MUSCLE (3.8) multiple sequence alignment

ADR195C            -------MSTAGQVKRSF----------------------------------EEQDGPYV
Ecym_4064          ------MSLAHNRLKRSLEDDDMTSSSSSGGST-------------------ATQLVFEG
KAFR0E03290        ----------------------------------------------------------ME
KNAG0C03210        ----------------------------------------------------MALTTGAA
CAGL0F03069g       -------------------------------------------------------MSKVS
NDAI0H01610        ------------------------------------------------------------
NCAS0F01100        ----------MSTTDE------------------------------------QQQQQQQP
TBLA0G00930        MSDTAVMPTNSSTIKRHLDASD------------------------------ANETASAT
TBLA0D01640        --------MVNSSITSP-----------------------------------NSNSNGTA
Skud_4.697         ------------------------------------------------------------
Smik_4.698         ---------------------------------MS-----------------EQVLANKD
YDR423C            ---------MGNILRKGQQIYLAGDMK-------------------------KQMLLNKD
TPHA0K00520        -------MSVVSNSKRVLDANI------------------------------GDSESSSS
TPHA0D02340        ----------------------------------------------------MEEYLDTG
Kpol_1004.22       -----------MDANNDIDF--------------------------------MDFLTESS
CAGL0H04631g       -----------------------------------------------------MAEVDNG
KLLA0A01760g       --------MSTSTAKRPFDNKRAGSPDDGTDSDS------------------GGNNSGSS
Kpol_1023.97       --------MTSVTVKRPLDESLTALSPNDNNSSILN----------------ASTDVDAS
ZYRO0D12584g       --------MSTTSAKRPLEPTVSLDFAED-----------------------EADDSPTS
TDEL0A03920        MERALPPLISRTSTRSNTSSMSAMSASTVKR---------------------PLEQSSSP
SAKL0G04950g       --------MSTVAATAPAATTSAASAAAAAAAVHK-----------------RPLDNEPT
KLTH0G03784g       ----------MSTVKRQ-----------------------------------LEASTPPA
Kwal_47.18631      ----------MTTVKRE-----------------------------------LETPTAAE
KNAG0B03680        --------MAATVASAMVTPEVHADRGRDR----------------------DLEVVDSG
NDAI0C01060        -----MTTVGTTTGKRQLDLIDQQQQQQQQFETQNANNTRPKDSTENA----TTNPMKKQ
NCAS0H02560        --------MSTTTAKRPLELDPNSRLQFAQSKEQQQEL--------------ERYSTEDA
KAFR0C05400        ------MSALTASTKRPLESTTST----------------------------DNDTDDKN
Suva_13.155        --------MSISAAKRSLDLVSSSS------LAQSDDSVSHHDEVENDHIHDDMHDNDDN
Skud_13.147        --------MSVSTAKRSLDLASPGS------LAEFDDSAAHHDEIENEHRHDSTRDDDDN
Smik_13.144        --------MSVSTAKRSLDLVSSGS------LAEFDDSKPHHEEIENEHTSNGTRDNDDN
YML007W            --------MSVSTAKRSLDVVSPGSLAEFEGSKSRHDEIENEHRRT------GTRDGEDS
                                                                               

ADR195C            GETKRRG----NKPG-----RKP-LDTEAKNRRTAQNRAAQRAFRERKERKMRDLEDQVR
Ecym_4064          GGSRRKG----NKPG-----RKP-LDTEAKNRRTAQNRAAQRAFRERKERKMKDLEDKVR
KAFR0E03290        TEVKRRV----GRPG-----RKK-LDADAKNKRTQQNRMAQRAFRERKEAKLKLLENEVD
KNAG0C03210        AETAKKV----GRPG-----RRK-LDVEAKNKRTQQNRVAQRAYRERKEAKLRTLEHKIA
CAGL0F03069g       KEGKKKA-------------GRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIV
NDAI0H01610        ---------------------------------------------------MKELEDKIS
NCAS0F01100        VVVKRRV----GRPG-----RKP-LDTAAKNRRTAQNRAAQRAFRERKERKMKELEDKIS
TBLA0G00930        KETKKKS----NKVG-----RKL-SDQEAKSKRTAQNRAAQRAFRERRERKMQELEDKVK
TBLA0D01640        TTTTSKV-------------QKD-SNAELKSKRTAQNRAAQRAFRERKEKKMKSLEEKVV
Skud_4.697         ------------------------------------------------------------
Smik_4.698         GIPKRKV----GRPG-----RKR-VDSEAKNRRTAQNRAAQRAFRDRKEARLKSLLERIE
YDR423C            GTPKRKV----GRPG-----RKR-IDSEAKSRRTAQNRAAQRAFRDRKEAKMKSLQERVE
TPHA0K00520        AASRKKV-------G-----RKLLNDSDVKSKRTFQNRNAQRAFRERKERKLKELEDKVL
TPHA0D02340        KDKEQNN-------------------ADYRMKRIAQNRAAQKAFRERKEKKMKELQEKVR
Kpol_1004.22       SIDSRKNYLNLSTSN---KIRKNDIDAEARIRRTAQNRAAQRAFRERKEKKMKELENKVN
CAGL0H04631g       GAQKSSA----SRKK-----RYQELDPETRMKRVAQNRAAQKAFRERKERKMKELERKVV
KLLA0A01760g       PASKRRE----RKPG-----RKP-LETEAKDKRTAQNRAAQRAFRERRERKMKELEDKVS
Kpol_1023.97       TVANANK----KKVG-----RKLLGDHEVKNKRTAQNRAAQRAFRERKERKMKELEDKVH
ZYRO0D12584g       DEPRKKG----GKPG-----RKP-LDSEAKSKRTAQNRAAQRAFRERKEKKMKELEDKVH
TDEL0A03920        MAPAAKG----SKPG-----RKP-LDEETKNKRTAQNRAAQRAFRERKEKKMKELEDKVQ
SAKL0G04950g       AQAKRKGTKPASKPG-----RKP-LGTEAKNKRTAQNRAAQRAFRERKERKMKELEDKVT
KLTH0G03784g       DLPKRKG----SKPG-----RKP-LDTEAKNKRTAQNRAAQRAFRERKERKMRELEEQVE
Kwal_47.18631      ELHKRKG----SKPG-----RKP-LDTEAKNKRTAQNRAAQRAFRERKERKMRELEEQVE
KNAG0B03680        AEPLKKR----THTA-----SKP-LDKEARMKRTEQNRAAQRAFRERKERKMKELEAKVD
NDAI0C01060        DLDNKTN----TEQSNGNSKKKQLLDPEARNKRTAQNRAAQRAFRERKERKMKELEEKVA
NCAS0H02560        GSRKKQEVSGTSNAAATTNMTKKQLDIEAKNKRTAQNRAAQRAFRERKERKMKELEEKVN
KAFR0C05400        AIPKKNN----ASKS-----SRTELDQEAKLKRTAQNRAAQRAFRERKERKMKELEAKVD
Suva_13.155        DQPRRKG----SKTS-----KKQDLDPETKLKRTAQNRAAQRAFRERKERKMKELEKKVH
Skud_13.147        EQPKKKG----TKIS-----KKQDLDPETKQKRTAQNRAAQRAFRERKERKMMELEKKVQ
Smik_13.144        EQPKRKG----TKTS-----KKQDLDPETKQKRTAQNRAAQRAFRERKERKMKELEKKVQ
YML007W            EQPKKKG----SKTS-----KKQDLDPETKQKRTAQNRAAQRAFRERKERKMKELEKKVQ
                                                                               

