MUSCLE (3.8) multiple sequence alignment

TBLA0G00940        MPIPATQTYSIVDDNDIEYN-LWTWYLNNIEEKTFHEFNEIENKEKYSKLKKLIDKKLFT
KNAG0C03240        --MMHYMNYVVGKNQCRESNNFWFWYIDNLVAGNFEEL--NDNLIKRNQLCSFLAHYFGG
ADR198C            --------------MLQDYHGLWSWYLGNLRKGRFEQL--VGDEARYSQLKAFLRDCFAH
TPHA0K00540        -------MVLFDEIKDDKYSSLWTWYLNCIRNGEFEEL--LKEEDKYRSILNKIRETLQT
Ecym_4061          -------MVENSGCLLDDCNGLWSWYLHNLRCGEFEEL--SSDIVKCRLMKRLVKEYSGG
NCAS0F01080        ------MIDSHSKNYPDDIDDMWSWYLSNLQSGNFEAL--VNGSVRQQHLEAYFKSQFT-
NDAI0H01590        ---------MSEDNIKKDDNEVLSWYLRNLREGRFENI--IEDRAKNYHLNTILDRQLFD
Kpol_1023.99       -------MSSDGNGDATKEIDVWTWYLCHVRNGSFEEI--LGNEDYYKLLKNNLVDDVFN
TBLA0D01660        MPVTKPKPVQVNDYYDNDNNGLWSWYLSNIRNGMFEEL--TENILKITLLKRFLKENFQQ
KNAG0B03710        ----MQKSIRVNDYYDNDDNGLWSWYLQNIRSGDFEEL--THNELKYTLLKRFLKNHFTS
ZYRO0D12540g       ----MHKSVRVGDYFSNDDNGLWSWYLTNIRNGDFEEL--TRNQLKHSLFKRFLRTYLEP
CAGL0K07271g       ----MSKSVRVGDYYGNDENGVWSWYLSNLRSGDFEEI--IENKLKYTLLKRFLNSNLLG
KAFR0C05390        ----MPNSVQIHDYFDNDENGLWSWYLTNLRSGNFEEL--INNKLKDSLLKRFLRNQVD-
KLLA0A01782g       ----MPTSVQVKDYYENDYNGLWSWYLSNLRNGEFEEL--TGNELKHGLLKRFLRDQFQA
SAKL0G04906g       ----MPSVVKVKDYFENDYNGLWSWYLSNLRDGHFEEL--TNNVLKFTLLKRFLNEHLMQ
KLTH0G03740g       ---MLESSVKVDDYFDNDENGLWSWYLCNLRHGNFEEL--NNNQLKFALLRRFLNEQLLS
Kwal_47.18646      ---MPENSVKVDDYFGNDENGLWSWYLCNLRHGNFEEL--NNNQLKSALLRRFLNEQLMS
TDEL0A03900        ----MQKSIKVDDYFDNDDNGLWSWYLSHIRSGDFEEF--SRNKLKVTLLRRFLNSHFDS
Smik_13.145        ----MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEEL--IGNQLKYTLLKRFLNSHFYG
YML006C            ----MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEEL--IGNQLKYTLLKRFLNSHFYG
Suva_13.156        ----MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEEL--IGNQLKYTLLKRFLNSHFYG
Skud_13.148        ----MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEEL--IGNQLKYTLLKRFLNSHFYG
NDAI0C01070        ----MQNSVRVRDYYNNDDNGLWSWYLRNIRLGDFEEL--TGNQLKYTLLKRFLNSHFYS
NCAS0H02550        ----MQKSVRVTDYFDNDDNGLWSWYLTNIRLGDFEEV--TGNQLKYTLLKRFLNSHFYS
                                    .   .  **:  :    *  .           :   .      

TBLA0G00940        VTNI----------------------NTKKVKNIIFLTLPKTKNF---QTRDSYFYLQKY
KNAG0C03240        KQ------------------------TTKLQRRLLLVTSPYGLRNGSLDEHLSKKLLSST
ADR198C            --------------------------STGQERRLQLLSFPASVPC---DYKILEEFIRQQ
TPHA0K00540        HARNIEMEEED---------------ANISDGNILFLSLHYTLDK---DKEIIDDFLVDN
Ecym_4061          --------------------------TMSASNRVLLVSVPDDIRQ---GASILEEFLRSS
NCAS0F01080        --------------------------SGNEGSKKILLSVPSMLCQ---EVSIKRLFLGSI
NDAI0H01590        N-------------------------KQYGATNKILVSTLTSIDE---IVSIKDIFLGQL
Kpol_1023.99       --------------------------IDKGNKIFKLISIN----------YLNNNILLDY
TBLA0D01660        DINSTSQ-------------------HSTNCTKILFTSIPDNIHQ---DLPILENLLKDY
KNAG0B03710        --------------------------LEGINSKILFISIPDKVHS---DISVLETFLKDY
ZYRO0D12540g       TL------------------------NERKDTKVLIVSIPEDVRR---DITLLEYFLGDY
CAGL0K07271g       NFSPESP-------------------TRFINKKLIFVSIPEDVHQ---DISILELFLRDY
KAFR0C05390        --------------------------INDQIKKILLISIPDHIFS---DINVLEIFLSDY
KLLA0A01782g       --------------------------TGPLNKKLLLVSIPDEIHQ---DIKVLEEFLSEY
SAKL0G04906g       D-------------------------IVQFNKKMLLVSIPDNIHQ---DITILENFLRSY
KLTH0G03740g       D-------------------------SVLFNKKLLLVSIPDAIHE---NTNLLENFLRDY
Kwal_47.18646      E-------------------------TVPFNKKLLLVSIPDAIHE---NTNLLENFLRDY
TDEL0A03900        NRS-----------------------HYGQNTKILFVSIPDKVHR---DLSLLENFLRDY
Smik_13.145        DNSI----------------------SVRSNKKILLVSIPENVHE---DISILEIFLKDY
YML006C            DNNI----------------------SARPNKKILLVSIPENVHE---DISILEIFLKDY
Suva_13.156        DNNT----------------------SIRPNKKILLVSIPENVHE---DISILEIFLKDY
Skud_13.148        DYNT----------------------SARPNKKILLVSIPENVHE---DISILEIFLKDY
NDAI0C01070        NATTTDTAIDDNNNTNSVND------IKPTVKKILLVSIPDKVHS---DISLLELFLRDY
NCAS0H02550        NSDVTATESPQQHNNNNNTNNNNTQQLKPNFRKILLVSIPDKVHR---DLSILETFLRDY
                                                      : :                  : . 

TBLA0G00940        LELIFSVQQLYITKLQNNTSTT------PSCNYCLIMDPILNFQNTTFKESYDSILSHIK
KNAG0C03240        FGT-------SIDEFL----TF------HGHNGWLTIFPISNSDEKLYEFYKQDLYCMG-
ADR198C            GNI-----SVAIPRVH-AT---------GTEKHYLV--------DGNYMVHA--------
TPHA0K00540        FPN-VDLSNIVIREIC-NNNINSEHFKKDHETYYMVIDSLNKLLTTSIEEVSVSCHRD--
Ecym_4061          LPGMREVRDGNITKLTGRKDLL------NGEDHYLINDT-----KGGVAGVGLTANRPVE
NCAS0F01080        FNE-ERLQYINVMEFS-KSPKQ------TEKKHYLLTDALSGFNEAAFIESMEFN-----
NDAI0H01590        FDH-ERLQYIEVEELK-SLKGD------NKETHYFLTDHLNSFNDLLLEEERLQTY----
Kpol_1023.99       YNN-----IVKKTLLL-LNKSN------SIELHYLVINGTSSHS----------------
TBLA0D01660        FDL-DNLDNIQILKLT-QNRCY------NHENHYILKDILDNFGNTSFFIHDGTKQKIPP
KNAG0B03710        FHL-EDLQNIKIQKLT-TSNCY------NHENHYLLTDTLNNFNDRKFLRYLNPGRKFEN
ZYRO0D12540g       LNL----DNMEITKLT-TSRIY------NHENHYVVMDKENNFKNSNFLHFASTNIQ---
CAGL0K07271g       FHL-KVLDNNQIHKLT-QDKVY------HHENHYFLMDELNNFEDPTFLEFGKSNWKMEG
KAFR0C05390        FHL-NDLSNIKIIKLT-KFNVY------NHENHYLLIDSVNNFKDETFLNYVNPQ-----
KLLA0A01782g       FHLKDDHTNIVIDKLT-RGTVY------KHENHYLIQDKLTNFNDEWFLEM---------
SAKL0G04906g       FHL-DDLQYIQIKKLT-DSQIY------NHENHYLISDNLNNFHDRSFLGFGQKKHDNVR
KLTH0G03740g       FNL-DDLQFIQIQKLT-QDRCY------NHENHYLISDSLSNFNDKSFLEFGAKSRRPRD
Kwal_47.18646      FHL-DDLQYIQIRKLT-QEKCY------NHENHYLICDNLSNFNDKSFLEFGIKRVGACN
TDEL0A03900        FHL-EHLEHIEITKLT-QSPVY------NHENHYILIDKLNNFDDPTFLQFASTRWQQQL
Smik_13.145        FHL-EKLEHIQISKLT-HSHCY------NHENHYLLTDNLNNFQDPTFLEFASTSWQVQK
YML006C            FHL-EKLEHIQISKLT-HSHCY------NHENHYLLTDNLNNFQDPTFLEFASTSWQVQK
Suva_13.156        FHL-EKLEHIQISKLT-HSHCY------NHENHYLLTDYLNNFQDPSFLEFASTSWQVQK
Skud_13.148        FHL-EKLEHIQISKLT-HSHCY------NHENHYLLTDNLNNFQDPTFLEFASTSWQVQK
NDAI0C01070        FHL-EDLENIQITKLT-QSECY------NHENHYLLTDKVNNFDDPMFLEFAGSTWQGRP
NCAS0H02550        FHL-EHLEGIQIQRLT-QSKCY------NHENHYLLTDTINNFDDPVFLEFAGSNWQARK
                                 .                   .                         

TBLA0G00940        SQKNKIKRNRELSTKNSNSSLLIRSLKNKSHYNSMTNCHSATMLNYSFYSNSNSRTTNYT
KNAG0C03240        --------------------------------YLMEECERGIISTPEFGWLSKTENAE--
ADR198C            ----------------------------------LEGCNLALTENEPFYTDSMSIEERSE
TPHA0K00540        --------------------------------DTSNIDRYKEQNSEFEYVNQSTQAK---
Ecym_4061          S-------------------------------FGSHFQRQDQCDNEFSFGHSNASLEETL
NCAS0F01080        --------------------------------QTEENEQSVYIEGMEINKSISSICLWPQ
NDAI0H01590        --------------------------------STNHSQHYFHRAMKNEKKKKKRKKKKTL
Kpol_1023.99       ------------------------------------------------------------
TBLA0D01660        LKHKPDSNNNINNLDNLDIYRDEDNSIINSDDQQSECPSLTPLNSIRSSHAYSAKKSNSI
KNAG0B03710        SGDMA--------KLDGVSGPLSIYGTTTSTTVKNEDDFPEEVTAEPATTTSTSTNASSL
ZYRO0D12540g       -------------------------------------TGKGFTGGELAGTTVAAQAEKNI
CAGL0K07271g       TAGTVYDPQNKENTTDALVTEATAKIDHKISSSNTDDSRFDTLVNDTKDDSSSHEYNAMN
KAFR0C05390        --------------------------------PSTNASNKFIPSIRTGTSASIPENDIPL
KLLA0A01782g       -------------------------------------KKDVSISGNSSKDATDSA-----
SAKL0G04906g       --------------------------------PQLSYNGYSVLSGETGYASLRTTEEQN-
KLTH0G03740g       DTEIL---------------------------GQDSNNQYSIISGETEADPALPAAISSE
Kwal_47.18646      GNELS---------------------------GETSNNQYSIISGETSTDVTKSSLEIPL
TDEL0A03900        SNQQS---------------------------NRLSDRQSGSIPNNDSSVEFNKKPCGTV
Smik_13.145        NSKAL----------------------------NNNNRSLIHPPTISSSKTSNGQLKSST
YML006C            NSKAL----------------------------NNNNRNSIPPPTISSSKASNGKLESNV
Suva_13.156        NPKSL---------------------------NNNNNRHLIHASTASSSKPSNAQLKPNT
Skud_13.148        NSKTL----------------------------NNNNRYLMHGSTISSSKTSTGQLKPNT
NDAI0C01070        NLHL----------------------------NNLDSLQLQEQNDDEEEKQREEREEKQY
NCAS0H02550        NLHLN---------------------------NHLDHRDDDRISPQSIDTHSALNKNDDQ
                                                                               

