNLYDLIHDYFELNL
YDDIWSRLVTHFKGY-E--VDTEK----YKYFSVNQLL-ADFFSKDFKEFKLSDITFIER
RVNVASKHFQKLTLTHSYAEKSKILVETLQQLSGPTEISSHQQELPNG---LNSLTMDAD
TLLSLFVLVVCRSEQK--HLKSHLYYLQNFSNNPSSTKFGILGYAISTLEAVVCYFEDFD
KNNENLAKANVSYQKTRELLDKL-SSEN--PTNEIENLATYED-NLQYRNEQGQSILSIC
ITNTKNCILLDVL--TEYEDLFPMEDILEDETLDGSTLLIESIKTGNIEAAKILIGIMLL
NC-SEGELVSYVNKADKYARTVAHY--LTHEMDILKSIGSYVDWKRKNS-SGQTPLFSIF
RTYDQP--NYEEMVKIAFNIANSWYQ-KHNSSFDYLDHTDSKGNSLLHILKSDVSILLQL
SK-----LDINGRNYKGLTPLMIYVKYKRISNIDAIT----KDSRLILEKVQ-NSTFFTC
FDYAKDHSVLSKIGERGARD-SLFGLVYLHSLR-YHN--LN-------ATTNITTA--SN
TDKPF--------LTTVINMKTIQGLLRSIL--KDNQFTFLPLNSYIDEISHLNRSD---
--------LT---IIGKADVRSLLHKLTNCFNVLLFLKK--VPQNLFTDEASVLYWMRIN
TSKRNQK------------PPSKDNPKTMEPEEINMIQSFLRFNFDEISSFKASLNILRK
ILIFLSLKSNDFEDTYDSLR---E--MGRKIINGE-------AADAFARIFTNHNMFSDL
AL-----AELLEHVSFLEQCTIQLSTFVQTILFDKITKWWKHYGEFLALQKNYRKAFP--
-------------------------------SVVKPKSATDTPSHIPLGSFIE-TKREQS
EQRLAVQIKASSKILKELGSEIFTAHEKLAEELSNYMEFRKACLDQRTIVAFATTNIGIF
QEYI--------------------------
>YML002W
----MDSHQLEL--------------P---------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------DGLNN----------------------------------------------
------------------------------------------------------------
------------------------------------------------------MTMDAD
TLISLFVLVVCRSEQK--HLKSHLYYLQNFSNNSSSTKFGILGYAVSTLEAVVCYFEDFN
KNTGNVAKANTLCEKTKNLLDKL-SCEN--PTNEVEDLATYKD-ILTYRNEQGQSILSIC
ITNHKNYILLDIL--SEYENDFPVEDLLEDETIDGSTLLIESIKAGNLEAAKVLIKIMLF
NC-TEEELVSYINKTDKYARTVAHY--LTHEMDILKSIGNYIDWKRKNS-SGQTPLFSIF
RSYDQP--NYEEMVKTAFDIANTWYR-KHNSLFDYLDHTDNKGNSLLHVLKTNIPILLQL
TK-----LDINEENYKGLTPLMVYVKYKRLSNIDAIT----KDRRLILEKVQ-NSTFFTC
FDYAKDHSVLSKIGERGVKD-SLFGLIYFHSLR-YHN--LN-------ATTNITSV--SN
AEKPF--------ATTVINMKTIQGLLRSIL--KDNPFTFLPLNTYIDEISHLNRSD---
--------LT---IIGKTDVTSLLHQLTNCFNVLLFLKK--IPENLFTDEASILYWMRIN
TSKRNQK------------PSGKENPKTMEPEEINMIQSFLRFNFDEISSFKASLNILRK
VLIFINLKSDDFEDAYKGLN---E--MGRKLINSE-------ASSAFKGIITNHNMFSEL
SL-----AALLENVRFLEQCTIQLSSFVQIILFEKIPNWWKHYGEFLALHKSYRKAFP--
-------------------------------NMVKPKSASDTSSRAPLGGFIE-TKREQS
EQRLAVQIKASSKMLKELGSEIFVAHERLAEELSNYMEFRKACLDQRSLVAFATTNISVL
QECV--------------------------
>ZYRO0C07810g
----MAYHIPVL-LNPL--VNSVFNCS--NPSDSQFKKLFGKL-KTERFILLVPPTEKLL