ADR195C            RLEEERSSAECEVQSLRGHVIALVRELRR-WRAR-------------------QQGAGG-
Ecym_4064          KLEEQRLQSEREVQSLRNQVVSLLRELKK-YRPG---------SPVLQE----PEPTGD-
KAFR0E03290        KLQLENLSKAEIIEFLKQNVMTLLGEIKN-YRKQ--TNKDKKLLDTIGK----LENDGM-
KNAG0C03210        ALERLNSYNEDRAELMAAHLRDLLGEANK-FRGE--KPRDKTVRELLTA----RDPTRD-
CAGL0F03069g       VLKGMNSKKNSETEYLKECLSELLTEVTK-YRPA--NEKDQGILKRLKE----IKADDL-
NDAI0H01610        SLEKIKDENSIETSFLRSYMTDLINEVNK-FRPK--NTTDSKILKYLSM----RNTHMH-
NCAS0F01100        DLERIKDNNEVESTFLRDYMMDLICDMQK-YRPN--NSTDSKVLKYLSL----KKKNQP-
TBLA0G00930        SLEEVHKKSEIESQFLRDQLKVLLGELQR-YRPE--RQNDAKVKEYLST----HKFDPS-
TBLA0D01640        ELEKVCRAHESETSFLRSQLILFGTELRKQHNTGNTPSNNNSISNYRNR----HKNSIA-
Skud_4.697         ------------------------------------------------------------
Smik_4.698         LLEQKDAQNKSVIDFLQSSLKSLLSEVTK-YRAK--NVNDERILAFLDD----LQEQQE-
YDR423C            LLEQKDAQNKTTTDFLLCSLKSLLSEITK-YRAK--NSDDERILAFLDD----LQEQQK-
TPHA0K00520        ALEQVNEAKELETNFLRSRLKSMADELKK-YRPA--QSSDLEVLEYLAK----KEQLAK-
TPHA0D02340        KLENINEKNEIETVFLRTQLLSLVNELKK-YRID--KNDDFRLKKIGSQ----LKHEKL-
Kpol_1004.22       SLENIHQKNEVETEFLRSQVLTLVNELKK-YRSE--TTSDSKILKLVSN----SRENTR-
CAGL0H04631g       DLENLTKLNEVETNFLRDQLSILVKELRK-YRPE--TKQDHKVLKYLEK----HKGGAA-
KLLA0A01760g       QLESLNKQSELETKFLRNQVTNLLSELKR-YNPELPKKRDSILLDYLAK----QRKASI-
Kpol_1023.97       ELEKVKQQNDVESEFLRNQLTLMIDELKK-YRPE--KSSDIKVLEYLAK----HEENGS-
ZYRO0D12584g       ALEELNQQSLVETEFLRSQLVTLVTELKR-YRPE--NPNDSQVLQYLAK----TENSKS-
TDEL0A03920        SLEQANRDTVVESEFLRSQLLTLVNELKK-YRPA--KANDLQVLDYLAK----HERTEP-
SAKL0G04950g       HLETVREQNEVETEFLRSQLMTLISELKK-YRPE--QSMDTQVLEYLAK----REEEKK-
KLTH0G03784g       RLEKVREQSEMESEFLRSQLQMLIAEIQK-YRPQ--QSSDSQVLKYLAE----AEERCKA
Kwal_47.18631      RLERVREQSELESEFLRSQLQKLLAEIQK-YRPR--QSSDSQVLNFLAKAEERRKSSQEA
KNAG0B03680        KLTRIQKQNEVESEFLRGQLVTLVHELKK-YRPE--TSNDSKVLEYLAK----HDNVPP-
NDAI0C01060        NLTKIQKQNEIESEFLRSQLITLVNELKK-YKPN--NENASKVLNYISN----SNSNSN-
NCAS0H02560        NLTKIQKQNEIESEFLRGQLITLVNELKK-YRDP--NPNESKVLEYLSQ----HNGNNK-
KAFR0C05400        HLSNIQKQNEIESEFLRSQLITLVKELKK-YRPE--TANDSQVLNYLAK----HENGNF-
Suva_13.155        SLESIQQENEVEATFLRDQLVTLVSELKK-YRPE--TRNDSKVLEYLAR----RDPNLH-
Skud_13.147        GLENIQQQNEVEATFLRDQLVTLVNELKK-YRPE--TRNDSKVLEYLAS----RDPNLP-
Smik_13.144        SLESIQQQNEVEATFLRDQLVTLVNELKK-YRPE--TRNDSKVLEYLAK----RDPNLH-
YML007W            SLESIQQQNEVEATFLRDQLITLVNELKK-YRPE--TRNDSKVLEYLAR----RDPNLH-
                                                                               

ADR195C            ------------------------------------------------------------
Ecym_4064          ------------------------------------------------------------
KAFR0E03290        ------------------------------------------------------------
KNAG0C03210        -----------------------------------------------------TLRRELE
CAGL0F03069g       ------------------------------------------------------------
NDAI0H01610        -----------------------------------------------NNPPNIDTLLELE
NCAS0F01100        -------------------------------------------------------SMKAT
TBLA0G00930        ------------------------------------------------------------
TBLA0D01640        ----------------SNHSNSSNHSNSNSISVPNSLSRHSSTSSIINQPNSMSMSMSMS
Skud_4.697         ------------------------------------------------------------
Smik_4.698         ------------------------------------------------------------
YDR423C            ------------------------------------------------------------
TPHA0K00520        -------------------YNHNANPIKEEEEVKEEEEDEEGEEGGDNIHANQSFEQESA
TPHA0D02340        --------------------------------------------NLNKLTKSSSSSSRLS
Kpol_1004.22       ------------------------------------------------------------
CAGL0H04631g       ---------------------------------------------GAGNGAATGSVSTST
KLLA0A01760g       ------------------------------------------------DSNPDFSAAANK
Kpol_1023.97       ------------------------------------------------------------
ZYRO0D12584g       ---------------------------------------------------DDSSQNKKD
TDEL0A03920        ------------------------------------------------------------
SAKL0G04950g       -------------------------------------DNSQDRSGGSANTSEEGADVSHS
KLTH0G03784g       APVEKRTGRNAARSSISTSNRDDSENASRSRSRSTSLSEHNTLDTSRPQRYSENSSPADQ
Kwal_47.18631      AAAAAAAATTAATTTGDSASRHSSDSLSNSRSRSTSITAQDGTGVPSHLRGSSNSSPADP
KNAG0B03680        ------------------------------------------------------------
NDAI0C01060        ------------------------------------------------------------
NCAS0H02560        ------------------------------------------------------------
KAFR0C05400        ------------------------------------------------------------
Suva_13.155        ----------------------------------------------PPNSNTNNNSEPIV
Skud_13.147        ---------------------------------------------TSNNSTNSSSNRPII
Smik_13.144        ---------------------------------------------SSSIKANHNNSRPII
YML007W            ---------------------------------------------FSKNNVNHSNSEPID
                                                                               

ADR195C            ---------ADAEPTAGYDVSWEH--------------------GAAGARAERRRLGGRR
Ecym_4064          ---------EEIQGKFGLNFPWEQ--------------------SSGEEDEDSLSMVITQ
KAFR0E03290        -----DATTLQHSPVSNYGSPPVL-----------------------------SHDEDDE
KNAG0C03210        AAEDAHSANEATAAAAVVADPVPQ-----------------------------ANDKPIS
CAGL0F03069g       ---KSVEVVPEQPSATNFMNSPTN------------------ITTAGSDKQADKTSSKKS
NDAI0H01610        KKRKEREEREQQQQQFHEEEQKQE--------QVSHEKNSHLSDTNTTNNTNTNQLPANQ
NCAS0F01100        SIDSLIEMENKKTDEISKESPDST------------------LNNNANNNNNNNNNDTNQ
TBLA0G00930        -VVSASNKNSPNDISNNTQIPSPN-----------------------------SSRFDDQ
TBLA0D01640        NPNANSNLTINHHHTNSTTTPYNG-------FANLNYSFLQTTSSTTAYNTNTSSPLSFT
Skud_4.697         ------------------------------------------------------------
Smik_4.698         --REKEKEASTKINETTETLPSFR-----------------------------------V
YDR423C            ---------RENEKGTSTAVSKAA----------------------------------KE
TPHA0K00520        KQKQEILSNIEKKKDFTFEYPKQN-----------------------------------K
TPHA0D02340        SLMEDLNSNKIDTITKTLTNSSFA-----------------SMNGSTHSPTSDFAINNID
Kpol_1004.22       ----------DLRHDSITSLDSDQ------------------------------------
CAGL0H04631g       RHTDLAASNANRVSKDSSILPGAK----------------IIRQDLESFNENRHFNVTGQ
KLLA0A01760g       AANSKDSSTAISSSNFQFEFPWKM--------------------------------DPSK
Kpol_1023.97       --TEKIKKNIQRKEDFSFEYPPPP------------PHSQTQGSSADTNVTYNKQNTDQR
ZYRO0D12584g       SESKEIEESVRRKMSFTFAFPWKNEFNNDHRNSEDKGNLSSHGEQQRSKQQHDNNNILMQ
TDEL0A03920        -TDKEIEQSVQKKMDFTFAFPWKD--------------------------RKEAEAQAQH
SAKL0G04950g       SSESHIRDNIQKKMDFTFEFPWKD------------------------------NAGRTQ
KLTH0G03784g       DEAAKINANVQRKMNFTFEYPKDM------------------------------PPANGA
Kwal_47.18631      DEAAKINANVQRKMNFTFAYAKDP-------------------TTSTGNANHSSTSGSAA
KNAG0B03680        -NQQGQAPAARDRGDFSFEFPWKG----------------------------------RT
NDAI0C01060        -PDLNLNSKFSPMESDASAMKRST-------------------GSVSSGDSNSRTMTSMD
NCAS0H02560        --------------DFTFQFPETS-----------------NLNKKVTIPSPDGSFERQQ
KAFR0C05400        ------NENLSKKSNFSFAFPWDD------------------NNATTDKSDNLNTTTNNN
Suva_13.155        TPNDDIQKNVKQKMNFTFQYPLDN-------------------------DDNDGKNMEKQ
Skud_13.147        TPSEEIQENVRQKMNFTFQYALDN----------------------------DSKNLEKQ
Smik_13.144        TPNDEIQENVKQKMNFTFQYPLDN-------------------------DSDENKNKERQ
YML007W            TPNDDIQENVKQKMNFTFQYPLDN-----------------------DNDNDNSKNVGKQ
                                                                               