TBLA0G00940        NNNSSSKKSFSIVYQP------------------------------NANANANINASLDE
KNAG0C03240        ----------------------------------------------EEDCSDYEDE----
ADR198C            IVS---------------------------------------------------------
TPHA0K00540        ----------------------------------------------DLDEEGSYVSSSEN
Ecym_4061          NVSLCANTGLENVAGI------------------------------STQLKGIGFDPVSN
NCAS0F01080        EETNMDLFYASNSMDH------------------------------TMENEE--------
NDAI0H01590        VRHLVLMRRNKRTMKK--------------------------------------------
Kpol_1023.99       ----------------------------------------------NDDTNSSI------
TBLA0D01660        TQENSKTNFLKLSQPAIDPLSLSYGPSNPSSFQGNSLLSLRDEAKNCCNNDEQQNGIVVA
KNAG0B03710        VSNHAPIQNLDKSHDLLI----------------------------IQNSTGLINGKGAS
ZYRO0D12540g       SPTESAKFRAGQGLEP------------------------------SDDTEGD-------
CAGL0K07271g       LNEQDSITSSNNNDSLLSSLSTGGEDSLNQELRRQSDHDESSSIIDQTNDNRKSYSNADT
KAFR0C05390        APIRNI------------------------------------------------------
KLLA0A01782g       ---------ENCGQEM------------------------------EDDSPRRDSDSSDS
SAKL0G04906g       --------GTHRPSGV------------------------------VEQCNGNSPATPRD
KLTH0G03740g       SPASVHLSKVVQEDVPL-----------------------------RTHNSSSRLLIVDN
Kwal_47.18646      SPEFIRDSKVTQEDPAL-----------------------------QTQSTSSRSLRIEN
TDEL0A03900        TERSRAGSLSSFSANS------------------------------GPSDLGSDTGGLQN
Smik_13.145        SDEQWSNINTQTPTGT------------------------------RTNTNTRTITSPNT
YML006C            SDDQWSNINTQTSTAT------------------------------RTNTNTRTLTSPDT
Suva_13.156        LDDQLLDINTQTSMTA------------------------------RTNTNTKTLTYTDT
Skud_13.148        LDDQWSNINTQTSTAT------------------------------RTNTNTRTLTSPDT
NDAI0C01070        IHKESRDPNEDSSI--------------------------------DNDTDEILITQPIT
NCAS0H02550        ILVTQPIDSTLVTPET------------------------------REKENLDDIDVG--
                                                                               

TBLA0G00940        ELNKIAISTPSSQSIRSENLKRHGYSND------------------------------DD
KNAG0C03240        ------------------------------------------------------------
ADR198C            ------------------------------------------------------------
TPHA0K00540        DS----------------------------------------------------------
Ecym_4061          DISYMQQNIDVDRREHTLDGGGVG----------------------------------DT
NCAS0F01080        ------------------------------------------------------------
NDAI0H01590        ------------------------------------------------------------
Kpol_1023.99       ------------------------------------------------------------
TBLA0D01660        ESFLNKDPNIETVDDFDGSINSHPPLIEHFLDTNKIDEDNTEINILDSNYSKEFEAKIKD
KNAG0B03710        EPIIEDKTVSNSTTCNNNGLQPNGISNKQNGIKSERIETPNESA--------------SS
ZYRO0D12540g       ------------------------------------------------------------
CAGL0K07271g       IRSKMIPSEGNISIDFDQGTDRESTNVDN-----------------------------SN
KAFR0C05390        ------------------------------------------------------------
KLLA0A01782g       YSIL-----------------TGDTF--------------------------------DT
SAKL0G04906g       VTAV-------------EPVKSSE----------------------------------DE
KLTH0G03740g       QECASSTDESDDA-----------------------------------------------
Kwal_47.18646      SGSLNSSDESDDT-----------------------------------------------
TDEL0A03900        IEVRSIQSESTAGQFNQIPINSINDQ--------------------------------DD
Smik_13.145        ADICLT-SANRQSNNYAVPQDSENRN--------------------------------DG
YML006C            VDINVT-SVNSQSNNNDTPQDNENEV--------------------------------DE
Suva_13.156        ADPSLTQPECNNKGDNDMPQNNENEN--------------------------------EE
Skud_13.148        ADLSLT-PTNGDNNNNDVLQSNENEN--------------------------------AE
NDAI0C01070        TTTSLSHNNQAYTPDENEQLN-------------------------------------QT
NCAS0H02550        ------------------------------------------------------------
                                                                               

TBLA0G00940        DDDNESEGDVDSIVIDFPRRFTRSTLLSSTSSNNQNNYTNTS---------------SKS
KNAG0C03240        ---------LEGLTINFAKQFKQNICENAF---------------------------AVN
ADR198C            ---------GMSLVFDFKPRFEHSTSNPVHSMRSSSSEM------------------HSG
TPHA0K00540        ---------GLSIELNFKTKFNRNKFQNSTTEIAKAEANHAV---------------VKP
Ecym_4061          EVASEKPRNGERFTTSFKANSLTAVDNSKLFTF------------------------GLS
NCAS0F01080        ---------EGAIILAFPSLLNNHSK-------------------------------LHN
NDAI0H01590        ---------QMPYSLIFESRLRQSNR-------------------------------ISK
Kpol_1023.99       ---------ASSIEINFKPKLSSSLNANAITSVNDNQK-------------------KSN
TBLA0D01660        DGGTDDEETDRSLFFTFKHKTLPESEKALSSQENKCD--------------------TTL
KNAG0B03710        ESSGLFEDGASSIVLDFPRSKVQAQKRKVRSARSSVSGSNASNNPLLNT--------ALN
ZYRO0D12540g       ---------EESLVFNFTHRDHHLTHPLRANGKEQEEAVGVSPSWNPQ---------QQQ
CAGL0K07271g       KRTGLDDDGASSIVLNFSHNRNAHKRKTKIDSLLG----------------------ERY
KAFR0C05390        ---------DSSISIECEH--------------------------------------EEY
KLLA0A01782g       E--------SHSIVLNFKHPE--VMVKPITKTTQRIV--------------------RIS
SAKL0G04906g       EDQE-----SGEIVLNFPHKPPKN---------------------------------IIN
KLTH0G03740g       ---------STELVLKFEHRGMLGKQRLHPEVR------------------------KMA
Kwal_47.18646      ---------ESEIVLRFKPRGTVGKRQLYSEVK------------------------RSP
TDEL0A03900        E--------NESIVLDFSHSLLRKQMEEKKSQAQRIRQQEYSADTNQTITNLHTNDKDTN
Smik_13.145        EDAADDT--TSSIVLNFSHS---RALEPKTSRLPKIF--------------------PPY
YML006C            EDA------TSSIVLNFSHS---RTVDSKPNRLPKIF--------------------PSY
Suva_13.156        EDAGDDA--ASSIVLNFSHP---RTLASKANRAPKIF--------------------PSY
Skud_13.148        EDAGEDA--TSSIVLNFSHS---RTLASKANRLPKIL--------------------PSY
NDAI0C01070        EKHTGNAYDNSSIVLNFPHLRKHSKDPKQTIINEQQEE-------------------PLA
NCAS0H02550        ---------GSSIVLNFSHTREHRKDKDPLNMVKQEEQSN-----------------KFS
                                                                               

TBLA0G00940        LLNVNSPPLSEINSINSFEYFD--------SENDS--MSPLTRTDLKDRTISEVPLIGKK
KNAG0C03240        PILRTLTDTSDTLSLKSFE-----------SYEDS--FE---------------------
ADR198C            SVRDAAFSGLDDMSIRSN------------ESCES--FS------------------GQ-
TPHA0K00540        SNNASIYSRSDIESIDSYSDLNS-------RNLNT-HYD------------------GQ-
Ecym_4061          SSAISTCKNSEEVSIRSS------------ESYQS--YD------------------GE-
NCAS0F01080        YVSHRTPATSEDISIDSEKY----------DDVDS--YI------------------HA-
NDAI0H01590        LGHQYTPYHSDSISINSFGS----------QNDES--FS-------------------H-
Kpol_1023.99       QSPYSSQNTTELSSIDSFQYSEDVESLPSLSYEKN--PN------------------NN-
TBLA0D01660        IKTDTNLPTSEDISFDSFNTSNNVLE----RNETS--YI------------------GH-
KNAG0B03710        NSNLYTPASSELVSFNSYYNEEE-------DASSTMIYN------------------SQE
ZYRO0D12540g       RLQEHNASNDEMASIDSYNLGSNSS-----RVVES--FK------------------GE-
CAGL0K07271g       PSDFYTPPQSELVSINSC------------GSAED--YT------------------GQ-
KAFR0C05390        DSSYSCSSSSDIFSVHNNNNNN--------NNNDG--ND------------------NN-
KLLA0A01782g       PGNNIGSPAESQVSIVTHG-----------DDLES--YR------------------GE-
SAKL0G04906g       QREQEVVTTSEDVSINS-------------EDASS--YD------------------GE-
KLTH0G03740g       STEEAIDTPSTGVSLRS-------------DDVSS--YD------------------GE-
Kwal_47.18646      LANDYIDTPSTGMSLRS-------------EDVSS--YD------------------GE-
TDEL0A03900        ASDIYSPAISENVSINSYEDESMRDGSDSITAKDS--YS------------------GQ-
Smik_13.145        TNEEYTPSHSEIVSIDSFAG----------EDVSS-TYP------------------GQ-
YML006C            TNEDYTPSHSEIMSIDSFAG----------EDVSS-TYP------------------GQ-
Suva_13.156        TNEDYNPSHSEIVSIDSFAG----------EDVSS-TYP------------------GQ-
Skud_13.148        TNEDYTPSHSEIVSIDSFTG----------EDASS-TYP------------------GQ-
NDAI0C01070        NNQYYTPPQSELVSINSFGD----------DDTNSMAYQ------------------GH-
NCAS0H02550        PNMMFTPPQSELVSINSF------------DDGDSMNYN------------------GH-
                                *. .                                           