YHVDA-----------ESGSSMNDLCQ-NYDFVASHILLLQQDTYSDGGFNLSASQ----
----TEY-KTLNDKRVAVRSSSG---------EILTTE--GFPLRRRARIQNVELITNFN
DYLNGS-EKFALVHIDHPL--IGTLIRKIDIPRGLAQGNFNGVD-------AK-GSLVRD
L---TQKSWSSFENILRLH--PDWSNI----LNGYF----NRYRSTP-------------
---------LTEGP-YEELFRMIVKQVHAKMVNDELF---RKI--PHLYDLIFDYVELNL
FDDVWIRIVNSYRKD-E--IDTEP----LKFLSINELE-TELYQKKYEKFRLQDVTTMEK
NIDLAINSFVGLPLTHTHAEKADCLINTLQSLSNTREQDMDIQT-------LP-ITMDAD
TLISFFVLVVCRTQVK--NIKSHLFYLKKFSKDENSIKFGILGYAISTLEAVVFYFDGL-
KGTKKLQKLQDDSNKAKELYILI-SDKS--TGQAVLDISQFRS-NLEFRTPQGESVLSQC
IINDKNGLLYELL--KNYEDIFPLEDILDDETVDGSTLLIQALKCDNSEAAQMIVEVLQN
SC-TEQELREYVNRADKNRRTVAHY--LTHEMNILESIGKYINWKSQDS-NGHTPLFTIF
RCYDQQ--NYEAMISAAFRSAVRWYQ-ANGEDFQFSDHEDNKGNTLLHIIKNNVSILLDY
DN-----VDINCTNKKGLTPLMIYTRYNRFDNVKTII----RDQRIILDKLQ-HPSFLNS
FDYARNPLVLKELVSQAIKT-TAFELAFVHHLK-YEA--PS-------WFFHITVKIGAG
ADEEY--------KTVKLHIKTLQNLFQVLL--KMHFASFLPLEKALEDLSNLYKSR---
--------MP---SIAKLETLYFFYMLTDCFDVLLRHDN---LNKLVLRESRLVSWIRSQ
DKKCNNS-------------KKLQKQKNVEPEEIGIMASFLRFNRGELSAVKLKLMTMKK
LLIFLKLKNTDLTHSYQFLSLFGT--EYNLAQDRL-------LFKDLEINCCAFGEEATM
T--------FVREIAFLENCTGKLLDRVEQLLSVDIPEWWKLYGDVLEMHKVYKQKFP--
-------------------------------NISRN-----DSGTGIIASFFE-GKREKM
ESKLSSDLADCKKRMRRVGDRISSTHEILAEELSKYMEFKSNFFINGILRRAVRENINIL
KGRLVEMRKRALYRSRKGENNI--------
>TDEL0G04490
----MPYHLPVL-LNPL--VNAVFNCP--NPSTSNLKKLFSNL-KDRKFILLVPPCDRLL
DCNDK-----------LSGSPLQELCY-SYEFVASHVLLIDEQNAEYMTTAPPSQ-----
----VKF-DTLNGKKVIVRSQNR---------IILTSD--GFQVKKRCHITKTDLFVNFN
EYLLQE-YKFPILCIDEPI--CAESVR-TQRVQI-----SQTLGSGKRETKDG-SSPTLD
S---SQGSKSSFDNILRIH--PDWALK----FNELF----AEYRSTP-------------
---------EGDDP-HIELFHDIIRRAYSAMRSDALF---ASM--PDLSDLIYDYVELNL
YDDIWVRITHHFKDS-E--VESNG----LRYLSLHQLE-TGLYPDKFEEFNLKSVVSMEN
NIELAMNSFSRLPLAHAHADKAMYLIDTLRNLSRVDKSIQE----------VSPVAIGAD
TLLSLFVLVICRTQLR--NLKGQLFYLQNFAKNETSITFGVLGYAISTLEAAVCYFDEL-
KGSKKMSRLESECENARSLVDKL-SSES--SS--V-NLIHYQK-TLSYRTEQGESLLSIC
IANGKNDILQELL--SD-ERSFPLEDILEDQTTEGCTLLMQSLKCGNGDAASLIVDLIKS
SC-TQEEMFAYFNRSDKDKRTAAHY--LTHEINILEQIGNFFDWDVKDS-SGHTALFTIF
RSYDQP--NYDDMIRASFRCAAEWYA-CRMRPFCFTVHEDRKENTLLHILKRSISILLEY
ES-----VDVNARNRKGLTPLMVYAKYNRLDNTKSIL----TDKRVILGKIQ-HPLLLCS
IDYAKNPLILHEIAKQSAMD-TAFGKCFVHTLK-YES--SS-------WLVNITVQ--AD
RKGNF--------ETVEFHLKTVQNFFRTVL--RTCPMTFLPLDSTLNQLASLGKAR---