ADR195C            SRRRGEE-----GALRA-GPAGARRRAAVAS-----------------------------
Ecym_4064          VPSPKSS-----NCSIS-QQDQDQEQQCVSAVAAAAAA----------------------
KAFR0E03290        IEEHDDE------------------EDEDVKRERFQQDI---------------------
KNAG0C03210        TATPSSTRSEPSVATTS-TSTSTSSSTAGHDGSKEPSVVQVP------------------
CAGL0F03069g       SPHVKLESNTSSVSVTS-EERGVLSHTPTTTNTSFDTSPSVINDLQRTAANRLE------
NDAI0H01610        VPSPNESSGSSIVSNTS-SPIINKTNASNFKIDSFNSPISVPISTTNNNSSFSNKYDINQ
NCAS0F01100        VPSPNESTG---SHISS-PDSQSLKHDEGLRLPSFSNKYDINSHDGGGI-----------
TBLA0G00930        VHSPSSET----SSKIS-SNILNNQDDSNTPKSLYSMPTSIPSSS---------------
TBLA0D01640        LHSPSNNNNHLMNSNNS-TILSANKESPELYLKNSTSPNDLNSTNLQSDINAYWEGQNLD
Skud_4.697         ------------------------------------------------------------
Smik_4.698         IRNTTVN-----TDTEV-ETHLHSSRNSTWDVGLCSTPR---------------------
YDR423C            LPSPNSDENMTVNTSIEVQPHTQENEKVMWNIGSWNAPS---------------------
TPHA0K00520        MPSPESS-----TSITS-SVVTSGKYNVQLQQGSVNNQVTTPDSSV--------------
TPHA0D02340        IVSPHSA-----SGSFT-NQTTAGTSYSHFSSELNSPTSVSNYFAGN-------------
Kpol_1004.22       --SPLND---------I-SKFNLNLGHINLSNSPNSSSI---------------------
CAGL0H04631g       LTPPGNT-----SSSTTANSVAANAKKQSIPHSDSSDSNESKNTWNTDPT----------
KLLA0A01760g       IPSPSSDST---SPSAS-TSILDNANNKSVSSTNLNHSR---------------------
Kpol_1023.97       LPSPGSS-----SGSSP-NMLMLNNKKQSILNNRITTPSSSTS-----------------
ZYRO0D12584g       FPSPGSS-----SKSSS-QSSSSLKPKNGLSTPSNGDGIRKGSTGNNSSINQTNGSISSS
TDEL0A03920        FPSPGSSMLSSSSASVN-SAASPSNKRRSTASRSTSTST---------------------
SAKL0G04950g       FPSPGS------------SSVSSNHKPSFSSNAPFNATNNTP------------------
KLTH0G03784g       FPSPSGS-----TSTTS-NHSFSHRPFSQLSNTPRTSS----------------------
Kwal_47.18631      FPSPSGS--------VS-TSSSHNRPFSLSSNTPRTSS----------------------
KNAG0B03680        APEFDNSTTQETTTATP-SPVSPGTKDQQG------------------------------
NDAI0C01060        APSMSTT-----TSVQS-NPLNLKPHNNMTLNDILPPATTVASTSTLDAN----------
NCAS0H02560        QKKPSTSSISSNDDSSS-SNLMQTINTPSMSTTTSVSSNQNQNLTGTTNNK---------
KAFR0C05400        IPSPDNSPVTASNDKKN-YPSSVSSIEPLNQNNNNNISSLSPSLDDNDGIS---------
Suva_13.155        LPSPNDP-----NHSAH-VPIAPTQKKLSDATDSSTATLDSFSNNNDVL-----------
Skud_13.147        LPSPNDP-----SHSAP-IPTTQAQKKSSDATDSSTATLDSLSNSHDVL-----------
Smik_13.144        LPSPNDP-----NHSVS-IPIAQKQKKSSNTTDSSSATLDSLSNSNDVL-----------
YML007W            LPSPNDP-----SHSAP-MPINQTQKKLSDATDSSSATLDSLSNSNDVLNNTPNSS----
                                                                               

ADR195C            -----------------------AVAVLVHLVLL----------------------RRAA
Ecym_4064          -----------------------AATSSTSGILMTG--------------------SGVQ
KAFR0E03290        -----------------------LSNTWTENEFQQDL-----------------------
KNAG0C03210        -----------------------LSNNWDDLMFYPAG-------------------RXXX
CAGL0F03069g       -----------------------STGSWMDSIFDQD--------------------SKLS
NDAI0H01610        VNDSNNVPIDGGGTDSHAVGTNIPNKNWMDNVFENNIAEGLPPFL-----------NNDD
NCAS0F01100        -----------------------TSSNWIDNIFDGDTAEGLPSFPASISSSS----ETPP
TBLA0G00930        -----------------------STNTWVENVLYKEDNEELPQFKMSN--------RTPS
TBLA0D01640        LLNSSSNP---------------ILSTNLKNISATSGLNNMINVANNNSSNSNPNSKAST
Skud_4.697         ------------------------------------------------------------
Smik_4.698         -----------------------LTNTW--NFPSEN--------------------RTDP
YDR423C            -----------------------LTNSWDSPPGN----------------------RTGA
TPHA0K00520        -----------------------SSSTWIHPVFYEDNAKQLPQFEQPKAVPTNMDVSPAN
TPHA0D02340        -----------------------AGTTWPEAFSMTDLMVNSGHMMGGSANNQ----QSNI
Kpol_1004.22       --------------------------------------------------------MSLS
CAGL0H04631g       -----------------------SSEDWLDDVMTSH--------------------KQIS
KLLA0A01760g       --------------------------------------------------------SSIS
Kpol_1023.97       -----------------------SSSGWMDNVFYKDDAQNLPHFDTSSTSTNTAFRDSPV
ZYRO0D12584g       NGFTPGS----------------TSTGWMDNVFYNDDA------------------RQLP
TDEL0A03920        -----------------------STTGWMDNVFYSDDA------------------QKLP
SAKL0G04950g       -----------------------STSSASLDMFYQD--------------------DALP
KLTH0G03784g       -----------------------GSLDFLGDSASNT--------------------QSLP
Kwal_47.18631      -----------------------GSLDFLGYNSNNN--------------------QSLP
KNAG0B03680        -----------------------KPTDWLDEV------------------------LSST
NDAI0C01060        -----------------------PSSTLFDSLLANDDLFTQQLMSFANNANNNN--NNND
NCAS0H02560        -----------------------TSLEWFDNMFNNDDLFN----------------QQLL
KAFR0C05400        -----------------------PSINWLDNMLHTEDLFN----------------EQLS
Suva_13.155        -NITPNSS---------------SSMDWLDNVMYTN--------------------KFVA
Skud_13.147        -NNTPNSS---------------SSMDWLDNVIYTN--------------------RFVA
Smik_13.144        -NNTPNSS---------------SSMDWLDNVIYTN--------------------KFVS
YML007W            -----------------------TSMDWLDNVIYTN--------------------RFVS
                                                                               

ADR195C            NAV---------------------------------FVFRRAHHGR-------GRPNTAA
Ecym_4064          PSLGCGHCSGSG------------------------SDGDSVIAAL--TASSNGKLGN-A
KAFR0E03290        ------------------------------------ISWTDLHAGD--VLEW--------
KNAG0C03210        XXXXDDLTGEQ-----------FYRSFGLDSND---LNLTNTWNSR--------------
CAGL0F03069g       NLMNDQSFYPFDNISFG--------NSPVITNN---WGENDMVAKQAGLESFNFAISN-S
NDAI0H01610        PEKIANMNNHTDTNNNLLTTGNLLDNSLMFSND---FNFNNQFDEH--VTNLLADSLS-R
NCAS0F01100        VNANDNDHSHVDFTNNLLD------HNMIFTNE---FSFHNQFDDH--------------
TBLA0G00930        VSNSNNNNNNNNNNNNNKNPSAFQYTTDFFSNQ---LNFDNSPSDVNNILPSTLKQTNSD
TBLA0D01640        ITSNTTTTSTSDGKSGIMDAPIDLNSMNWFNTDIETFNFDNQFDEQ--ISKFCLKLNS-A
Skud_4.697         ------------------------------------------------------------
Smik_4.698         SAISDKSANDSKKLDFSLDVTFNDKLTGINHLD---YDIRSHLSEH--FGDFSSDKVE-P
YDR423C            VTIGDESINGSEMPDFSLDLVSNDRQTGLEALD---YDIHNYFPQH-SERLTAEKIDTSA
TPHA0K00520        SDINQSTSDIVPGSAKSFDAIPFGYDSSLFSND---FNFDDKFSDQ--VSSFCDKVNNPN
TPHA0D02340        NSLSVTMDDEKVSSLVDEKSSILQQDSNLFSTE---FDFANEFDEQ--VSTFCAKMNK-T
Kpol_1004.22       PTASNNLPNAS--------------DSGLFSND---FNFNNQFDEQ--VSTFCAKMNN-N
CAGL0H04631g       RGQSGSG-----------------------------IDFNNFFDEQ--VSEFCTKLNQ-A
KLLA0A01760g       NSSSSPSNVNGLSSRKHSNTLNLYQTQSNVTSE---FDFDSQFDES--VSSFCSKLSM-A
Kpol_1023.97       NNSINSIKLEDNLKNNNNSALTVGYDSDLFSND---FNFDDHFDQQ--VSSFCVKMNQ-A
ZYRO0D12584g       QFYQSNNNNENSRLFEDNTTMPGDYDSVTFSNQ---FNFNDKFDEQ--VSEFCTKLGQ-V
TDEL0A03920        QFAIKGDSTADP----------------LFSNE---FNFDDQFDEQ--VSQFCTKMNK-A
SAKL0G04950g       KFTSSSLERGNN-------SGTIADAGFSITND---FDFESHFDEQ--VSEFCTRMNQ-A
KLTH0G03784g       KFPTSESGNGD-------------------------FDFNTHFDEQ--VSVFCTQMNE-V
Kwal_47.18631      KFVPSEPAKTE-------------------------FDFNSHFDEQ--VSEFCTRMNE-V
KNAG0B03680        ELYAKQQQQQLQGNRSESPFLAGYDDSLTVSNE---ITFDTQFDEQ--VSDFCVRMNE-A
NDAI0C01060        SVTTLDNSNTQQQNLQQPQITPPIEDSNLISNS---FDFNDKFDEQ--VSDFCGKMSM-A
NCAS0H02560        SLSNTANANKNTTTTATNTSLLQLDDPNLITNN---FDVTDKFDEQ--VSDFCGKMNM-A
KAFR0C05400        SFSNTPISRNDSNESKNPMT-----DSQLISNE---FNFEDQFDEK--VTDFCIKMNQ-V
Suva_13.155        GGDQKNASNESK-------SKPKGVDSNMFSND---FNFENQFDEQ--VSEFCSKMNQ-A
Skud_13.147        GGDGSKLEVKNV-------------DSNMFSNN---FNFENQFDEQ--VSEFCSKMNQ-V
Smik_13.144        GDDGCKRETKNV-------------DSNLFSND---FNFENQFDEQ--VSEFCSKMNQ-V
YML007W            GDDGSNSKTKNL-------------DSNMFSND---FNFENQFDEQ--VSEFCSKMNQ-V
                                                                               