TBLA0G00940        DNQLKVNEELIKTTFKAFSKESI---SITTSSSSASSSSLNSGSISTSQSSITHYQPIIR
KNAG0C03240        -------------IGYCHEERDC-------------------------------------
ADR198C            --------ELVRVLTHEGDSQEY-------------------------------------
TPHA0K00540        --------SLKLTHHKDNLLKNT-------------------------------------
Ecym_4061          --------VLARTLTREEHIQGS-------------------------------------
NCAS0F01080        -------MSLMRVNANCANQIQS-------------------------------------
NDAI0H01590        --------ATSLTRVKCNEHIEE-------------------------------------
Kpol_1023.99       --------QAKYLISNNEQQDAA-------------------------------------
TBLA0D01660        --------PLSLTITHEEDQNQK----------------------------------IEQ
KNAG0B03710        GRSGHMDHPLTRMLTRSDSQMLQ---------------------------DNETNSDQED
ZYRO0D12540g       --------PLTLTMTRTEDFSSS-------------------------------------
CAGL0K07271g       --------SLRLMVTKNGTDSKD------------------EQPGDNPNRSKTSVNGHIA
KAFR0C05390        --------DILYEGTEFHENDNA-------------------------------------
KLLA0A01782g       --------ALVQTVTRAIDEDEE-------------------------------------
SAKL0G04906g       --------ALIQTITRDEDASSA-------------------------------------
KLTH0G03740g       --------VLTQTITRDEDSVSL-------------------------------------
Kwal_47.18646      --------ELAHIASRDEDSASL-------------------------------------
TDEL0A03900        --------PLALTTTHYKDDTQG-------------------------------------
Smik_13.145        --------DLSLTTARCEDDNDQ---DDVEGHYNRTSNDLNDKSTNQIRLNMESSVSCTS
YML006C            --------DLSLTTARREDESGQ---DEVEDHYSRVSHDLGDESIDQASYSMESSVSYTS
Suva_13.156        --------DLSLTTARREDKDDE----------DRSSNGFDDESFEETSSSIESSVNYTN
Skud_13.148        --------DLSLTTARREDANDENDENESEDHYNRNSDGFHDEGNEQVSLGIESCVSYSS
NDAI0C01070        --------PLHLVLTRQDEESST--------------------------QLEEDELGAKN
NCAS0H02550        --------PLKLTLTRQDEESIA---------------QLEQDKQAEYPTATTTTTATIT
                                                                               

TBLA0G00940        EFTADTGSRRNSHSSTSSFVRATNDNETFLTNTFVSSHNNSGSSIINNKFNNNMNSSRNS
KNAG0C03240        ----------------------------------------SCRAL---------------
ADR198C            -------------------------QCDSTETRIFRESYSDISSL---------------
TPHA0K00540        ------------------TSSLDSGQNDKAVERLDDEATSDSMIV--SDVFSSGAYSMSN
Ecym_4061          ---------------------------CCPTEHRHEELYNEGDST--SELSSAC------
NCAS0F01080        ----------------------PSEMMDESIDSLTESIISSDEIK--EDDSKLTREENLR
NDAI0H01590        -----------------------------GSSEFSKSLNSLSTDF--PSSIEKSEFEKKE
Kpol_1023.99       ----------------------ADTNADAEGDVNVEDIYLDDSDS--DSLSSFPPYFIND
TBLA0D01660        QLLYRGDNSQNFRTDNIENRNMHNKDGLSNSSDKVSELSKLSDSL--NSLNYSVTESNSS
KNAG0B03710        SNSELPSVVETADDAPVVGAGAGTGTGLNSRPHGISCVSSVSTGSFTSSFTTSSSSSCST
ZYRO0D12540g       ----------------------------DEYDSLASSPSSSDTDL--SSF----------
CAGL0K07271g       SPLSDIQNVSINEANMGGQNDQASFSDNESESMYSSDLESEDGEM--DHYNAS-------
KAFR0C05390        -----------------------------DYETYSEDYFDDDSEF--QNY----------
KLLA0A01782g       ---------------------------DEDDDDHHHDVESADDMK---------------
SAKL0G04906g       ----------------------------DEDNSNISELSSVDHSL--NSLSYNSDIS---
KLTH0G03740g       ----------------------------MIEDDSISELSSVDHSL--KSLSYDSEYS---
Kwal_47.18646      ----------------------------SADEDNISELSSVDHSL--NSLSYDSECT---
TDEL0A03900        -------------------------SSDDSQEENISELSSVSRSM--KSLGSQTSLGDNN
Smik_13.145        CSSSS-SSSIRYSLSSTSRASLKRESADHTNATYVSELSSITSSI--DNLTTSTTPEEED
YML006C            YSSSSNSSSAHYSLSSSSRGNPKRENIDHTNATYVSELSSITSSI--DNLTTSTTPEEED
Suva_13.156        CSSSSNSSIVRYHFNSSSRGSLGRGDVDHTNATYVSELSSITSSI--ENVTNSTTPEEED
Skud_13.148        CSSSSIGSSVRYSLSGNRRDSLRNGNVDHTNATYVSELSSITSSI--DNLTTSTTPEEEE
NDAI0C01070        LSNTALGLNNNDNHMDDQSSGLEPSYENSEISIQNSGFDSYSNQL--QRFDDDTNEEIKK
NCAS0H02550        ATNNNINNNTYHNLHDHKLTPEESIQSYEIGKSSITDMSSLKRSL--NSIGTDSSSSISR
                                                                               

TBLA0G00940        STTTSSSQLLNISRQHATTSFEGNIIRYGSRSTEEVSLDGNIYNQTYYSDSNVDSVSSSS
KNAG0C03240        ---------------------------------------------------------RHY
ADR198C            ---------------------------------------------------------SQF
TPHA0K00540        -----------------------------------------------------LSINSQD
Ecym_4061          --------------------------------------------------------NSVS
NCAS0F01080        --------------------------------------------------------SASC
NDAI0H01590        ------------------------------------------------EGDKILMDYEEA
Kpol_1023.99       P-------------------------------------------------------NFGS
TBLA0D01660        ---------------------------------------------NLLSASSSNDSSSSY
KNAG0B03710        ---------------------------------------------------SMSTSSTVS
ZYRO0D12540g       ---------------------------------------------------------ESC
CAGL0K07271g       --------------------------------------------------------GSDI
KAFR0C05390        --------------------------------------------------------SISE
KLLA0A01782g       -----------------------------------------------------------S
SAKL0G04906g       --------------------------------------------------------SDDY
KLTH0G03740g       --------------------------------------------------------QGSS
Kwal_47.18646      --------------------------------------------------------PGSS
TDEL0A03900        -------------------------------------------------DYENNSDSSDY
Smik_13.145        ---------------------------HLIHHNYDAQGYASREDEVEEVDDDADLSSSDY
YML006C            ---------------------------NLIHHNYDAQGYGSGEDDGEEVYDDEDLSSSDY
Suva_13.156        ---------------------------HLVRNNYDTREYISGEEDEEEVDDEEDISSSDY
Skud_13.148        ---------------------------NLVQNNYDAREYISGEEDGEGADEDEDISSSDY
NDAI0C01070        PVECVRSIDEDDESDYNIIQGTRNMHVGDQNDSDEGDDEEEVHGDDDDDDDDLDDLSSDY
NCAS0H02550        ----------------------REILNLDRTDIEEGEVDDR---DDEDEDEDIDDLSSDY
                                                                               

TBLA0G00940        SLYLSKFKTAASNTS-SNFDQENRRMNLNCIILKKIGNTNGDFFTAIKEYN------ELY
KNAG0C03240        PLHRVQARVNHVDNYNRDL-----TINVVSLLGKD--DASGKLWHAVRQLQ--------D
ADR198C            SNHSVFPSLSITNDF-SKF-----RVVLQSILVYD--CEKDRINTAVRQYNNNPNIANCS
TPHA0K00540        RLLSLLPSIEMQNSY-GEF-----KLVLQSMILIN--FESGESFTAVRQSNSLIHEATED
Ecym_4061          SDCSIFPSISISGDE-GDF-----RIVLQSILIYN--TTLDQLLTAVRQSNNDTTVADIN
NCAS0F01080        NFHSNIPTQTFSYKS-GQL-----RFVLHSLLIQN--AQSKETFTAIRQRSSDPNTANIL
NDAI0H01590        LSVPVVPSISCHHPY-GQI-----RFVLQSIVFKS--VRTAELLTAIRQSSADRIVATSS
Kpol_1023.99       YFNTVLPTVNLPDPY-ANF-----QLVLQSILIYN--SDSDELITAIRQSNNEQDSADID
TBLA0D01660        SAMSILPSISISDSL-GHF-----RLVLQCILIYH--PHAEKTYTAIRQSDSNRDVADIQ
KNAG0B03710        SHYSILPSITIKDTE-GHF-----RLVLQSVLLQR--ED-KAIFTAIRQSNNKVDRATVQ
ZYRO0D12540g       SLMSILPSISIADSF-GHF-----RLVLQSVLFIN--PTSNEIFTAIRQSNNKPTKADVD
CAGL0K07271g       TLLSILPSISIFDTL-GYF-----RLVLQSILIQD--PQTKEVFTAVRQSNNKPTIADIT
KAFR0C05390        SNCSILPCVSINNEAIGHY-----RLVLQSMLICN--KENLDLQTGVRQSNNLINYANIN
KLLA0A01782g       KDISIPPSISISDNF-GTF-----RLVLQSILITN--KETEQIFTGIRQSENDRSNADIN
SAKL0G04906g       SMASIFPAISISDTF-GTF-----RLVLQSILIQN--PDTREIFTAVRQSNNDPNVAHIN
KLTH0G03740g       SLTSIFPSISISEKF-GRF-----RLVLQSILVHQ--PDTRQLFTAVRQSNNDPTVAHVN
Kwal_47.18646      SMTSIFPSISISEKF-GRF-----RLVLQSILIQQ--TDTRQLYTAVRQSNNDPTVAHVN
TDEL0A03900        SVVSILPSISISDAR-GHY-----RLVMQSSLLQD--PETKEIYTAIRQSNNQPTVADVD
Smik_13.145        SVLSILPSISICDSL-GYF-----RLVLQSILIQD--PDTKEIFTAIRQSNNRPTIASVT
YML006C            SVLSILPSISICDSL-GYF-----RLVLQSILIQD--PDTKEIFTAIRQSNNKPTMASVT
Suva_13.156        SILSILPSISICDSL-GYF-----RLVLQSILIQN--PDTKEIFTAIRQSNNEPTVASVT
Skud_13.148        SVLSILPSISICDSL-GYF-----RLVLQSILIQD--PDTKEIFTAIRQSNNKPTMASVT
NDAI0C01070        SVLSILPSISISDRNEGHF-----RLVLQSTLIQN--PITKEIFTAIRQSNNEPTIAHIT
NCAS0H02550        SVLSILPSISISDAIEGHF-----RLVLQSILIQH--PVTKEIYTAIRQSNNEPTIADIM
                                            . : . :             .:.: .         

TBLA0G00940        SKWLIFDSTFQTEKSQLVSFDKLLEI-AKSFSKIFFYSYNNTVVKNETS-----------
KNAG0C03240        DDWVIYDADFSLNNLENCKLEDILLNSDGACQ-----TM--VIL----------------
ADR198C            DDCLLYDNKISLITFRILSLVDLMEL-NRAHPKMLFYSV--AEIFNSSP--RCSAAGCCA
TPHA0K00540        DEWLLYDSKFSMDNLEIVTLNYLMDI-YADFVKIFFYSM--VIINLEYP--QAITFATDK
Ecym_4061          DDWLLYDERFSMNNIQMVSLIDIFEM-NGVFPKILFYSV--VAIPCNNT--ASKEANSCA
NCAS0F01080        DEWLLYDSKFSLDNLEMGTLQDILLS-NKGNSMLLLYKT--ILISK--------------
NDAI0H01590        DEWLLYDSDFSLNNLEISTLQDILYP-NYENPRILFYTM--SVVS---------------
Kpol_1023.99       DDWLLYDSKFSMTNLQILSLNELLHI-NKDYPKILFYSL--VSIPNVTV-----------
TBLA0D01660        DDWLLYDLKFSMDNLEILTLQELLDF-NRDYPKILFYTL--VAINDNSS--YIRTNKNIS
KNAG0B03710        DDWILYDSDFSMNNLMMMTLRGLFNF-SENMSKILFYSM--IIVDDAET-----------
ZYRO0D12540g       DDWLLYDSQFSMHNLQMLTLQDLSEL-NKGCPKVLFYSL--VEVVDTPS--LEDADTEC-
CAGL0K07271g       DDWLLYDAEFSMHNLQILTLQDIMTI-KKDYPKILFYTM--VVI-NDRS--EIACEFPYN
KAFR0C05390        DDWMLYDEKFSMRNLNILSLKDLSIIGNVDSIKILFYSM--IDVNNQRS-----------
KLLA0A01782g       DDWLLYDTDFNLGNLQMLSLYDILDF-SKFLPKILFYSM--IHVKDSVD-----------
SAKL0G04906g       DDWLLYDEKFSMHNLQMLSLHDVLEI-NRFFPKILFYTM--VMLDTEEI--ADEAHAYIP
KLTH0G03740g       DDWLLYDDKFSMNNLQILALHDVLEM-NKFFPKILFYSL--VMISEEVA--ADAQDYYPS
Kwal_47.18646      DDWLLYDDKFSMNNLQILALHDVLEI-NKFFPKVLFYSL--IVVTDEVA--IDAQEYYPS
TDEL0A03900        DDWLLYDSQFSMNNLQMLTLQELLDM-NRSFPKIIFYSM--IVVSDEQQELLQWSNG---
Smik_13.145        DDWLLYDSNFSMNNLQILTLQDLLDI-KRSFPKILFYTM--VIVTESGQQIEEEPK----
YML006C            DDWLLYDSNFSMNNLQILTLQDLLDI-KRSFPKILFYTM--VIVTNSGK--QVEEEFK--
Suva_13.156        DDWLLYDSNFSMNNLQILTLQDLLDI-KRSFPKILLYTM--VIVTNSGQQQIEEENTN--
Skud_13.148        DDWLLYDSNFSMNNLQILTLQDLLDI-KRSFPKILFYTM--VIVTDSGHQQIEEEHK---
NDAI0C01070        DDWLLYDSKFAMDNLQILTLQDLLDS-NRTFPKILFYSM--VIVNESSPPINDDQHNYNG
NCAS0H02550        DDWLLYDSQFSMDNLQILTLQDLLDT-NRSFPKILFYSM--VIVTDAHHQPIQGPTSTAG
                   .. :::*  :   .     :  :              .     :                