--------LS---SIGKLETVCYLRSLTNCFNVLINSQE--LPKDILANESKLLSWIKVQ
YKAFRNG-------------TTHIFSKKVEPEEMSIIQGFLRFNQAELSTLRSKLHVMKK
LAIFLRLKSSDVEQSVELLLPLGS--EG--MGDLY-------PLTDHKFSCTTVYGNDSM
IL-------LVEDIDLMLKCTIRLYDHINNLLQVKIPEWWKLYGELLNFRKQYAQNFP--
-------------------------------HLVKNGET--STDAGIIGKILE-GKKEKL
EKRLSFSIAETRRSMNQAGAIIAHDHESLAEQLSKFMEFKGAYICRGVIKRWVRENIKEL
KERLIHIQRDLRNISGQKLRS---------
>Sklu_YGOB_Anc_6.20b
----MPYHLPIL-LNPL--VNSVFNCP--TPSTSPLKKIFASL-RDQRFILVVPNVNILL
HYQDL-----------DTGSSLQDLCY-TYEFVANHIIILKKDS--------KYSD----
----QEF-KTLNGKTVLIRSQNG---------IVLTGD--GFPSKRRCKITNTELFINFN
DYLKGS-KYFPLIHIDKPL--MSDAVK-NDELQV-----FGVRS----TNTSS-LPLSTD
L---TQREVSSFEQLFRLH--PQLGDR----FSGLFKEQRQEINANF-------------
---------KGLDS-LVDFFDKFNYEAFELIRHERRF---ENH--SKLHQTVHNYVELNL
YDDIWKQITQLYRDD-E--IEATYDYNLLKYIAISQVP-TPFYPEKQSKFSLKKVTHFEK
SLEQATDCFKRLAFSSSHSEKTKIIMDTLQTLTDYSEFPDAD---------IEDVTIDAD
TLIGLMVLVVCRSQVK--NLKSHLFYLQNFSLDENTIKFGVVAYALSTLEAVLCYFEDA-
ENSGKIRSLEFNCRRNKQFWDHL-SCKA--VS--FDSLKSYRD-ILRIRTAGGESCLSVC
IQKGNFSGIECLL--QNFEHELPLEDILDDQTINGSTLLMQTLETGNTRMADVLLEILCQ
SC-TINELREYLNRRNRWKRTAAHY--LTQDLQMADKIGIFFDWEAKDI-SGHTPLFAIF
RSYDHP--DYAQMVTNAFRTASKWYE-IRGENFNFSAHKDTKGNTLLHVMKTNIEILLEQ
EN-----IDVNEVNKKGLTPLMVYVKYNRLDNVKCIL----RDNRLIMEKHQ-KSLFLNC
FDYVKNPVIQAELGFHAAEK-TKFGEVVAHTFR-FEN--NR-------WFLWITLK-GKD
RETDF--------QTVKHNIRAIQGLLQVYL--RRNPMSFLPIDAVLEDLHEIGKTG---
--------LV---SVGKLEVHRFLCELTLVLKLICQKEE--FKKALYLPASDLVNWIRES
GRKRTNV------------------SRRIEPEEINSIQSFLRFNLSELSLIRDKISILQK
LSIFSELKAQDINQARCMLF---S--QSVRLEDTA-------ISQAFGISGLSEKDSEDL
SA-----TILTSNIDFLKECTNKLVGKIDQLLQGKLTRWWKLYAELLDARNQYNKNFP--
-------------------------------NSVKPHL---DDNKGLFGTYVE-GKRSKL
EEKLSAQIKSCLERLQTLTYEVKQEHEALAEELSIYLEFKTNYLRTGIIQDFTVGKINTL
KDTMRHFKRSLKNYKEQGYT----------
>ACR006C
----MPYHLPVL-LNPL--VNAVFNCP--APGASPLKKLFNNA-KDKKFILVVPRTEVLL
QYQDA-----------TTYVPLTELCY-NYEFVASHTLVQLQEA--------RVTE----
----LEF-QTINGKSVVIRPQSG---------IIT-----AQPSAKKCRIQRCELLRSFN
DYLLGR-TAFALLYIDRPL--VGEIEL-ITPLRV-----FGPQE------QPL-QYQRIT
Q---TADAPLPLEQFLRLH--PQLGNQ----LDEVFKDAKERMRYIA-------------
---------LSLKE-LVRLFHELVEKVYCLIKLDKNF---RNY--LNLLEMVQGYVELNM
YEDVWRKLVQLNGKN-E--PDRVPGYYITRSISLNQLS-TSIYPEELDKFNLSPVTEIEK
RVVQATECFSKLTLTNSHHEKARILISTFQKLTTKTSQATLD------------PMIDAD