ADR195C            APCLAEAVRGRHQRSLAGGPRLLQHVGQR-------------------------------
Ecym_4064          NGSLKDIIPD---------SCSTPSLNLL-------------------------------
KAFR0E03290        ------------------------------------------------------------
KNAG0C03210        -------------------QQDSNDAFLT-------------------------------
CAGL0F03069g       NSTFGLPAIATDISDINDINDTTTRIEPQ-------------------------------
NDAI0H01610        FPSDGNHHDSNIISKSNSSLTSPAQSLML-------------------------------
NCAS0F01100        ------PIIDLTTQQKPT-QQQQQQAFVI-------------------------------
TBLA0G00930        SLNSDSPHIKNVKDNDMNDASILEPSKFF-------------------------GSSSFD
TBLA0D01640        CGNLSYQLTTTANNNAANIPINNNDLNEL-------------------------------
Skud_4.697         ------------------------------------------------------------
Smik_4.698         LAFPSETDNMYFLDEAND-DILLSSVVSP-------------------------------
YDR423C            C---QCEIDQKYLPYETEDDTLFPSVLPL-------------------------------
TPHA0K00520        YSPENNSLPSLVSENYNA-ESHNNTIALP-------------------------------
TPHA0D02340        FENRKEMIKQFYTEKVRNSNNKPRTVSIK-------------------------------
Kpol_1004.22       FENRKKIIKKTYDEKIKL-KSEFSDVNSV----------------------------LAS
CAGL0H04631g       CGTKACPIPQSKSAATTPLPGTSSNGNSNSPMIINDTMGDVSLNMQGNEHGNATNNLVTD
KLLA0A01760g       CGTKSNPIPKASPVSTPS-SSDLLKPKSNSNVNITNHNNNKINSKDLSSSAPLHDSASAS
Kpol_1023.97       CGTKQNPVPKTMAESNKS-QKTPPSEGNP--------------STTPNESSNDSSLSIAK
ZYRO0D12584g       CGTKDCPIPQKQKSSYSS-PAVPKSPIVF-------------------------------
TDEL0A03920        CGTRECPIPGFTPQMASP-QVASPQIL---------------------------------
SAKL0G04950g       CGTRDSPVPQTLSNQS---SSTTTPITMTTTTRHDTATAPAPAPALAPEEPNAASSSPQA
KLTH0G03784g       CGTRECPLPQALPPSTAA-SVTPRPISPI-----QEEQPELSKPAQAKIPAADAFLKQAQ
Kwal_47.18631      CGTRECPVAPALPPSTAMAHTTPSSAQPQ---------PDSLTRRPSQELSEKHLQNQLS
KNAG0B03680        CGSKTNPVPKSKKGSVFSNSVLSPPSLLN-------------------------------
NDAI0C01060        CGTRSNPIPKSKSNVSTPQSIMNSNNKSPISPLNDSTLAKSNVITTSNIFDHQSNTPQAI
NCAS0H02560        CGTRYDPVPKSKSNTSTPQNNNSSLLSPP------------SNSKQIANQSNLFNLNTPP
KAFR0C05400        CGTRSNPIPKKSTSNLPSTESTPLFTNTF-------------------------------
Suva_13.155        CGTKQCPIPKKSVHQLDK-EVFASSSVLS----------------------------ANS
Skud_13.147        CGTRQCPIPKKPVSTLDQ-EVFASSSILS----------------------------ANS
Smik_13.144        CGTRQCPIPKKPVSTLDK-EVFASSSILS----------------------------ANS
YML007W            CGTRQCPIPKKPISALDK-EVFASSSILS-----------------------------SN
                                                                               

ADR195C            ------------------------------------------------------------
Ecym_4064          ------------------------------------------------------------
KAFR0E03290        ------------------------------------------------------------
KNAG0C03210        ------------------------------------------------------------
CAGL0F03069g       ------------------------------------------------------------
NDAI0H01610        ----TNTWDT--------------------------------------------------
NCAS0F01100        ----SNTWDS--------------------------------------------------
TBLA0G00930        FTNSINLGNSPQQ---------------------------------NFGRIGF-------
TBLA0D01640        --ININTNDE--------------------------------------------------
Skud_4.697         ------------------------------------------------------------
Smik_4.698         ------------------------------------------------------------
YDR423C            ------------------------------------------------------------
TPHA0K00520        ------------------------------------------DTTTEFGKKGF-------
TPHA0D02340        ------------------------------------------------------------
Kpol_1004.22       PSLSSSRFSD--------------------------------------------------
CAGL0H04631g       PAFLSNTWDDMSP----------------------ASNQHSTGGAPGFGQLGF-------
KLLA0A01760g       ALNNHDSVNAVSNQFSVDKQYNDSSHSQATPNGLDNDSSVSAWQQPSFGQLGF-------
Kpol_1023.97       FDDPNFLFDSPSN---------------DFTNTLDIPSVDSSNANSNFGQLGF-------
ZYRO0D12584g       ----SNTWDTPSE-----------------------------------------------
TDEL0A03920        ----TNSWDTVAS--------------------------------PAFGQQSL-------
SAKL0G04950g       GLNLTNTWET-----------------------------------PSFGNLGF-------
KLTH0G03784g       QQQPPNAWDS-----------------------------------PQFGHSGF-------
Kwal_47.18631      PQAASSVWDT-----------------------------------PQFGHSGF-------
KNAG0B03680        --SLSNTWGT--------------------------------------------------
NDAI0C01060        NSNLTNTWGIPSA-----------------------------------------------
NCAS0H02560        NLNITNTFDF--------------------------------------------------
KAFR0C05400        ------------------------------------------------------------
Suva_13.155        PVL-TNTWDSHSN----------------VTTNTPANITTNGSSSSSFGQPGF-------
Skud_13.147        PAL-TNTWESHSN----------------ITANTPANITTNDTSLSGFGQLGFELTTSRH
Smik_13.144        PSL-TNTWESHSN------------ITVNTPANVIGNDTSIDTSFSSFGQLGF-------
YML007W            SPALTNTWESHSN-----------ITDNTPANVIATDATKYENSFSGFGRLGF-------
                                                                               

ADR195C            ------------------------------------------------------------
Ecym_4064          ---------------------SDSERNSICDTFQLNNDFGGACHQ---------------
KAFR0E03290        ------------------------------------------------------------
KNAG0C03210        ------------------------------------------------------------
CAGL0F03069g       -----------LAFPGEDIKYSRENMVMRRESSAMNNGGILDTVI---------------
NDAI0H01610        -----------------------NNSPSLDGIDTDNNIYVNDDSN---------------
NCAS0F01100        ------------------------------------NSNGNSTDN---------------
TBLA0G00930        -------GDFDMSMSLDSSKFWGTNSISNNNSNNSTHTPTDFNKMSSVKSAVKGCNELLK
TBLA0D01640        -------EDHGDLKNLNDVFENKFSVQQSINNNNNDNNNNNSSEN---------------
Skud_4.697         ------------------------------------------------------------
Smik_4.698         -------------------------------------AKENECNG---------------
YDR423C            -----------------------AVGSQCNNICNRKCIGTKPCSN---------------
TPHA0K00520        ---EFANSDATDTFSWNSGAFHEDDPSSKLFIDTLDKQYAVPTSD---------------
TPHA0D02340        ------------------------QEPTTTLQANIQPSDSNDVTE---------------
Kpol_1004.22       -------DNSSTYFNTRHHHNNDHNNTTTTKNHNYNNQSMKSEFP---------------
CAGL0H04631g       -------GDNLLGNDILFSPNSPAYSPSVLGSGRTQEVYRSPAVQ---------------
KLLA0A01760g       --------RTDQLFDLDLDSASPITKQKDNNYSTTTNNTNSPAKA---------------
Kpol_1023.97       -----HGLSNDITFNSNDSNWNDFISLKTDSMTSVPTTSSVATND---------------
ZYRO0D12584g       -----------DPQQQLPTLEENLSDPSIRQTNAYSNTDGGDGDD---------------
TDEL0A03920        -------------------------------------APSKKQLT---------------
SAKL0G04950g       -------GGDGDSHGNGDGHGHGNGDDSNKWLFTSDLGPSPGAAA---------------
KLTH0G03784g       --------------------GMGTEDPTNRWLFPDFSSGNMSSTV---------------
Kwal_47.18631      --------------------GSDLEDPTNRWMFAGFNAATEGGVI---------------
KNAG0B03680        ---------------DRTDAGSATSETTSPRLTESSSSTVTTNND---------------
NDAI0C01060        ---------SPNSNDSSPNNIVPTQDNSNVNMNFGQLGFMMDSPQ---------------
NCAS0H02560        -------NSPLDSPQQQNQAFGQLGMPNSPQFLSAFELPTENSIQ---------------
KAFR0C05400        ----------------------DSPSFGQLNIQNIESTNSDNTNN---------------
Suva_13.155        -------DLNTNHYATNDKYTDNSDNNKTNNYNDILPFISESPFD--------------M
Skud_13.147        AAEENSTGNTDNDNNSGDSSNNKNNNNNNNNNNNSNNNKNNNNNGDDGGVIPFISDSPFD
Smik_13.144        -------GVAANHHDVNNDNTSSTGNKNGSNKNSTNNDDVLPFIS----------ESPFD
YML007W            -------DMSANHYVVNDNSTGSTDSTGSTGNKNKKNNNNSDDVL------PFISESPFD
                                                                               