TBLA0G00940        -------------------FQNRKTEILDINLTPS-------TSKDNNTKADDFIFFDDL
KNAG0C03240        ------------------------------------------------------------
ADR198C            ----QVHHSQPQLLQRNS-FSASTLSRHSLRLLPT-VTSANTIERHVRTDVADKGKIPNS
TPHA0K00540        ----HINNNLINSDG----SSANLSLDSNISPLASNFLSVNDKEVAVSVRNPLLPYIPNS
Ecym_4061          ----EIGKKNASNISN---WIYSCISQNTLSQQAT-------TADSAFVFGGPRHYRWHS
NCAS0F01080        ------------------------------------------------------------
NDAI0H01590        ------------------------------------------------------------
Kpol_1023.99       -----------------------NISNYENSSNPHLEDYINHSDDSLSIHDTPQQFYPMI
TBLA0D01660        ----E--------------INELTNNLKNLNCKPSGDDRNKKDNQKINTEFNTTRIHSNH
KNAG0B03710        -------------------------ADDMLDEEAT--------HSGDVSDTQPQLMFDE-
ZYRO0D12540g       -------------------ATISNTASTSLSSAPT----------STSVSCEPRVFFPSN
CAGL0K07271g       ----GAQFTKAPSPI----TNKSHEVEKEELDQPT----------------EVQAYFPGN
KAFR0C05390        ------------------------------------------TTQHLQLTFQDDLKIAKT
KLLA0A01782g       -------------------DNTELSLQHLITVNNT--------------LTNGNMYSPHE
SAKL0G04906g       ----NDPHLPPPSQGI---ASTSTLSQNTLRLLPT-------ATSNVTYTRHNELLNAAA
KLTH0G03740g       ----KPSKSPQPT------ASNSTISENTLKVQPTLTHSLTNTNSYLSTGAYNSSLSPFY
Kwal_47.18646      ----ASHQSPERT------VSTSLLSENTLKLQTTLTPSLTNTNSFLSMGVNSSSLTPFY
TDEL0A03900        -------------------MTQKEDTADASSSIPR-------ADSYASMSRDPQQFYANM
Smik_13.145        -------------------NPNYGTREDMLKEQPL--------NSDLLLSHDPKQYFPNA
YML006C            -------------------NPNYDNREGISKEQPL--------DSELSLTNDPQQYFPTA
Suva_13.156        -------------------LNQQHREVDLTEEKPP--------NSELSLSNDPQRYFPST
Skud_13.148        -------------------SSSHRGTVDTSKEEPL--------NSELSLSHDPQQYFPTA
NDAI0C01070        MTALNSEYLSNKLESLEKTSSEEGKSINRYKYYPTLPKAGITAKNGEMIADVPEQFFPGP
NCAS0H02550        ----PDLTTSYLSNKLESIAGDETNQRFENRYYPM---------ADDQVEDQPQQFFPQE
                                                                               

TBLA0G00940        KEKELSLEIHGNEIDED-------------------EIYHEEKNYALEEEHQQRELENQG
KNAG0C03240        ------------------------------------------------------------
ADR198C            PAFCWQKSVDYTEYYQDQLFTRELGLAHNP--------SYSSRSSNSEQP-SERLLPTDS
TPHA0K00540        DDNQHNNNNKTTFEKPSSNRDDEDSDCDSVLEYPIPEIFSPDTIASNKAT-ALRSVTTNN
Ecym_4061          SEREEHEPLAGDGDSVHREGNRASPLTSGA------EIVTNNIPMLSTLPVHSKAFSRTG
NCAS0F01080        ------------------------------------------------------------
NDAI0H01590        ------------------------------------------------------------
Kpol_1023.99       VNDNNNNININNHNNTRRS-SVDYYDDSIPQQFYPDDMNIPTKVNTNTTI-AHRSYRTIT
TBLA0D01660        LIDHSSSEDIPRQLYTTLSSDEEYGEIEYP---EGLEMYEPSKIKSNTTTIAHRSIRTVN
KNAG0B03710        --------------------EDSDSGVQEP------QMYLPQKTASHATT-AHRSIRTVN
ZYRO0D12540g       VNGDNSG-------------------------------CRLAKGNTNSSTLGHRSIVTTN
CAGL0K07271g       GQAIKDSIKPNNRDSLTFD------------------LCQAERTKSNMTT-THRSIRTVN
KAFR0C05390        TSN------------------------------------------------GHRSIRTII
KLLA0A01782g       VDDSMSELSSDNSIECYTG-NSNDSIADEP----VIGLYSPATAATA----GHRSIRTVE
SAKL0G04906g       TSAQDAENYFPEDNHD----DEDDQEVNGV-----MPLYAPTRTNSNSTT-AHRSILTVN
KLTH0G03740g       SSVQHNHEQGEEDDYYDDDKNSEGVVV---------PLYSATRTNSNKST-AHRSIRTIK
Kwal_47.18646      ATAQGSPDRANDEDDYFDD-ERDGKTDDGE----VFQLYSATRTNSNKST-AHRSIRTIK
TDEL0A03900        DDD-----------------DTSLSEQSGP------MMYAPTRLQSNTST-AHRSIRTVN
Smik_13.145        YNNDYDEYIDDEDDDD----DASLSEQSGP------QMYIPTRMESNVTT-AHRSIRTVN
YML006C            YNNGYNDYIDDEDDEDDGD-DASLSEQSGP------QMYIPTRMESNVTT-AHRSIRTVN
Suva_13.156        FDDDYDEYIDDDDGGD----DASLSEQSGP------QMYLPTRMASNVTT-AHRSIRTVN
Skud_13.148        YNIDYDEYTDDEDEGD----DASLSEQSGP------QMYLPTRMASNVTT-AHRSIRTVN
NDAI0C01070        PSDDENGKGEDYDDDYD---DESLMEQHGP------EMYLPTRMQTNVTT-AHRSIRTAN
NCAS0H02550        DDHDDDNMYDT---------DDSLMEEAGP------EMYLPTRMETNNTT-AHRSIRTVN
                                                                               

TBLA0G00940        VAINQETYSCSTSISSNSSSSNSSSYLSD-------------------------------
KNAG0C03240        ------------------------------------------------------------
ADR198C            KAVNPIQLSRHVTPVIFSSIQASADVDFE-------------------------------
TPHA0K00540        SESTYKVLSRTYTGDKSIGRNTTVTDGGD-------------------------------
Ecym_4061          SVSEPTKTRVNSNREIHKCESHSSITESR-------------------------------
NCAS0F01080        ------------------------------------------------------------
NDAI0H01590        ------------------------------------------------------------
Kpol_1023.99       N-GSSSYINDGQELQNIITLTNTVGTEYP-------------------------------
TBLA0D01660        SIGEWAFHRTDTRG-TKDTKNISINSYVEPFSRSPSPFEYIISSHIKDSTTNETENITTT
KNAG0B03710        SIGEWAYKKKSNATSNHDAASVGSQGNST-------------------------------
ZYRO0D12540g       SAADWRRQSVESNASIRKYDSTAETYKGL-------------------------------
CAGL0K07271g       SIGDWSISRDTTGI--ATRAATNTSGQYD--------------DHYQ-------------
KAFR0C05390        TDGETIYKRKNKNKLKLNRFESMSS-----------------------------------
KLLA0A01782g       SIGAWALNRSNTKKSMETVQNTVSRDSRG-------------------------------
SAKL0G04906g       SIGEWAFHHNEPYPQNNHSNISFADQNTS-------------------------------
KLTH0G03740g       SIGDWAFHHDSSSRKLSPNDSTLEDSYQS-------------------------------
Kwal_47.18646      SIGDWAFHHDSTSRRTSSAASFLEDPRLD-------------------------------
TDEL0A03900        SIGDWAFVHKNETKRQGSHRGSTSQAGVS-------------------------------
Smik_13.145        SIGEWAFNRHNSVTKINKSNSNESDDSEN---------------NDDRLSSDEPYPMTQI
YML006C            SIGEWAFNRHNSVTKIDKSNSNELDNSKT---------------GESTVLSSEPHPMTQL
Suva_13.156        SIGEWAFNRHNSVTKINKSSSNESDNLKE---------------CGDRISPVEPYPMTQL
Skud_13.148        SIGEWAFNRHNSVTKINKSDSNELDNSKE---------------GVNRNSLGEPYPMAQL
NDAI0C01070        SIGEWAFNRMNSNTTSNNMNVDDENKDPD-------------------------------
NCAS0H02550        SIGEWAFNRNNTNGSSSKSAIGREDEDGD-------------------------------
                                                                               

TBLA0G00940        ---------------------------------------------------HNNKTNELG
KNAG0C03240        ------------------------------------------------------------
ADR198C            ---------------------MRASVATKASSRSGLDKIST-RGSF--STARQINTDTLP
TPHA0K00540        --------------NNNETLLKLLTITPTNHFDTDLSKYSTTLTTM--TTVERSISQKSS
Ecym_4061          ----------RKLSDDNEDMFRSKYIISKNPSKNGLTKISS-LGSLSLAHRERMFSCSLP
NCAS0F01080        ------------------------------------------------------------
NDAI0H01590        ------------------------------------------------------------
Kpol_1023.99       -----------------------------------LAKYSTALTSS--SKAERSKSRLIN
TBLA0D01660        AFITDYNTKYATQKSEISKLVLQPDNNQAGSNTLILDKIKNRKRQM--HPVERSKSTPVP
KNAG0B03710        -------------------------LQPIISKPEHIEKHKEDVRKL--SVVERWKSLPSK
ZYRO0D12540g       ------------------------------------------NATHAVGIMERTRSTPLP
CAGL0K07271g       -------ALKFDESSKERLIQGRKDGSGGKYSKHQISRVNTNGSSMPLDSVERTKSLPLP
KAFR0C05390        ------------------------------------------------TSLERWKSLPLK
KLLA0A01782g       ------------------------------------------------NFMNRIKSQPMP
SAKL0G04906g       ------------------TAGKMKRVSSKGSSKNTLQKTTT-VGSL--SAVERSKSTPLP
KLTH0G03740g       ------------------VEGNLMKVRSKSSVKSGLTKTLT-LGSL--STVERSKSVPLP
Kwal_47.18646      ------------------DEGNLMKIKSKSSVKSGLTKTFT-LGSL--STVERSKSVPLP
TDEL0A03900        -----------GVQFDSDNQNLQFLHPERVHSRNGLSKVST-MASL--NPVERSKSTPLP
Smik_13.145        SNFNTSSSNFSHSLKKKNTSKVNSKINNESNSKSELKKIKNSINAM--SAVERSKSLPLP
YML006C            SNSNTTSSNFSHSLKTKNSHKPNSKGNNESNSKNELKKIKSSINAM--SAVERSKSLPLP
Suva_13.156        SNSNTVTSNFSHLLKNKNSYKRTSKGNNESNSKNELKKIKTSINAM--SAVERSKSLPLP
Skud_13.148        SNSSTTTSNFNHLLKKKNSYKLGSRDKNGSNSKNELKKIKTSINAM--SAVERSKSLPLP
NDAI0C01070        --------------------------------------------YMEDTSNDKYETSRTN
NCAS0H02550        --EEEETNHHNDGQTHDNNHHHNKKTGKKGSYGGAKNKRSGNIEAM--KAVERTKSTPLP
                                                                               