TLLGLMVVVVCRAQVK--NLKSHLDYLREFAQNSDDVKFGLLGYSLSTLEAVVGYFDIG-
GSSIKLERLITQCQRNKIFWNLI-EQGI--PI----NLKEHEE-VLISRTPSCESVLSLC
IQYGRQDVFYDII--ANYQSHFTLEDILQDVNQSNCSLLIQALQAGNKDITEAVIDLLIA
NC-TNTEMYAYINKCDIAGRTVGHY--LPQNYEIVDRLGKFVDWKRKDL-NMHTPLFTVC
RAYDHP--SYLELLSKCFQHCFDFYS-TRGKRFSFADHEDPLGNTLLHIIKDGIQLALST
PG-----ANVNKCNTRGMTPLMVYAKYNRIENIREIL----NDKRLILSKLQ-DPQSLKA
IDYVKNPIILNLIGTAMAKN-SLYGCLSVHNIK-YEE--NA-------WYLWITSS---L
SPESY--------KTSSYALKDIQSLLQIYN--KKHPMSFLPIDHHLETLKTLGKSG---
--------II---SVINLENSMLLEALTFSLSIIQQRED--YKNVFSYTESELSTWLRAS
MVKQKPN-----------------KRDKIEPEEIHSIQNFLKFSLTEFNYLREKFTVLKK
LIIFEHYKSHDIECSQRILY---S--QGEIIASVV-------PSKRLRTSPFDNEFNDGI
DP-------FEQAVDFMCMCLDSLTSKIVEVLDSKVSTWWTLYGEITNLQKEYQRNFP--
-------------------------------EKGKPNSASSEDSKGFFVSYME-DKRQKL
ESKLQSRLSVCSENLQHLDAELKHCHELLAEEISFFISSKNFAYMNFMVKAYVNRRIKQH
KNMLLAIEEFIST-----------------
>Ecym_3024
----MPYHLPVL-LNPL--VNAVFNCP--TPTTSPLKKLFNNV-KGQRFILLVPSTDVLL
QYQDL-----------DSGLPLSELCY-NYDFVASHILIQLQES--------KVTE----
----QEY-RTLNGNSVIIRSQAG---------IVM-----SKPELRKCRVKSYEVLRNFN
DYLSNV-IYFPLLHIDRPL--VGALVR-NDELQV-----FGSYE----MHNPS-KSKTIN
T---ISENHIPFEKFIRLY--PQLGAQ----LDGYFQRDRQRIRNEV-------------
---------DQLDK-LIKIFKDLVIDVYGVIKEDKNF---RNY--MELLNVTQEYVELNM
YEDIWLKLVQLNGSK-E--PDRVSGYSSTKYISLNNVA-TILYPEGTNSFDLRVVTEVEK
RVVKATDCFAKLSLTNSHNEKAKIVVSTFQILTTKMEYTSID------------PTIDAD
TLIGLMLVVLCRSQVK--NLKSHLEYLREFAPRPDDVKFGLTGYSLSTIEAVLAYFEAG-
DGTEKLKKLISLSEANRVFWDLI-RSGV--AV----SLSSYKN-SLISRSSNCESSLSIC
IHAGRLDLIKEIL--LNYQEQIKLEDLLFDVNQANSTLLIQALETGHDEIAELLIDVMIS
NC-TNNEFYEYVNRSNSAGRTVAHY--LPQAFSIIEKIGLYLDWRKKDV-NMHTPLFIIC
RAYDQL--HYSEMLSRSFEYVFEYCR-RRGEDFSFTDHEDPMGNSLLHIMKGGIQSILSQ
PN-----INVNKSNIKGMTPLMLYAKYNRIENIRDIL----EDKRLIVSKIQ-NPQTLKA
IDYVKNPMILNLIGTHIAKN-SLYGLLSADGIK-FED--NC-------WYLWITVK---F
SDNSY--------STLRQSVKNIQGLLQFYN--KKHPMNFLPIDHILSILKNIGKPG---
--------IL---PVINLENSIFLGLLTQLLSVIGQRNE--YMAVLRYNESDLSTWLRTN
NFKPRAN-----------------KDERIEPEEVSSIQSFLKFNLSEFSEIKEKFTILRK
LVVFQSLKAQDIECAQRIIY------QQMEIVSNS-------VGPSVEKTFIGSNENYSL
DS-------FQQAIEFIAMCLETLSSKIQYVLDSKVTLWWRLYGELSSLRREYQRNFP--
-------------------------------SDFKSSDVSGEESKGFFESYIE-GKRQKT
EDKLQARLRVCITKLQTLSGELKKDHENLAEEISFFVTFKNFAYESFVMKTYANICIKHH
RNILQVIEEFRKYNSTKAKN----------