ADR195C            ------------------------------------------------------------
Ecym_4064          -------------------------------SSSSSLLSGCSLIPQQT------------
KAFR0E03290        ---------------------------------DMPFQNDATAV----------------
KNAG0C03210        ------------------------------------SVDTPLAFPDIW------------
CAGL0F03069g       -------------------------------NSPIPMLDDN---SEDI------------
NDAI0H01610        -------------------------KDTASIMNVRPIIDSTLAFPSTM------------
NCAS0F01100        ---------------------DTQSLIGNNINNNNPLIDSNLAFPTDI------------
TBLA0G00930        NEQNIANNAASKSTNNSKLRNSNITITPLADDNNIPFIDTSLAFNDIP-----------T
TBLA0D01640        ------------------WNFNLSSTPINSFNVNINDVETNLAFPNQT------------
Skud_4.697         ------------------------------------------------------------
Smik_4.698         -------------------------KCNGKCAEDTPLLNKEI------------------
YDR423C            ------------------------------------------------------------
TPHA0K00520        ------------------------ASIANDFSKANNFIESSLAFPEST-----------A
TPHA0D02340        -----------------------------------SLVAASIAFPEQY------------
Kpol_1004.22       -----------------PLIFFSDNNYMDSPDNSFPLIDASLAFPNNS------------
CAGL0H04631g       ---------------------KVVEKENESKSVNFPFINSSLAFPGDY-------DNNFF
KLLA0A01760g       -----------DGMYWNFNTPLSNMVSRNMQNPEIPFIDTGLAFPDYD------------
Kpol_1023.97       ----------------HPINISKPSEENSPRKEVLPFIDTSIAFPETK------------
ZYRO0D12584g       -------------------EGIVVSMNSPEKNSELPFIDTSLAFPEEQ------------
TDEL0A03920        --------------------------KTPPSQPELPFIDPTMAFPTDD------------
SAKL0G04950g       ------------------------ANTPSNSADILPFIDTSIAFPTEQ------------
KLTH0G03784g       -------------------------RAPSAKIDSVPFIDTSMAFPTDQ------------
Kwal_47.18631      -------------------------RTTSATADSLPFIDTSMAFPTDP------------
KNAG0B03680        --------------------------LKLDADFEIPFINTSLAFPTDD------------
NDAI0C01060        ----------FQNIDLSLPIENDKFSASNFKKPSLPFINPTLAFPNDD-----------L
NCAS0H02560        ------------------KQPQQQQPMASKKSPTLPFINSSLAFPTDD---------IFN
KAFR0C05400        -------------------------DTTPDDNGIFSFLNPSLAFPSST------------
Suva_13.155        NQVTNFFSPGTNNTTNANTTNSHNPSLQQSTKDDIPFINTSLAFPDDNPTNIQLQPLSQS
Skud_13.147        MNQVTNFFSPGSTNNINIAASSANPSLSQNTKDDVPFINAGLAFPDENPTNIQLQPFSES
Smik_13.144        MDQVTNFFCPGPTNTINNVAASANSNFLQNSKDDIPFINANLAFPDENSTNIQLQPISES
YML007W            MNQVTNFFSPGSTGIGNNAASNTNPSLLQSSKEDIPFINANLAFPDDNSTNIQLQPFSES
                                                                               

ADR195C            ------------------------------------------------------------
Ecym_4064          ------------LKLDPQESTDDFSNTWVSTTPDSSYGSR--------------SATES-
KAFR0E03290        ---------------------------------------------------------KC-
KNAG0C03210        ------------NDTGALAPAAPATTVLQDTPPDVLPEGC-------DCGGRCLTDIKC-
CAGL0F03069g       ----LGDFTCSCQNKANSCPTRQLENEAKATPVGKKIADM----------NLDDVELRC-
NDAI0H01610        ----TENDLFAQRYGTMQSSSSSLSESAMQLGDDKKCTCN-------DQCNSDDEEIEC-
NCAS0F01100        --------------NENEVFVKQYQEYVSQQQPAEQDTITCPCQHADTGADDDDEEIEC-
TBLA0G00930        NLSNDNEFNMQLFKTNRKSSDDDFFKFLMDEDNDILNGNN----------NSTENNEDN-
TBLA0D01640        ---------------LLQDPSINVDKFEFPISPANNLNVS--------------------
Skud_4.697         ------------------------------------------------------------
Smik_4.698         ---------------------------------------------------------KC-
YDR423C            ------------------------------------------------------KEIKC-
TPHA0K00520        SVANSMNGNLYFRDSNIDNTIDMLDLLADDDDDEDEVDE---------------------
TPHA0D02340        ----------------NMVKSDSLYNFLKQNNNNIGYGDV----------RGNISTQPN-
Kpol_1004.22       -NSNRNNNNNNNNNVLFRDISTAEMQFMDESPLQNVEFNS--------------------
CAGL0H04631g       RETTDLNFDDNDQDDNFTNSNDLVNDYFTTNIPDTDNSDS--------------------
KLLA0A01760g       ---------------------DPLLDILKEEQENEQVEGD------------------S-
Kpol_1023.97       ADFDAFDNQMFFRDDGFNESLNISDDIVGAESDDEQDNNN-----------------DN-
ZYRO0D12584g       ------------DLFREQQPDNMFAEFIEHDPQRDTTNGN----------EGNTSPDQD-
TDEL0A03920        --------DEGLFFRTHRDENSLFAELLDEVEP-----------------------TDN-
SAKL0G04950g       -------NELVFRDTAANNSSTVFDEFLEEDPVVHQLTTE--------------------
KLTH0G03784g       -----------PDALLPQNSDDVLNQFFEEDPIVSQLTTE----------ESNYDPFKPD
Kwal_47.18631      -----------QEDLLAPNPDDVLDQFFEEDPIVSQLTTE----------ESAYDQFKS-
KNAG0B03680        GAVPQTVDDNIFFRDTQHEQRSALDDFLEEEELTDNQQQQ-----------------QH-
NDAI0C01060        FNKNNSNNDNNNNTTTTHDESDLLSQFLANDYSNTISTNN----LMNSDDDEDEDDDDYE
NCAS0H02560        NTISNNNNNSNTNGPLFNESSSLLSDFIRNEDGNVSDSDN-----------DADSDFDN-
KAFR0C05400        ------------------SPENSLSDGSINNNIDNNNNSS-------------LNNFRD-
Suva_13.155        QHQNKFDYDMFFRDSSKEGN-NLFEEFLEEDDDDDDDDGN--DGNDNDGEAVNASDDES-
Skud_13.147        QSQNKFDYDMFFRDSSRAGN-SLFEEFLEEEEDDDDDDNN-------NEKATNASDDES-
Smik_13.144        QSQNKFDYDMFFRDSSKEGN-NLFEEFLEEDDDDDDDGNK---------KAYNTSDDES-
YML007W            QSQNKFDYDMFFRDSSKEGN-NLFGEFLEDDDDDKKAANM--------------SDDES-
                                                                               

ADR195C            ---VARRELRSHAAGRHGH-----------------------------------------
Ecym_4064          -MPSFTTLLSGNSNVNEQWSVQDW------------------------------------
KAFR0E03290        -DLM--------------------------------------------------------
KNAG0C03210        -DLLTRRVMNNESL----------------------------------------------
CAGL0F03069g       -ELLTQHIIYREPLSTVLQLLKRTR-----------------------------------
NDAI0H01610        -ELLSRNLLNDESMKSIIKEKQTRPSN---------------------------------
NCAS0F01100        -EFISRNLLNNESIPSILRDKTSI------------------------------------
TBLA0G00930        -NSILNNLINETPAVESTQLAQTPRASDSAHTSPIVQTPNKDPSIS--------------
TBLA0D01640        --------LNQQDKSNISDVDDDEDDD---------------------------------
Skud_4.697         ------------------------------------------------------------
Smik_4.698         -ELITKRLLNQESLDSIVPASAPYRENIGIRSEA--------------------------
YDR423C            -DLITSHLLNQKSLASVLPVAASHTKTIRTQSEA--------------------------
TPHA0K00520        -SLIKNNLVTEECMDDAQAKSQLCDKY---------------------------------
TPHA0D02340        -SIMTNNLSNNEQNYNFSKDAQFIVSQQNTVRNIQTANEYPNIYETDDSSDGGDEV----
Kpol_1004.22       -EDAIKRLISEEPSPHYSNSVPHLHNNNVNSASLHPLTVLVQEPDDELD-----------
CAGL0H04631g       -ALIANGLVKEEPSMQTEDTFKVQNTNDMLNSSRMKETIDNQNIGEKTTKDDNEDDDEDD
KLLA0A01760g       -DPIQALINEEPSMPLCHDPAANAGASVSETDKLSNQEEI--------------------
Kpol_1023.97       -DLISKNLVCEEVKE---------------------------------------------
ZYRO0D12584g       -EFLASGMVQEEPAVTTGEVKDNTNDNVKDGKIQDEGKEAPN------------------
TDEL0A03920        -NFVNENLINEEPSTTTAVAEETRPKPKT-------------------------------
SAKL0G04950g       -ESVYDVFSNDYGAKKGKPFSPEENKGNYTTLPLSQESSNPLV-----------------
KLTH0G03784g       LQPSADSETSKHSVSSCSNDSDPSRAESNASTALTEPNYTIDKTSVPSAVLAAE------
Kwal_47.18631      -PPYAPYDMSKTSASASSNDSANSSADSNASTALTDPNYTTYKPGAPTPATSTAMAATTF
KNAG0B03680        -EEKINLLINEVPFSIEADKEVPFSIEPNEDG----------------------------
NDAI0C01060        KKLVANNLINEEPSSTNKNNNLTSTSKEQENNDF--------------------------
NCAS0H02560        -DLINKNLINQEISNPVLAPAPTSVPASTAATAAPEDEDD--------------------
KAFR0C05400        -TSIFDDFLKHEAEPSVEDLINEEIDD---------------------------------
Suva_13.155        -NLIKNKLINEEPQQQSQCHLSTPKNGSEVLQNKNSSNSEDVNDN---------------
Skud_13.147        -SLIRNQLINEEPQPLNQNSLSSLNNEKETSPKTNSGGTQNANDSDGNDN----------
Smik_13.144        -SLIKNQLINEEPQSTLKNESESAQRKDSYVQEAIDNNNGNGN-----------------
YML007W            -SLIKNQLINEEPELPKQYLQSVPGNESEISQKNGSSLQNADKINNGNDNDN--------
                                                                               