TBLA0G00940        TSVES-------NNDE-------ANKDFSKDFNHFENA----------------------
KNAG0C03240        ------------------------------------------------------------
ADR198C            TLLHSI-SHRKYGLSK-----PQIGKTLKHKWQRWSSSQGHMT-----------------
TPHA0K00540        TNNDKQKSSSKSSIKS-----KSKQGHFDNKADTVVNNLKGIKQQIHKQGHASKTKSSQL
Ecym_4061          GMLHTVFNGTYASDEH-----PLAVPRKKVRMPSWRRLHKQSCGKQSCGKRQGFVC----
NCAS0F01080        ------------------------------------------------------------
NDAI0H01590        ------------------------------------------------------------
Kpol_1023.99       SSLDKISSVSNKSSNKSSRKSNENKNDLKKNIKNVDRLSSNKKSTSNKRSKSKRKSGKNS
TBLA0D01660        YNVSSK-D----QKNT-------KSKSWREKMDIIKRRREESRQRKSKDSLSDRNTL---
KNAG0B03710        RIN---------GHD--------EIKKWKLKMKKFKKSNGHTADGSKETF----------
ZYRO0D12540g       TALKTI-S----GSDR------QRNKKWKGEFKRRGHGNAIRRFADDKG-----------
CAGL0K07271g       TLLKTA-S----GIET---SHIETPSKWGFRSIKRHKNKHKSKGSLTNGDKNRHRRTKKN
KAFR0C05390        LVETDV-------------------KKWKRKISLFKKRKSNSHHHNHNQHQDSDSF----
KLLA0A01782g       VLLQTLNS----NIDE-------EAIKIKKNLAKVRARQRKKSTSHN-------------
SAKL0G04906g       TLLRTL-S----GLDD-------ETMMWKRKVEKFKRKRRAKKEGKKLDNN---------
KLTH0G03740g       SVLKSL-S----NFDE-------EALYLKKKVEKFKRKRLTKRKKNEPN-----------
Kwal_47.18646      SILKTL-S----NFDE-------EALYLKKKVEKFKRKRLAKRKKNEPN-----------
TDEL0A03900        VILISF-S----NLDG-------ESKHWKDKITTFRRKKNHRQHEKG-------------
Smik_13.145        TLLKSL-S----SIDNNTHGTNKDRKRWKFQMNRFRNHKNSGSASMDKSQR---------
YML006C            TLLKSL-S----GIDNPTHATNKDRKRWKFQMNRFKNHKNSGSAGTDKSQR---------
Suva_13.156        TLLKSL-S----GMDNHTDSNNKDRKRWKFKMTRFRNNKNNGSTDIDKSQR---------
Skud_13.148        TLLKSL-S----GIDNHTHGANKDRKRWKFQMNRFRNNKNNNSTNTDKSPR---------
NDAI0C01070        DVHINI-----------------DEKDLNLNQAKLKNKSDYKSKETNGK-----------
NCAS0H02550        TLLKSI-S----GTGT-------DKKRWKDRLKEMKKKNKSSQEDHSL------------
                                                                               

TBLA0G00940        ----SITS
KNAG0C03240        ----CNLQ
ADR198C            ----CLIM
TPHA0K00540        KDSKCVLM
Ecym_4061          ----CAVM
NCAS0F01080        --------
NDAI0H01590        --------
Kpol_1023.99       A---CSIM
TBLA0D01660        ----CNIM
KNAG0B03710        ----CSIM
ZYRO0D12540g       ----CIIC
CAGL0K07271g       ENSACVLM
KAFR0C05390        ----CNIM
KLLA0A01782g       ----CSIM
SAKL0G04906g       ----CVVM
KLTH0G03740g       ----CLLM
Kwal_47.18646      ----CLLM
TDEL0A03900        ----CIIM
Smik_13.145        ----CVMM
YML006C            ----CAIM
Suva_13.156        ----CAIM
Skud_13.148        ----CAIM
NDAI0C01070        ----HKLI
NCAS0H02550        ----CNIM
                           