ADR195C            --AGSQLPAG-------HCDTAGKRR----------------LDVGRQPQPDRGHARAFP
Ecym_4064          --AMNGVPSLAQH--QQQNQKQQKQK--------QQQPSFVDPSL-----TFSISARSVP
KAFR0E03290        --TNYINNGMDTS--CRSCSQCIGEVS-------LAHIK----DFDKLCQELFDLITI--
KNAG0C03210        --RSIIAEKRCGS--NDTCAHVIRTL--------TQSPHYQENDLEDLCQELMVKCKFDT
CAGL0F03069g       --HERDARSSEGKP-VLRCEDICGTV--------GPSIGYDSLDFENLCAELMNKAKI--
NDAI0H01610        --VAPSCCNGGYGNRFAKCSKIWERINNKMNIETNSGPRFKDSDIDDLCNELMTKARC--
NCAS0F01100        --DGGMACNK-----YSKCSAIWKRFK-------TQKPKFSDDDIDSLCQELITKAKC--
TBLA0G00930        --VMSIIREEDKGKNYMQCSEVWDRI--------TSHPKYSDLDIDGLCTELMHKAKC--
TBLA0D01640        --DNEMVPADPE---MLPCTKIWDRI--------TALPKYTSADIENLCNELMSKAKC--
Skud_4.697         -----------------------------------TLPKYSPLNTDNLCRQLMVNARF--
Smik_4.698         --IRRISSAISNQ--NTSCCHILKEI--------SSLPKYSSLDIDNLCCELMTKAEF--
YDR423C            --IEHISSAISNG--KASCYHILEEI--------SSLPKYSSLDIDDLCSELIIKAKC--
TPHA0K00520        --KNTVIRAEDGS--YLKCSQVWSRL--------TEHPKYSELDIDGLCTELMLQAKC--
TPHA0D02340        --VGQIVPLTDGR--LLECGEIWDRI--------TTYPRYSDIDIDGLCEELMASAKC--
Kpol_1004.22       --EDVVVPSTDSQ--LMRCSEIWDRI--------TTNPRYTDLDIDGLCEELMFSAKC--
CAGL0H04631g       ENDNTVVPSRDDG--LLRCSEIWDRI--------TAHPKYSDIDIDGLCSELMAKAKC--
KLLA0A01760g       --VQDIIPSNDGK--LLKCSEVWDRI--------TAHPRYSDLDIDGLCLELRTKAKC--
Kpol_1023.97       --HDMVIPTSDGK--LLKCSEVWDRI--------TAHPRYSDIDIDGLCQELMHNAKC--
ZYRO0D12584g       --SDVVVPSSDGK--LLKCSEVWDRI--------TSHPKYSDMDIDGLCQELMAKAKC--
TDEL0A03920        --ETDVVPSRDGK--LLKCSEVWDRI--------TTHPKYSAIDIDGLCGELMTKAKC--
SAKL0G04950g       --SDDVVPSRDGK--LLKCGEIWDRI--------TSHPKYSDLDIDGLCMELRTKAKC--
KLTH0G03784g       --DADVVPARDGL--LLKCSEIWDRI--------TAHPKYSDIDIDGLCMELRTKAKC--
Kwal_47.18631      LSEDAVVPARDGT--LLKCSEVWDRI--------TSHPKYSDIDIDGLCLELRTKAKC--
KNAG0B03680        --DPQVVPSKDGK--LLKCSEIWDRI--------TAHPKYSDLDIDGLCGELMTKAKC--
NDAI0C01060        --DDFIVPSRDGG--LLRCSEIWDRI--------TAHPKYSELDIDGLCSELMTKAKC--
NCAS0H02560        --DEFIVPSRDGG--LLRCSEIWDRI--------SAHPKYSDLDIDGLCSELMTKAKC--
KAFR0C05400        --INDVVPSKDKN--LLRCSEVWDRI--------TAHPKYSDIDIDGLCGELMAKAKC--
Suva_13.155        --DNEVVPSKEGS--LLRCSEIWDRI--------TTHPKYSDIDVDGLCSELMAKAKC--
Skud_13.147        --DNDVVPSKEGS--LLRCSEIWDRI--------TTHPKYSDIDVDGLCSELMAKAKC--
Smik_13.144        --DNDVVPSKEGS--LLRCSEIWDRI--------TTHPKYSDIDVDGLCSELMAKAKC--
YML007W            --DNDVVPSKEGS--LLRCSEIWDRI--------TTHPKYSDIDVDGLCSELMAKAKC--
                                                              .                

ADR195C            PVRG-----------------------------RPARQ-
Ecym_4064          AAAGY---------TTVSSNDLQEDDV------LSYFQ-
KAFR0E03290        TEEPFSK----KRVAMISLIDLRNVI-------LRHAM-
KNAG0C03210        HDAS----------ITVGREDVRSAL-------ERHIAA
CAGL0F03069g       SDDGDGTDIVPKRHVVIKAGDLQRTL-------AKHISS
NDAI0H01610        STNGS---------IVIKTGDIKQSL-------MKHF--
NCAS0F01100        SDEGT---------IVIRSRDVKNTL-------RKHF--
TBLA0G00930        SEKG----------VVVKADDVQKAL-------TKHLS-
TBLA0D01640        SDKG----------VVVSSLDVDKVLLNEKKSNSRHFQM
Skud_4.697         TDDS-----------------------------RAMLQ-
Smik_4.698         TDDCE---------IVVRAHDLQTTL-------VKQLL-
YDR423C            TDDCK---------IVVKARDLQSAL-------VRQLL-
TPHA0K00520        SEKG----------VVVESRDVQKAL-------SKYLSS
TPHA0D02340        SDKG----------VLVSSDDVQKVL-------SRRLV-
Kpol_1004.22       SDKG----------VVVASKDVHKVL-------AKHMA-
CAGL0H04631g       SERG----------VVINADDVQVAL-------NKHMS-
KLLA0A01760g       SEKG----------VVVNAEDVQKAL-------ISHMQ-
Kpol_1023.97       SDKG----------VVVDSKDVQKAL-------SNHMS-
ZYRO0D12584g       SERG----------VVVQAEDVQYAL-------NNRVE-
TDEL0A03920        SEKG----------VVVQAEDVQRVL-------DKHMDV
SAKL0G04950g       SEKG----------VVVNADDVQKAL-------AKHMS-
KLTH0G03784g       SEKG----------VVVNSDDVQSAL-------AKHMS-
Kwal_47.18631      SEKG----------VVVNIDDVQRAL-------TKHMS-
KNAG0B03680        SERG----------VVVNADDVKDAL-------NRHIA-
NDAI0C01060        SERG----------VVVNAEDVQMAL-------TKHMS-
NCAS0H02560        SERG----------VVVNAEDVQLAL-------TKHMS-
KAFR0C05400        SEKG----------VVVNAEDVQSAL-------SKHLS-
Suva_13.155        SERG----------VVINAEDVQLAL-------NKHMN-
Skud_13.147        SERG----------VVINAEDVQLAL-------NKHMN-
Smik_13.144        SERG----------VVINAEDVQLAL-------NKHMN-
YML007W            SERG----------VVINAEDVQLAL-------NKHMN-
                                                          