FASTA FORMAT for MUSCLE Version 3.6

>TBLA0G00940
MPIPATQTYSIVDDNDIEYN-LWTWYLNNIEEKTFHEFNEIENKEKYSKLKKLIDKKLFT
VTNI----------------------NTKKVKNIIFLTLPKTKNF---QTRDSYFYLQKY
LELIFSVQQLYITKLQNNTSTT------PSCNYCLIMDPILNFQNTTFKESYDSILSHIK
SQKNKIKRNRELSTKNSNSSLLIRSLKNKSHYNSMTNCHSATMLNYSFYSNSNSRTTNYT
NNNSSSKKSFSIVYQP------------------------------NANANANINASLDE
ELNKIAISTPSSQSIRSENLKRHGYSND------------------------------DD
DDDNESEGDVDSIVIDFPRRFTRSTLLSSTSSNNQNNYTNTS---------------SKS
LLNVNSPPLSEINSINSFEYFD--------SENDS--MSPLTRTDLKDRTISEVPLIGKK
DNQLKVNEELIKTTFKAFSKESI---SITTSSSSASSSSLNSGSISTSQSSITHYQPIIR
EFTADTGSRRNSHSSTSSFVRATNDNETFLTNTFVSSHNNSGSSIINNKFNNNMNSSRNS
STTTSSSQLLNISRQHATTSFEGNIIRYGSRSTEEVSLDGNIYNQTYYSDSNVDSVSSSS
SLYLSKFKTAASNTS-SNFDQENRRMNLNCIILKKIGNTNGDFFTAIKEYN------ELY
SKWLIFDSTFQTEKSQLVSFDKLLEI-AKSFSKIFFYSYNNTVVKNETS-----------
-------------------FQNRKTEILDINLTPS-------TSKDNNTKADDFIFFDDL
KEKELSLEIHGNEIDED-------------------EIYHEEKNYALEEEHQQRELENQG
VAINQETYSCSTSISSNSSSSNSSSYLSD-------------------------------
---------------------------------------------------HNNKTNELG
TSVES-------NNDE-------ANKDFSKDFNHFENA----------------------
----SITS
>KNAG0C03240
--MMHYMNYVVGKNQCRESNNFWFWYIDNLVAGNFEEL--NDNLIKRNQLCSFLAHYFGG
KQ------------------------TTKLQRRLLLVTSPYGLRNGSLDEHLSKKLLSST
FGT-------SIDEFL----TF------HGHNGWLTIFPISNSDEKLYEFYKQDLYCMG-
--------------------------------YLMEECERGIISTPEFGWLSKTENAE--
----------------------------------------------EEDCSDYEDE----
------------------------------------------------------------
---------LEGLTINFAKQFKQNICENAF---------------------------AVN
PILRTLTDTSDTLSLKSFE-----------SYEDS--FE---------------------
-------------IGYCHEERDC-------------------------------------
----------------------------------------SCRAL---------------
---------------------------------------------------------RHY
PLHRVQARVNHVDNYNRDL-----TINVVSLLGKD--DASGKLWHAVRQLQ--------D
DDWVIYDADFSLNNLENCKLEDILLNSDGACQ-----TM--VIL----------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----CNLQ
>ADR198C
--------------MLQDYHGLWSWYLGNLRKGRFEQL--VGDEARYSQLKAFLRDCFAH
--------------------------STGQERRLQLLSFPASVPC---DYKILEEFIRQQ
GNI-----SVAIPRVH-AT---------GTEKHYLV--------DGNYMVHA--------
----------------------------------LEGCNLALTENEPFYTDSMSIEERSE
IVS---------------------------------------------------------
------------------------------------------------------------
---------GMSLVFDFKPRFEHSTSNPVHSMRSSSSEM------------------HSG
SVRDAAFSGLDDMSIRSN------------ESCES--FS------------------GQ-
--------ELVRVLTHEGDSQEY-------------------------------------
-------------------------QCDSTETRIFRESYSDISSL---------------
---------------------------------------------------------SQF
SNHSVFPSLSITNDF-SKF-----RVVLQSILVYD--CEKDRINTAVRQYNNNPNIANCS
DDCLLYDNKISLITFRILSLVDLMEL-NRAHPKMLFYSV--AEIFNSSP--RCSAAGCCA
----QVHHSQPQLLQRNS-FSASTLSRHSLRLLPT-VTSANTIERHVRTDVADKGKIPNS
PAFCWQKSVDYTEYYQDQLFTRELGLAHNP--------SYSSRSSNSEQP-SERLLPTDS
KAVNPIQLSRHVTPVIFSSIQASADVDFE-------------------------------
---------------------MRASVATKASSRSGLDKIST-RGSF--STARQINTDTLP
TLLHSI-SHRKYGLSK-----PQIGKTLKHKWQRWSSSQGHMT-----------------
----CLIM
>TPHA0K00540
-------MVLFDEIKDDKYSSLWTWYLNCIRNGEFEEL--LKEEDKYRSILNKIRETLQT
HARNIEMEEED---------------ANISDGNILFLSLHYTLDK---DKEIIDDFLVDN
FPN-VDLSNIVIREIC-NNNINSEHFKKDHETYYMVIDSLNKLLTTSIEEVSVSCHRD--
--------------------------------DTSNIDRYKEQNSEFEYVNQSTQAK---
----------------------------------------------DLDEEGSYVSSSEN
DS----------------------------------------------------------
---------GLSIELNFKTKFNRNKFQNSTTEIAKAEANHAV---------------VKP
SNNASIYSRSDIESIDSYSDLNS-------RNLNT-HYD------------------GQ-
--------SLKLTHHKDNLLKNT-------------------------------------
------------------TSSLDSGQNDKAVERLDDEATSDSMIV--SDVFSSGAYSMSN
-----------------------------------------------------LSINSQD
RLLSLLPSIEMQNSY-GEF-----KLVLQSMILIN--FESGESFTAVRQSNSLIHEATED
DEWLLYDSKFSMDNLEIVTLNYLMDI-YADFVKIFFYSM--VIINLEYP--QAITFATDK
----HINNNLINSDG----SSANLSLDSNISPLASNFLSVNDKEVAVSVRNPLLPYIPNS
DDNQHNNNNKTTFEKPSSNRDDEDSDCDSVLEYPIPEIFSPDTIASNKAT-ALRSVTTNN
SESTYKVLSRTYTGDKSIGRNTTVTDGGD-------------------------------
--------------NNNETLLKLLTITPTNHFDTDLSKYSTTLTTM--TTVERSISQKSS
TNNDKQKSSSKSSIKS-----KSKQGHFDNKADTVVNNLKGIKQQIHKQGHASKTKSSQL
KDSKCVLM
>Ecym_4061
-------MVENSGCLLDDCNGLWSWYLHNLRCGEFEEL--SSDIVKCRLMKRLVKEYSGG
--------------------------TMSASNRVLLVSVPDDIRQ---GASILEEFLRSS
LPGMREVRDGNITKLTGRKDLL------NGEDHYLINDT-----KGGVAGVGLTANRPVE
S-------------------------------FGSHFQRQDQCDNEFSFGHSNASLEETL
NVSLCANTGLENVAGI------------------------------STQLKGIGFDPVSN
DISYMQQNIDVDRREHTLDGGGVG----------------------------------DT
EVASEKPRNGERFTTSFKANSLTAVDNSKLFTF------------------------GLS
SSAISTCKNSEEVSIRSS------------ESYQS--YD------------------GE-
--------VLARTLTREEHIQGS-------------------------------------
---------------------------CCPTEHRHEELYNEGDST--SELSSAC------
--------------------------------------------------------NSVS
SDCSIFPSISISGDE-GDF-----RIVLQSILIYN--TTLDQLLTAVRQSNNDTTVADIN
DDWLLYDERFSMNNIQMVSLIDIFEM-NGVFPKILFYSV--VAIPCNNT--ASKEANSCA
----EIGKKNASNISN---WIYSCISQNTLSQQAT-------TADSAFVFGGPRHYRWHS
SEREEHEPLAGDGDSVHREGNRASPLTSGA------EIVTNNIPMLSTLPVHSKAFSRTG
SVSEPTKTRVNSNREIHKCESHSSITESR-------------------------------
----------RKLSDDNEDMFRSKYIISKNPSKNGLTKISS-LGSLSLAHRERMFSCSLP
GMLHTVFNGTYASDEH-----PLAVPRKKVRMPSWRRLHKQSCGKQSCGKRQGFVC----
----CAVM
>NCAS0F01080
------MIDSHSKNYPDDIDDMWSWYLSNLQSGNFEAL--VNGSVRQQHLEAYFKSQFT-
--------------------------SGNEGSKKILLSVPSMLCQ---EVSIKRLFLGSI
FNE-ERLQYINVMEFS-KSPKQ------TEKKHYLLTDALSGFNEAAFIESMEFN-----
--------------------------------QTEENEQSVYIEGMEINKSISSICLWPQ
EETNMDLFYASNSMDH------------------------------TMENEE--------
------------------------------------------------------------
---------EGAIILAFPSLLNNHSK-------------------------------LHN
YVSHRTPATSEDISIDSEKY----------DDVDS--YI------------------HA-
-------MSLMRVNANCANQIQS-------------------------------------
----------------------PSEMMDESIDSLTESIISSDEIK--EDDSKLTREENLR
--------------------------------------------------------SASC
NFHSNIPTQTFSYKS-GQL-----RFVLHSLLIQN--AQSKETFTAIRQRSSDPNTANIL
DEWLLYDSKFSLDNLEMGTLQDILLS-NKGNSMLLLYKT--ILISK--------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------
>NDAI0H01590
---------MSEDNIKKDDNEVLSWYLRNLREGRFENI--IEDRAKNYHLNTILDRQLFD
N-------------------------KQYGATNKILVSTLTSIDE---IVSIKDIFLGQL
FDH-ERLQYIEVEELK-SLKGD------NKETHYFLTDHLNSFNDLLLEEERLQTY----
--------------------------------STNHSQHYFHRAMKNEKKKKKRKKKKTL
VRHLVLMRRNKRTMKK--------------------------------------------
------------------------------------------------------------
---------QMPYSLIFESRLRQSNR-------------------------------ISK
LGHQYTPYHSDSISINSFGS----------QNDES--FS-------------------H-
--------ATSLTRVKCNEHIEE-------------------------------------
-----------------------------GSSEFSKSLNSLSTDF--PSSIEKSEFEKKE
------------------------------------------------EGDKILMDYEEA
LSVPVVPSISCHHPY-GQI-----RFVLQSIVFKS--VRTAELLTAIRQSSADRIVATSS
DEWLLYDSDFSLNNLEISTLQDILYP-NYENPRILFYTM--SVVS---------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------
>Kpol_1023.99
-------MSSDGNGDATKEIDVWTWYLCHVRNGSFEEI--LGNEDYYKLLKNNLVDDVFN
--------------------------IDKGNKIFKLISIN----------YLNNNILLDY
YNN-----IVKKTLLL-LNKSN------SIELHYLVINGTSSHS----------------
------------------------------------------------------------
----------------------------------------------NDDTNSSI------
------------------------------------------------------------
---------ASSIEINFKPKLSSSLNANAITSVNDNQK-------------------KSN
QSPYSSQNTTELSSIDSFQYSEDVESLPSLSYEKN--PN------------------NN-
--------QAKYLISNNEQQDAA-------------------------------------
----------------------ADTNADAEGDVNVEDIYLDDSDS--DSLSSFPPYFIND
P-------------------------------------------------------NFGS
YFNTVLPTVNLPDPY-ANF-----QLVLQSILIYN--SDSDELITAIRQSNNEQDSADID
DDWLLYDSKFSMTNLQILSLNELLHI-NKDYPKILFYSL--VSIPNVTV-----------
-----------------------NISNYENSSNPHLEDYINHSDDSLSIHDTPQQFYPMI
VNDNNNNININNHNNTRRS-SVDYYDDSIPQQFYPDDMNIPTKVNTNTTI-AHRSYRTIT
N-GSSSYINDGQELQNIITLTNTVGTEYP-------------------------------
-----------------------------------LAKYSTALTSS--SKAERSKSRLIN
SSLDKISSVSNKSSNKSSRKSNENKNDLKKNIKNVDRLSSNKKSTSNKRSKSKRKSGKNS
A---CSIM
>TBLA0D01660
MPVTKPKPVQVNDYYDNDNNGLWSWYLSNIRNGMFEEL--TENILKITLLKRFLKENFQQ
DINSTSQ-------------------HSTNCTKILFTSIPDNIHQ---DLPILENLLKDY
FDL-DNLDNIQILKLT-QNRCY------NHENHYILKDILDNFGNTSFFIHDGTKQKIPP
LKHKPDSNNNINNLDNLDIYRDEDNSIINSDDQQSECPSLTPLNSIRSSHAYSAKKSNSI
TQENSKTNFLKLSQPAIDPLSLSYGPSNPSSFQGNSLLSLRDEAKNCCNNDEQQNGIVVA
ESFLNKDPNIETVDDFDGSINSHPPLIEHFLDTNKIDEDNTEINILDSNYSKEFEAKIKD
DGGTDDEETDRSLFFTFKHKTLPESEKALSSQENKCD--------------------TTL
IKTDTNLPTSEDISFDSFNTSNNVLE----RNETS--YI------------------GH-