FASTA FORMAT for MUSCLE Version 3.6

>ADR195C
-------MSTAGQVKRSF----------------------------------EEQDGPYV
GETKRRG----NKPG-----RKP-LDTEAKNRRTAQNRAAQRAFRERKERKMRDLEDQVR
RLEEERSSAECEVQSLRGHVIALVRELRR-WRAR-------------------QQGAGG-
------------------------------------------------------------
---------ADAEPTAGYDVSWEH--------------------GAAGARAERRRLGGRR
SRRRGEE-----GALRA-GPAGARRRAAVAS-----------------------------
-----------------------AVAVLVHLVLL----------------------RRAA
NAV---------------------------------FVFRRAHHGR-------GRPNTAA
APCLAEAVRGRHQRSLAGGPRLLQHVGQR-------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---VARRELRSHAAGRHGH-----------------------------------------
--AGSQLPAG-------HCDTAGKRR----------------LDVGRQPQPDRGHARAFP
PVRG-----------------------------RPARQ-
>Ecym_4064
------MSLAHNRLKRSLEDDDMTSSSSSGGST-------------------ATQLVFEG
GGSRRKG----NKPG-----RKP-LDTEAKNRRTAQNRAAQRAFRERKERKMKDLEDKVR
KLEEQRLQSEREVQSLRNQVVSLLRELKK-YRPG---------SPVLQE----PEPTGD-
------------------------------------------------------------
---------EEIQGKFGLNFPWEQ--------------------SSGEEDEDSLSMVITQ
VPSPKSS-----NCSIS-QQDQDQEQQCVSAVAAAAAA----------------------
-----------------------AATSSTSGILMTG--------------------SGVQ
PSLGCGHCSGSG------------------------SDGDSVIAAL--TASSNGKLGN-A
NGSLKDIIPD---------SCSTPSLNLL-------------------------------
------------------------------------------------------------
---------------------SDSERNSICDTFQLNNDFGGACHQ---------------
-------------------------------SSSSSLLSGCSLIPQQT------------
------------LKLDPQESTDDFSNTWVSTTPDSSYGSR--------------SATES-
-MPSFTTLLSGNSNVNEQWSVQDW------------------------------------
--AMNGVPSLAQH--QQQNQKQQKQK--------QQQPSFVDPSL-----TFSISARSVP
AAAGY---------TTVSSNDLQEDDV------LSYFQ-
>KAFR0E03290
----------------------------------------------------------ME
TEVKRRV----GRPG-----RKK-LDADAKNKRTQQNRMAQRAFRERKEAKLKLLENEVD
KLQLENLSKAEIIEFLKQNVMTLLGEIKN-YRKQ--TNKDKKLLDTIGK----LENDGM-
------------------------------------------------------------
-----DATTLQHSPVSNYGSPPVL-----------------------------SHDEDDE
IEEHDDE------------------EDEDVKRERFQQDI---------------------
-----------------------LSNTWTENEFQQDL-----------------------
------------------------------------ISWTDLHAGD--VLEW--------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------DMPFQNDATAV----------------
---------------------------------------------------------KC-
-DLM--------------------------------------------------------
--TNYINNGMDTS--CRSCSQCIGEVS-------LAHIK----DFDKLCQELFDLITI--
TEEPFSK----KRVAMISLIDLRNVI-------LRHAM-
>KNAG0C03210
----------------------------------------------------MALTTGAA
AETAKKV----GRPG-----RRK-LDVEAKNKRTQQNRVAQRAYRERKEAKLRTLEHKIA
ALERLNSYNEDRAELMAAHLRDLLGEANK-FRGE--KPRDKTVRELLTA----RDPTRD-
-----------------------------------------------------TLRRELE
AAEDAHSANEATAAAAVVADPVPQ-----------------------------ANDKPIS
TATPSSTRSEPSVATTS-TSTSTSSSTAGHDGSKEPSVVQVP------------------
-----------------------LSNNWDDLMFYPAG-------------------RXXX
XXXXDDLTGEQ-----------FYRSFGLDSND---LNLTNTWNSR--------------
-------------------QQDSNDAFLT-------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------SVDTPLAFPDIW------------
------------NDTGALAPAAPATTVLQDTPPDVLPEGC-------DCGGRCLTDIKC-
-DLLTRRVMNNESL----------------------------------------------
--RSIIAEKRCGS--NDTCAHVIRTL--------TQSPHYQENDLEDLCQELMVKCKFDT
HDAS----------ITVGREDVRSAL-------ERHIAA
>CAGL0F03069g
-------------------------------------------------------MSKVS
KEGKKKA-------------GRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIV
VLKGMNSKKNSETEYLKECLSELLTEVTK-YRPA--NEKDQGILKRLKE----IKADDL-
------------------------------------------------------------
---KSVEVVPEQPSATNFMNSPTN------------------ITTAGSDKQADKTSSKKS
SPHVKLESNTSSVSVTS-EERGVLSHTPTTTNTSFDTSPSVINDLQRTAANRLE------
-----------------------STGSWMDSIFDQD--------------------SKLS
NLMNDQSFYPFDNISFG--------NSPVITNN---WGENDMVAKQAGLESFNFAISN-S
NSTFGLPAIATDISDINDINDTTTRIEPQ-------------------------------
------------------------------------------------------------
-----------LAFPGEDIKYSRENMVMRRESSAMNNGGILDTVI---------------
-------------------------------NSPIPMLDDN---SEDI------------
----LGDFTCSCQNKANSCPTRQLENEAKATPVGKKIADM----------NLDDVELRC-
-ELLTQHIIYREPLSTVLQLLKRTR-----------------------------------
--HERDARSSEGKP-VLRCEDICGTV--------GPSIGYDSLDFENLCAELMNKAKI--
SDDGDGTDIVPKRHVVIKAGDLQRTL-------AKHISS
>NDAI0H01610
------------------------------------------------------------
---------------------------------------------------MKELEDKIS
SLEKIKDENSIETSFLRSYMTDLINEVNK-FRPK--NTTDSKILKYLSM----RNTHMH-
-----------------------------------------------NNPPNIDTLLELE
KKRKEREEREQQQQQFHEEEQKQE--------QVSHEKNSHLSDTNTTNNTNTNQLPANQ
VPSPNESSGSSIVSNTS-SPIINKTNASNFKIDSFNSPISVPISTTNNNSSFSNKYDINQ
VNDSNNVPIDGGGTDSHAVGTNIPNKNWMDNVFENNIAEGLPPFL-----------NNDD
PEKIANMNNHTDTNNNLLTTGNLLDNSLMFSND---FNFNNQFDEH--VTNLLADSLS-R
FPSDGNHHDSNIISKSNSSLTSPAQSLML-------------------------------
----TNTWDT--------------------------------------------------
-----------------------NNSPSLDGIDTDNNIYVNDDSN---------------
-------------------------KDTASIMNVRPIIDSTLAFPSTM------------
----TENDLFAQRYGTMQSSSSSLSESAMQLGDDKKCTCN-------DQCNSDDEEIEC-
-ELLSRNLLNDESMKSIIKEKQTRPSN---------------------------------
--VAPSCCNGGYGNRFAKCSKIWERINNKMNIETNSGPRFKDSDIDDLCNELMTKARC--
STNGS---------IVIKTGDIKQSL-------MKHF--
>NCAS0F01100
----------MSTTDE------------------------------------QQQQQQQP
VVVKRRV----GRPG-----RKP-LDTAAKNRRTAQNRAAQRAFRERKERKMKELEDKIS
DLERIKDNNEVESTFLRDYMMDLICDMQK-YRPN--NSTDSKVLKYLSL----KKKNQP-
-------------------------------------------------------SMKAT
SIDSLIEMENKKTDEISKESPDST------------------LNNNANNNNNNNNNDTNQ
VPSPNESTG---SHISS-PDSQSLKHDEGLRLPSFSNKYDINSHDGGGI-----------
-----------------------TSSNWIDNIFDGDTAEGLPSFPASISSSS----ETPP
VNANDNDHSHVDFTNNLLD------HNMIFTNE---FSFHNQFDDH--------------
------PIIDLTTQQKPT-QQQQQQAFVI-------------------------------
----SNTWDS--------------------------------------------------
------------------------------------NSNGNSTDN---------------
---------------------DTQSLIGNNINNNNPLIDSNLAFPTDI------------
--------------NENEVFVKQYQEYVSQQQPAEQDTITCPCQHADTGADDDDEEIEC-
-EFISRNLLNNESIPSILRDKTSI------------------------------------
--DGGMACNK-----YSKCSAIWKRFK-------TQKPKFSDDDIDSLCQELITKAKC--
SDEGT---------IVIRSRDVKNTL-------RKHF--
>TBLA0G00930
MSDTAVMPTNSSTIKRHLDASD------------------------------ANETASAT
KETKKKS----NKVG-----RKL-SDQEAKSKRTAQNRAAQRAFRERRERKMQELEDKVK
SLEEVHKKSEIESQFLRDQLKVLLGELQR-YRPE--RQNDAKVKEYLST----HKFDPS-
------------------------------------------------------------
-VVSASNKNSPNDISNNTQIPSPN-----------------------------SSRFDDQ
VHSPSSET----SSKIS-SNILNNQDDSNTPKSLYSMPTSIPSSS---------------
-----------------------STNTWVENVLYKEDNEELPQFKMSN--------RTPS
VSNSNNNNNNNNNNNNNKNPSAFQYTTDFFSNQ---LNFDNSPSDVNNILPSTLKQTNSD
SLNSDSPHIKNVKDNDMNDASILEPSKFF-------------------------GSSSFD
FTNSINLGNSPQQ---------------------------------NFGRIGF-------
-------GDFDMSMSLDSSKFWGTNSISNNNSNNSTHTPTDFNKMSSVKSAVKGCNELLK
NEQNIANNAASKSTNNSKLRNSNITITPLADDNNIPFIDTSLAFNDIP-----------T