--------PLSLTITHEEDQNQK----------------------------------IEQ
QLLYRGDNSQNFRTDNIENRNMHNKDGLSNSSDKVSELSKLSDSL--NSLNYSVTESNSS
---------------------------------------------NLLSASSSNDSSSSY
SAMSILPSISISDSL-GHF-----RLVLQCILIYH--PHAEKTYTAIRQSDSNRDVADIQ
DDWLLYDLKFSMDNLEILTLQELLDF-NRDYPKILFYTL--VAINDNSS--YIRTNKNIS
----E--------------INELTNNLKNLNCKPSGDDRNKKDNQKINTEFNTTRIHSNH
LIDHSSSEDIPRQLYTTLSSDEEYGEIEYP---EGLEMYEPSKIKSNTTTIAHRSIRTVN
SIGEWAFHRTDTRG-TKDTKNISINSYVEPFSRSPSPFEYIISSHIKDSTTNETENITTT
AFITDYNTKYATQKSEISKLVLQPDNNQAGSNTLILDKIKNRKRQM--HPVERSKSTPVP
YNVSSK-D----QKNT-------KSKSWREKMDIIKRRREESRQRKSKDSLSDRNTL---
----CNIM
>KNAG0B03710
----MQKSIRVNDYYDNDDNGLWSWYLQNIRSGDFEEL--THNELKYTLLKRFLKNHFTS
--------------------------LEGINSKILFISIPDKVHS---DISVLETFLKDY
FHL-EDLQNIKIQKLT-TSNCY------NHENHYLLTDTLNNFNDRKFLRYLNPGRKFEN
SGDMA--------KLDGVSGPLSIYGTTTSTTVKNEDDFPEEVTAEPATTTSTSTNASSL
VSNHAPIQNLDKSHDLLI----------------------------IQNSTGLINGKGAS
EPIIEDKTVSNSTTCNNNGLQPNGISNKQNGIKSERIETPNESA--------------SS
ESSGLFEDGASSIVLDFPRSKVQAQKRKVRSARSSVSGSNASNNPLLNT--------ALN
NSNLYTPASSELVSFNSYYNEEE-------DASSTMIYN------------------SQE
GRSGHMDHPLTRMLTRSDSQMLQ---------------------------DNETNSDQED
SNSELPSVVETADDAPVVGAGAGTGTGLNSRPHGISCVSSVSTGSFTSSFTTSSSSSCST
---------------------------------------------------SMSTSSTVS
SHYSILPSITIKDTE-GHF-----RLVLQSVLLQR--ED-KAIFTAIRQSNNKVDRATVQ
DDWILYDSDFSMNNLMMMTLRGLFNF-SENMSKILFYSM--IIVDDAET-----------
-------------------------ADDMLDEEAT--------HSGDVSDTQPQLMFDE-
--------------------EDSDSGVQEP------QMYLPQKTASHATT-AHRSIRTVN
SIGEWAYKKKSNATSNHDAASVGSQGNST-------------------------------
-------------------------LQPIISKPEHIEKHKEDVRKL--SVVERWKSLPSK
RIN---------GHD--------EIKKWKLKMKKFKKSNGHTADGSKETF----------
----CSIM
>ZYRO0D12540g
----MHKSVRVGDYFSNDDNGLWSWYLTNIRNGDFEEL--TRNQLKHSLFKRFLRTYLEP
TL------------------------NERKDTKVLIVSIPEDVRR---DITLLEYFLGDY
LNL----DNMEITKLT-TSRIY------NHENHYVVMDKENNFKNSNFLHFASTNIQ---
-------------------------------------TGKGFTGGELAGTTVAAQAEKNI
SPTESAKFRAGQGLEP------------------------------SDDTEGD-------
------------------------------------------------------------
---------EESLVFNFTHRDHHLTHPLRANGKEQEEAVGVSPSWNPQ---------QQQ
RLQEHNASNDEMASIDSYNLGSNSS-----RVVES--FK------------------GE-
--------PLTLTMTRTEDFSSS-------------------------------------
----------------------------DEYDSLASSPSSSDTDL--SSF----------
---------------------------------------------------------ESC
SLMSILPSISIADSF-GHF-----RLVLQSVLFIN--PTSNEIFTAIRQSNNKPTKADVD
DDWLLYDSQFSMHNLQMLTLQDLSEL-NKGCPKVLFYSL--VEVVDTPS--LEDADTEC-
-------------------ATISNTASTSLSSAPT----------STSVSCEPRVFFPSN
VNGDNSG-------------------------------CRLAKGNTNSSTLGHRSIVTTN
SAADWRRQSVESNASIRKYDSTAETYKGL-------------------------------
------------------------------------------NATHAVGIMERTRSTPLP
TALKTI-S----GSDR------QRNKKWKGEFKRRGHGNAIRRFADDKG-----------
----CIIC
>CAGL0K07271g
----MSKSVRVGDYYGNDENGVWSWYLSNLRSGDFEEI--IENKLKYTLLKRFLNSNLLG
NFSPESP-------------------TRFINKKLIFVSIPEDVHQ---DISILELFLRDY
FHL-KVLDNNQIHKLT-QDKVY------HHENHYFLMDELNNFEDPTFLEFGKSNWKMEG
TAGTVYDPQNKENTTDALVTEATAKIDHKISSSNTDDSRFDTLVNDTKDDSSSHEYNAMN
LNEQDSITSSNNNDSLLSSLSTGGEDSLNQELRRQSDHDESSSIIDQTNDNRKSYSNADT
IRSKMIPSEGNISIDFDQGTDRESTNVDN-----------------------------SN
KRTGLDDDGASSIVLNFSHNRNAHKRKTKIDSLLG----------------------ERY
PSDFYTPPQSELVSINSC------------GSAED--YT------------------GQ-
--------SLRLMVTKNGTDSKD------------------EQPGDNPNRSKTSVNGHIA
SPLSDIQNVSINEANMGGQNDQASFSDNESESMYSSDLESEDGEM--DHYNAS-------
--------------------------------------------------------GSDI
TLLSILPSISIFDTL-GYF-----RLVLQSILIQD--PQTKEVFTAVRQSNNKPTIADIT
DDWLLYDAEFSMHNLQILTLQDIMTI-KKDYPKILFYTM--VVI-NDRS--EIACEFPYN
----GAQFTKAPSPI----TNKSHEVEKEELDQPT----------------EVQAYFPGN
GQAIKDSIKPNNRDSLTFD------------------LCQAERTKSNMTT-THRSIRTVN
SIGDWSISRDTTGI--ATRAATNTSGQYD--------------DHYQ-------------
-------ALKFDESSKERLIQGRKDGSGGKYSKHQISRVNTNGSSMPLDSVERTKSLPLP
TLLKTA-S----GIET---SHIETPSKWGFRSIKRHKNKHKSKGSLTNGDKNRHRRTKKN
ENSACVLM
>KAFR0C05390
----MPNSVQIHDYFDNDENGLWSWYLTNLRSGNFEEL--INNKLKDSLLKRFLRNQVD-
--------------------------INDQIKKILLISIPDHIFS---DINVLEIFLSDY
FHL-NDLSNIKIIKLT-KFNVY------NHENHYLLIDSVNNFKDETFLNYVNPQ-----
--------------------------------PSTNASNKFIPSIRTGTSASIPENDIPL
APIRNI------------------------------------------------------
------------------------------------------------------------
---------DSSISIECEH--------------------------------------EEY
DSSYSCSSSSDIFSVHNNNNNN--------NNNDG--ND------------------NN-
--------DILYEGTEFHENDNA-------------------------------------
-----------------------------DYETYSEDYFDDDSEF--QNY----------
--------------------------------------------------------SISE
SNCSILPCVSINNEAIGHY-----RLVLQSMLICN--KENLDLQTGVRQSNNLINYANIN
DDWMLYDEKFSMRNLNILSLKDLSIIGNVDSIKILFYSM--IDVNNQRS-----------
------------------------------------------TTQHLQLTFQDDLKIAKT
TSN------------------------------------------------GHRSIRTII
TDGETIYKRKNKNKLKLNRFESMSS-----------------------------------
------------------------------------------------TSLERWKSLPLK
LVETDV-------------------KKWKRKISLFKKRKSNSHHHNHNQHQDSDSF----
----CNIM
>KLLA0A01782g
----MPTSVQVKDYYENDYNGLWSWYLSNLRNGEFEEL--TGNELKHGLLKRFLRDQFQA
--------------------------TGPLNKKLLLVSIPDEIHQ---DIKVLEEFLSEY
FHLKDDHTNIVIDKLT-RGTVY------KHENHYLIQDKLTNFNDEWFLEM---------
-------------------------------------KKDVSISGNSSKDATDSA-----
---------ENCGQEM------------------------------EDDSPRRDSDSSDS
YSIL-----------------TGDTF--------------------------------DT
E--------SHSIVLNFKHPE--VMVKPITKTTQRIV--------------------RIS
PGNNIGSPAESQVSIVTHG-----------DDLES--YR------------------GE-
--------ALVQTVTRAIDEDEE-------------------------------------
---------------------------DEDDDDHHHDVESADDMK---------------
-----------------------------------------------------------S
KDISIPPSISISDNF-GTF-----RLVLQSILITN--KETEQIFTGIRQSENDRSNADIN
DDWLLYDTDFNLGNLQMLSLYDILDF-SKFLPKILFYSM--IHVKDSVD-----------
-------------------DNTELSLQHLITVNNT--------------LTNGNMYSPHE
VDDSMSELSSDNSIECYTG-NSNDSIADEP----VIGLYSPATAATA----GHRSIRTVE
SIGAWALNRSNTKKSMETVQNTVSRDSRG-------------------------------
------------------------------------------------NFMNRIKSQPMP
VLLQTLNS----NIDE-------EAIKIKKNLAKVRARQRKKSTSHN-------------
----CSIM
>SAKL0G04906g
----MPSVVKVKDYFENDYNGLWSWYLSNLRDGHFEEL--TNNVLKFTLLKRFLNEHLMQ
D-------------------------IVQFNKKMLLVSIPDNIHQ---DITILENFLRSY
FHL-DDLQYIQIKKLT-DSQIY------NHENHYLISDNLNNFHDRSFLGFGQKKHDNVR
--------------------------------PQLSYNGYSVLSGETGYASLRTTEEQN-
--------GTHRPSGV------------------------------VEQCNGNSPATPRD
VTAV-------------EPVKSSE----------------------------------DE
EDQE-----SGEIVLNFPHKPPKN---------------------------------IIN
QREQEVVTTSEDVSINS-------------EDASS--YD------------------GE-
--------ALIQTITRDEDASSA-------------------------------------
----------------------------DEDNSNISELSSVDHSL--NSLSYNSDIS---
--------------------------------------------------------SDDY
SMASIFPAISISDTF-GTF-----RLVLQSILIQN--PDTREIFTAVRQSNNDPNVAHIN
DDWLLYDEKFSMHNLQMLSLHDVLEI-NRFFPKILFYTM--VMLDTEEI--ADEAHAYIP
----NDPHLPPPSQGI---ASTSTLSQNTLRLLPT-------ATSNVTYTRHNELLNAAA
TSAQDAENYFPEDNHD----DEDDQEVNGV-----MPLYAPTRTNSNSTT-AHRSILTVN
SIGEWAFHHNEPYPQNNHSNISFADQNTS-------------------------------
------------------TAGKMKRVSSKGSSKNTLQKTTT-VGSL--SAVERSKSTPLP
TLLRTL-S----GLDD-------ETMMWKRKVEKFKRKRRAKKEGKKLDNN---------
----CVVM
>KLTH0G03740g
---MLESSVKVDDYFDNDENGLWSWYLCNLRHGNFEEL--NNNQLKFALLRRFLNEQLLS
D-------------------------SVLFNKKLLLVSIPDAIHE---NTNLLENFLRDY
FNL-DDLQFIQIQKLT-QDRCY------NHENHYLISDSLSNFNDKSFLEFGAKSRRPRD
DTEIL---------------------------GQDSNNQYSIISGETEADPALPAAISSE
SPASVHLSKVVQEDVPL-----------------------------RTHNSSSRLLIVDN
QECASSTDESDDA-----------------------------------------------
---------STELVLKFEHRGMLGKQRLHPEVR------------------------KMA
STEEAIDTPSTGVSLRS-------------DDVSS--YD------------------GE-
--------VLTQTITRDEDSVSL-------------------------------------
----------------------------MIEDDSISELSSVDHSL--KSLSYDSEYS---
--------------------------------------------------------QGSS
SLTSIFPSISISEKF-GRF-----RLVLQSILVHQ--PDTRQLFTAVRQSNNDPTVAHVN
DDWLLYDDKFSMNNLQILALHDVLEM-NKFFPKILFYSL--VMISEEVA--ADAQDYYPS
----KPSKSPQPT------ASNSTISENTLKVQPTLTHSLTNTNSYLSTGAYNSSLSPFY
SSVQHNHEQGEEDDYYDDDKNSEGVVV---------PLYSATRTNSNKST-AHRSIRTIK
SIGDWAFHHDSSSRKLSPNDSTLEDSYQS-------------------------------
------------------VEGNLMKVRSKSSVKSGLTKTLT-LGSL--STVERSKSVPLP
SVLKSL-S----NFDE-------EALYLKKKVEKFKRKRLTKRKKNEPN-----------
----CLLM
>Kwal_47.18646
---MPENSVKVDDYFGNDENGLWSWYLCNLRHGNFEEL--NNNQLKSALLRRFLNEQLMS
E-------------------------TVPFNKKLLLVSIPDAIHE---NTNLLENFLRDY
FHL-DDLQYIQIRKLT-QEKCY------NHENHYLICDNLSNFNDKSFLEFGIKRVGACN
GNELS---------------------------GETSNNQYSIISGETSTDVTKSSLEIPL
SPEFIRDSKVTQEDPAL-----------------------------QTQSTSSRSLRIEN
SGSLNSSDESDDT-----------------------------------------------
---------ESEIVLRFKPRGTVGKRQLYSEVK------------------------RSP
LANDYIDTPSTGMSLRS-------------EDVSS--YD------------------GE-
--------ELAHIASRDEDSASL-------------------------------------
----------------------------SADEDNISELSSVDHSL--NSLSYDSECT---
--------------------------------------------------------PGSS
SMTSIFPSISISEKF-GRF-----RLVLQSILIQQ--TDTRQLYTAVRQSNNDPTVAHVN
DDWLLYDDKFSMNNLQILALHDVLEI-NKFFPKVLFYSL--IVVTDEVA--IDAQEYYPS
----ASHQSPERT------VSTSLLSENTLKLQTTLTPSLTNTNSFLSMGVNSSSLTPFY
ATAQGSPDRANDEDDYFDD-ERDGKTDDGE----VFQLYSATRTNSNKST-AHRSIRTIK
SIGDWAFHHDSTSRRTSSAASFLEDPRLD-------------------------------
------------------DEGNLMKIKSKSSVKSGLTKTFT-LGSL--STVERSKSVPLP
SILKTL-S----NFDE-------EALYLKKKVEKFKRKRLAKRKKNEPN-----------
----CLLM
>TDEL0A03900
----MQKSIKVDDYFDNDDNGLWSWYLSHIRSGDFEEF--SRNKLKVTLLRRFLNSHFDS
NRS-----------------------HYGQNTKILFVSIPDKVHR---DLSLLENFLRDY
FHL-EHLEHIEITKLT-QSPVY------NHENHYILIDKLNNFDDPTFLQFASTRWQQQL
SNQQS---------------------------NRLSDRQSGSIPNNDSSVEFNKKPCGTV
TERSRAGSLSSFSANS------------------------------GPSDLGSDTGGLQN
IEVRSIQSESTAGQFNQIPINSINDQ--------------------------------DD
E--------NESIVLDFSHSLLRKQMEEKKSQAQRIRQQEYSADTNQTITNLHTNDKDTN
ASDIYSPAISENVSINSYEDESMRDGSDSITAKDS--YS------------------GQ-
--------PLALTTTHYKDDTQG-------------------------------------
-------------------------SSDDSQEENISELSSVSRSM--KSLGSQTSLGDNN
-------------------------------------------------DYENNSDSSDY
SVVSILPSISISDAR-GHY-----RLVMQSSLLQD--PETKEIYTAIRQSNNQPTVADVD
DDWLLYDSQFSMNNLQMLTLQELLDM-NRSFPKIIFYSM--IVVSDEQQELLQWSNG---
-------------------MTQKEDTADASSSIPR-------ADSYASMSRDPQQFYANM
DDD-----------------DTSLSEQSGP------MMYAPTRLQSNTST-AHRSIRTVN
SIGDWAFVHKNETKRQGSHRGSTSQAGVS-------------------------------
-----------GVQFDSDNQNLQFLHPERVHSRNGLSKVST-MASL--NPVERSKSTPLP
VILISF-S----NLDG-------ESKHWKDKITTFRRKKNHRQHEKG-------------
----CIIM
>Smik_13.145
----MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEEL--IGNQLKYTLLKRFLNSHFYG
DNSI----------------------SVRSNKKILLVSIPENVHE---DISILEIFLKDY
FHL-EKLEHIQISKLT-HSHCY------NHENHYLLTDNLNNFQDPTFLEFASTSWQVQK
NSKAL----------------------------NNNNRSLIHPPTISSSKTSNGQLKSST
SDEQWSNINTQTPTGT------------------------------RTNTNTRTITSPNT
ADICLT-SANRQSNNYAVPQDSENRN--------------------------------DG
EDAADDT--TSSIVLNFSHS---RALEPKTSRLPKIF--------------------PPY
TNEEYTPSHSEIVSIDSFAG----------EDVSS-TYP------------------GQ-
--------DLSLTTARCEDDNDQ---DDVEGHYNRTSNDLNDKSTNQIRLNMESSVSCTS
CSSSS-SSSIRYSLSSTSRASLKRESADHTNATYVSELSSITSSI--DNLTTSTTPEEED
---------------------------HLIHHNYDAQGYASREDEVEEVDDDADLSSSDY
SVLSILPSISICDSL-GYF-----RLVLQSILIQD--PDTKEIFTAIRQSNNRPTIASVT
DDWLLYDSNFSMNNLQILTLQDLLDI-KRSFPKILFYTM--VIVTESGQQIEEEPK----
-------------------NPNYGTREDMLKEQPL--------NSDLLLSHDPKQYFPNA
YNNDYDEYIDDEDDDD----DASLSEQSGP------QMYIPTRMESNVTT-AHRSIRTVN
SIGEWAFNRHNSVTKINKSNSNESDDSEN---------------NDDRLSSDEPYPMTQI
SNFNTSSSNFSHSLKKKNTSKVNSKINNESNSKSELKKIKNSINAM--SAVERSKSLPLP
TLLKSL-S----SIDNNTHGTNKDRKRWKFQMNRFRNHKNSGSASMDKSQR---------
----CVMM
>YML006C
----MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEEL--IGNQLKYTLLKRFLNSHFYG
DNNI----------------------SARPNKKILLVSIPENVHE---DISILEIFLKDY
FHL-EKLEHIQISKLT-HSHCY------NHENHYLLTDNLNNFQDPTFLEFASTSWQVQK
NSKAL----------------------------NNNNRNSIPPPTISSSKASNGKLESNV
SDDQWSNINTQTSTAT------------------------------RTNTNTRTLTSPDT
VDINVT-SVNSQSNNNDTPQDNENEV--------------------------------DE
EDA------TSSIVLNFSHS---RTVDSKPNRLPKIF--------------------PSY
TNEDYTPSHSEIMSIDSFAG----------EDVSS-TYP------------------GQ-
--------DLSLTTARREDESGQ---DEVEDHYSRVSHDLGDESIDQASYSMESSVSYTS
YSSSSNSSSAHYSLSSSSRGNPKRENIDHTNATYVSELSSITSSI--DNLTTSTTPEEED
---------------------------NLIHHNYDAQGYGSGEDDGEEVYDDEDLSSSDY
SVLSILPSISICDSL-GYF-----RLVLQSILIQD--PDTKEIFTAIRQSNNKPTMASVT
DDWLLYDSNFSMNNLQILTLQDLLDI-KRSFPKILFYTM--VIVTNSGK--QVEEEFK--
-------------------NPNYDNREGISKEQPL--------DSELSLTNDPQQYFPTA
YNNGYNDYIDDEDDEDDGD-DASLSEQSGP------QMYIPTRMESNVTT-AHRSIRTVN
SIGEWAFNRHNSVTKIDKSNSNELDNSKT---------------GESTVLSSEPHPMTQL
SNSNTTSSNFSHSLKTKNSHKPNSKGNNESNSKNELKKIKSSINAM--SAVERSKSLPLP
TLLKSL-S----GIDNPTHATNKDRKRWKFQMNRFKNHKNSGSAGTDKSQR---------
----CAIM
>Suva_13.156
----MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEEL--IGNQLKYTLLKRFLNSHFYG
DNNT----------------------SIRPNKKILLVSIPENVHE---DISILEIFLKDY
FHL-EKLEHIQISKLT-HSHCY------NHENHYLLTDYLNNFQDPSFLEFASTSWQVQK
NPKSL---------------------------NNNNNRHLIHASTASSSKPSNAQLKPNT
LDDQLLDINTQTSMTA------------------------------RTNTNTKTLTYTDT
ADPSLTQPECNNKGDNDMPQNNENEN--------------------------------EE
EDAGDDA--ASSIVLNFSHP---RTLASKANRAPKIF--------------------PSY
TNEDYNPSHSEIVSIDSFAG----------EDVSS-TYP------------------GQ-
--------DLSLTTARREDKDDE----------DRSSNGFDDESFEETSSSIESSVNYTN
CSSSSNSSIVRYHFNSSSRGSLGRGDVDHTNATYVSELSSITSSI--ENVTNSTTPEEED
---------------------------HLVRNNYDTREYISGEEDEEEVDDEEDISSSDY
SILSILPSISICDSL-GYF-----RLVLQSILIQN--PDTKEIFTAIRQSNNEPTVASVT
DDWLLYDSNFSMNNLQILTLQDLLDI-KRSFPKILLYTM--VIVTNSGQQQIEEENTN--
-------------------LNQQHREVDLTEEKPP--------NSELSLSNDPQRYFPST
FDDDYDEYIDDDDGGD----DASLSEQSGP------QMYLPTRMASNVTT-AHRSIRTVN
SIGEWAFNRHNSVTKINKSSSNESDNLKE---------------CGDRISPVEPYPMTQL
SNSNTVTSNFSHLLKNKNSYKRTSKGNNESNSKNELKKIKTSINAM--SAVERSKSLPLP
TLLKSL-S----GMDNHTDSNNKDRKRWKFKMTRFRNNKNNGSTDIDKSQR---------
----CAIM
>Skud_13.148
----MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEEL--IGNQLKYTLLKRFLNSHFYG
DYNT----------------------SARPNKKILLVSIPENVHE---DISILEIFLKDY
FHL-EKLEHIQISKLT-HSHCY------NHENHYLLTDNLNNFQDPTFLEFASTSWQVQK
NSKTL----------------------------NNNNRYLMHGSTISSSKTSTGQLKPNT
LDDQWSNINTQTSTAT------------------------------RTNTNTRTLTSPDT
ADLSLT-PTNGDNNNNDVLQSNENEN--------------------------------AE
EDAGEDA--TSSIVLNFSHS---RTLASKANRLPKIL--------------------PSY
TNEDYTPSHSEIVSIDSFTG----------EDASS-TYP------------------GQ-
--------DLSLTTARREDANDENDENESEDHYNRNSDGFHDEGNEQVSLGIESCVSYSS
CSSSSIGSSVRYSLSGNRRDSLRNGNVDHTNATYVSELSSITSSI--DNLTTSTTPEEEE
---------------------------NLVQNNYDAREYISGEEDGEGADEDEDISSSDY
SVLSILPSISICDSL-GYF-----RLVLQSILIQD--PDTKEIFTAIRQSNNKPTMASVT
DDWLLYDSNFSMNNLQILTLQDLLDI-KRSFPKILFYTM--VIVTDSGHQQIEEEHK---
-------------------SSSHRGTVDTSKEEPL--------NSELSLSHDPQQYFPTA
YNIDYDEYTDDEDEGD----DASLSEQSGP------QMYLPTRMASNVTT-AHRSIRTVN
SIGEWAFNRHNSVTKINKSDSNELDNSKE---------------GVNRNSLGEPYPMAQL
SNSSTTTSNFNHLLKKKNSYKLGSRDKNGSNSKNELKKIKTSINAM--SAVERSKSLPLP
TLLKSL-S----GIDNHTHGANKDRKRWKFQMNRFRNNKNNNSTNTDKSPR---------
----CAIM
>NDAI0C01070
----MQNSVRVRDYYNNDDNGLWSWYLRNIRLGDFEEL--TGNQLKYTLLKRFLNSHFYS
NATTTDTAIDDNNNTNSVND------IKPTVKKILLVSIPDKVHS---DISLLELFLRDY
FHL-EDLENIQITKLT-QSECY------NHENHYLLTDKVNNFDDPMFLEFAGSTWQGRP
NLHL----------------------------NNLDSLQLQEQNDDEEEKQREEREEKQY
IHKESRDPNEDSSI--------------------------------DNDTDEILITQPIT
TTTSLSHNNQAYTPDENEQLN-------------------------------------QT
EKHTGNAYDNSSIVLNFPHLRKHSKDPKQTIINEQQEE-------------------PLA
NNQYYTPPQSELVSINSFGD----------DDTNSMAYQ------------------GH-
--------PLHLVLTRQDEESST--------------------------QLEEDELGAKN
LSNTALGLNNNDNHMDDQSSGLEPSYENSEISIQNSGFDSYSNQL--QRFDDDTNEEIKK
PVECVRSIDEDDESDYNIIQGTRNMHVGDQNDSDEGDDEEEVHGDDDDDDDDLDDLSSDY
SVLSILPSISISDRNEGHF-----RLVLQSTLIQN--PITKEIFTAIRQSNNEPTIAHIT
DDWLLYDSKFAMDNLQILTLQDLLDS-NRTFPKILFYSM--VIVNESSPPINDDQHNYNG
MTALNSEYLSNKLESLEKTSSEEGKSINRYKYYPTLPKAGITAKNGEMIADVPEQFFPGP
PSDDENGKGEDYDDDYD---DESLMEQHGP------EMYLPTRMQTNVTT-AHRSIRTAN
SIGEWAFNRMNSNTTSNNMNVDDENKDPD-------------------------------
--------------------------------------------YMEDTSNDKYETSRTN
DVHINI-----------------DEKDLNLNQAKLKNKSDYKSKETNGK-----------
----HKLI
>NCAS0H02550
----MQKSVRVTDYFDNDDNGLWSWYLTNIRLGDFEEV--TGNQLKYTLLKRFLNSHFYS
NSDVTATESPQQHNNNNNTNNNNTQQLKPNFRKILLVSIPDKVHR---DLSILETFLRDY
FHL-EHLEGIQIQRLT-QSKCY------NHENHYLLTDTINNFDDPVFLEFAGSNWQARK
NLHLN---------------------------NHLDHRDDDRISPQSIDTHSALNKNDDQ
ILVTQPIDSTLVTPET------------------------------REKENLDDIDVG--
------------------------------------------------------------
---------GSSIVLNFSHTREHRKDKDPLNMVKQEEQSN-----------------KFS
PNMMFTPPQSELVSINSF------------DDGDSMNYN------------------GH-
--------PLKLTLTRQDEESIA---------------QLEQDKQAEYPTATTTTTATIT
ATNNNINNNTYHNLHDHKLTPEESIQSYEIGKSSITDMSSLKRSL--NSIGTDSSSSISR
----------------------REILNLDRTDIEEGEVDDR---DDEDEDEDIDDLSSDY
SVLSILPSISISDAIEGHF-----RLVLQSILIQH--PVTKEIYTAIRQSNNEPTIADIM
DDWLLYDSQFSMDNLQILTLQDLLDT-NRSFPKILFYSM--VIVTDAHHQPIQGPTSTAG
----PDLTTSYLSNKLESIAGDETNQRFENRYYPM---------ADDQVEDQPQQFFPQE
DDHDDDNMYDT---------DDSLMEEAGP------EMYLPTRMETNNTT-AHRSIRTVN
SIGEWAFNRNNTNGSSSKSAIGREDEDGD-------------------------------
--EEEETNHHNDGQTHDNNHHHNKKTGKKGSYGGAKNKRSGNIEAM--KAVERTKSTPLP
TLLKSI-S----GTGT-------DKKRWKDRLKEMKKKNKSSQEDHSL------------
----CNIM