NLSNDNEFNMQLFKTNRKSSDDDFFKFLMDEDNDILNGNN----------NSTENNEDN-
-NSILNNLINETPAVESTQLAQTPRASDSAHTSPIVQTPNKDPSIS--------------
--VMSIIREEDKGKNYMQCSEVWDRI--------TSHPKYSDLDIDGLCTELMHKAKC--
SEKG----------VVVKADDVQKAL-------TKHLS-
>TBLA0D01640
--------MVNSSITSP-----------------------------------NSNSNGTA
TTTTSKV-------------QKD-SNAELKSKRTAQNRAAQRAFRERKEKKMKSLEEKVV
ELEKVCRAHESETSFLRSQLILFGTELRKQHNTGNTPSNNNSISNYRNR----HKNSIA-
----------------SNHSNSSNHSNSNSISVPNSLSRHSSTSSIINQPNSMSMSMSMS
NPNANSNLTINHHHTNSTTTPYNG-------FANLNYSFLQTTSSTTAYNTNTSSPLSFT
LHSPSNNNNHLMNSNNS-TILSANKESPELYLKNSTSPNDLNSTNLQSDINAYWEGQNLD
LLNSSSNP---------------ILSTNLKNISATSGLNNMINVANNNSSNSNPNSKAST
ITSNTTTTSTSDGKSGIMDAPIDLNSMNWFNTDIETFNFDNQFDEQ--ISKFCLKLNS-A
CGNLSYQLTTTANNNAANIPINNNDLNEL-------------------------------
--ININTNDE--------------------------------------------------
-------EDHGDLKNLNDVFENKFSVQQSINNNNNDNNNNNSSEN---------------
------------------WNFNLSSTPINSFNVNINDVETNLAFPNQT------------
---------------LLQDPSINVDKFEFPISPANNLNVS--------------------
--------LNQQDKSNISDVDDDEDDD---------------------------------
--DNEMVPADPE---MLPCTKIWDRI--------TALPKYTSADIENLCNELMSKAKC--
SDKG----------VVVSSLDVDKVLLNEKKSNSRHFQM
>Skud_4.697
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------TLPKYSPLNTDNLCRQLMVNARF--
TDDS-----------------------------RAMLQ-
>Smik_4.698
---------------------------------MS-----------------EQVLANKD
GIPKRKV----GRPG-----RKR-VDSEAKNRRTAQNRAAQRAFRDRKEARLKSLLERIE
LLEQKDAQNKSVIDFLQSSLKSLLSEVTK-YRAK--NVNDERILAFLDD----LQEQQE-
------------------------------------------------------------
--REKEKEASTKINETTETLPSFR-----------------------------------V
IRNTTVN-----TDTEV-ETHLHSSRNSTWDVGLCSTPR---------------------
-----------------------LTNTW--NFPSEN--------------------RTDP
SAISDKSANDSKKLDFSLDVTFNDKLTGINHLD---YDIRSHLSEH--FGDFSSDKVE-P
LAFPSETDNMYFLDEAND-DILLSSVVSP-------------------------------
------------------------------------------------------------
-------------------------------------AKENECNG---------------
-------------------------KCNGKCAEDTPLLNKEI------------------
---------------------------------------------------------KC-
-ELITKRLLNQESLDSIVPASAPYRENIGIRSEA--------------------------
--IRRISSAISNQ--NTSCCHILKEI--------SSLPKYSSLDIDNLCCELMTKAEF--
TDDCE---------IVVRAHDLQTTL-------VKQLL-
>YDR423C
---------MGNILRKGQQIYLAGDMK-------------------------KQMLLNKD
GTPKRKV----GRPG-----RKR-IDSEAKSRRTAQNRAAQRAFRDRKEAKMKSLQERVE
LLEQKDAQNKTTTDFLLCSLKSLLSEITK-YRAK--NSDDERILAFLDD----LQEQQK-
------------------------------------------------------------
---------RENEKGTSTAVSKAA----------------------------------KE
LPSPNSDENMTVNTSIEVQPHTQENEKVMWNIGSWNAPS---------------------
-----------------------LTNSWDSPPGN----------------------RTGA
VTIGDESINGSEMPDFSLDLVSNDRQTGLEALD---YDIHNYFPQH-SERLTAEKIDTSA
C---QCEIDQKYLPYETEDDTLFPSVLPL-------------------------------
------------------------------------------------------------
-----------------------AVGSQCNNICNRKCIGTKPCSN---------------
------------------------------------------------------------
------------------------------------------------------KEIKC-
-DLITSHLLNQKSLASVLPVAASHTKTIRTQSEA--------------------------
--IEHISSAISNG--KASCYHILEEI--------SSLPKYSSLDIDDLCSELIIKAKC--
TDDCK---------IVVKARDLQSAL-------VRQLL-
>TPHA0K00520
-------MSVVSNSKRVLDANI------------------------------GDSESSSS
AASRKKV-------G-----RKLLNDSDVKSKRTFQNRNAQRAFRERKERKLKELEDKVL
ALEQVNEAKELETNFLRSRLKSMADELKK-YRPA--QSSDLEVLEYLAK----KEQLAK-
-------------------YNHNANPIKEEEEVKEEEEDEEGEEGGDNIHANQSFEQESA
KQKQEILSNIEKKKDFTFEYPKQN-----------------------------------K
MPSPESS-----TSITS-SVVTSGKYNVQLQQGSVNNQVTTPDSSV--------------
-----------------------SSSTWIHPVFYEDNAKQLPQFEQPKAVPTNMDVSPAN
SDINQSTSDIVPGSAKSFDAIPFGYDSSLFSND---FNFDDKFSDQ--VSSFCDKVNNPN
YSPENNSLPSLVSENYNA-ESHNNTIALP-------------------------------
------------------------------------------DTTTEFGKKGF-------
---EFANSDATDTFSWNSGAFHEDDPSSKLFIDTLDKQYAVPTSD---------------
------------------------ASIANDFSKANNFIESSLAFPEST-----------A
SVANSMNGNLYFRDSNIDNTIDMLDLLADDDDDEDEVDE---------------------
-SLIKNNLVTEECMDDAQAKSQLCDKY---------------------------------
--KNTVIRAEDGS--YLKCSQVWSRL--------TEHPKYSELDIDGLCTELMLQAKC--
SEKG----------VVVESRDVQKAL-------SKYLSS
>TPHA0D02340
----------------------------------------------------MEEYLDTG
KDKEQNN-------------------ADYRMKRIAQNRAAQKAFRERKEKKMKELQEKVR
KLENINEKNEIETVFLRTQLLSLVNELKK-YRID--KNDDFRLKKIGSQ----LKHEKL-
--------------------------------------------NLNKLTKSSSSSSRLS
SLMEDLNSNKIDTITKTLTNSSFA-----------------SMNGSTHSPTSDFAINNID
IVSPHSA-----SGSFT-NQTTAGTSYSHFSSELNSPTSVSNYFAGN-------------
-----------------------AGTTWPEAFSMTDLMVNSGHMMGGSANNQ----QSNI
NSLSVTMDDEKVSSLVDEKSSILQQDSNLFSTE---FDFANEFDEQ--VSTFCAKMNK-T
FENRKEMIKQFYTEKVRNSNNKPRTVSIK-------------------------------
------------------------------------------------------------
------------------------QEPTTTLQANIQPSDSNDVTE---------------
-----------------------------------SLVAASIAFPEQY------------
----------------NMVKSDSLYNFLKQNNNNIGYGDV----------RGNISTQPN-
-SIMTNNLSNNEQNYNFSKDAQFIVSQQNTVRNIQTANEYPNIYETDDSSDGGDEV----
--VGQIVPLTDGR--LLECGEIWDRI--------TTYPRYSDIDIDGLCEELMASAKC--
SDKG----------VLVSSDDVQKVL-------SRRLV-
>Kpol_1004.22
-----------MDANNDIDF--------------------------------MDFLTESS
SIDSRKNYLNLSTSN---KIRKNDIDAEARIRRTAQNRAAQRAFRERKEKKMKELENKVN
SLENIHQKNEVETEFLRSQVLTLVNELKK-YRSE--TTSDSKILKLVSN----SRENTR-
------------------------------------------------------------
----------DLRHDSITSLDSDQ------------------------------------
--SPLND---------I-SKFNLNLGHINLSNSPNSSSI---------------------
--------------------------------------------------------MSLS
PTASNNLPNAS--------------DSGLFSND---FNFNNQFDEQ--VSTFCAKMNN-N
FENRKKIIKKTYDEKIKL-KSEFSDVNSV----------------------------LAS
PSLSSSRFSD--------------------------------------------------
-------DNSSTYFNTRHHHNNDHNNTTTTKNHNYNNQSMKSEFP---------------
-----------------PLIFFSDNNYMDSPDNSFPLIDASLAFPNNS------------
-NSNRNNNNNNNNNVLFRDISTAEMQFMDESPLQNVEFNS--------------------
-EDAIKRLISEEPSPHYSNSVPHLHNNNVNSASLHPLTVLVQEPDDELD-----------
--EDVVVPSTDSQ--LMRCSEIWDRI--------TTNPRYTDLDIDGLCEELMFSAKC--
SDKG----------VVVASKDVHKVL-------AKHMA-
>CAGL0H04631g
-----------------------------------------------------MAEVDNG
GAQKSSA----SRKK-----RYQELDPETRMKRVAQNRAAQKAFRERKERKMKELERKVV
DLENLTKLNEVETNFLRDQLSILVKELRK-YRPE--TKQDHKVLKYLEK----HKGGAA-
---------------------------------------------GAGNGAATGSVSTST
RHTDLAASNANRVSKDSSILPGAK----------------IIRQDLESFNENRHFNVTGQ
LTPPGNT-----SSSTTANSVAANAKKQSIPHSDSSDSNESKNTWNTDPT----------
-----------------------SSEDWLDDVMTSH--------------------KQIS
RGQSGSG-----------------------------IDFNNFFDEQ--VSEFCTKLNQ-A
CGTKACPIPQSKSAATTPLPGTSSNGNSNSPMIINDTMGDVSLNMQGNEHGNATNNLVTD
PAFLSNTWDDMSP----------------------ASNQHSTGGAPGFGQLGF-------
-------GDNLLGNDILFSPNSPAYSPSVLGSGRTQEVYRSPAVQ---------------
---------------------KVVEKENESKSVNFPFINSSLAFPGDY-------DNNFF
RETTDLNFDDNDQDDNFTNSNDLVNDYFTTNIPDTDNSDS--------------------
-ALIANGLVKEEPSMQTEDTFKVQNTNDMLNSSRMKETIDNQNIGEKTTKDDNEDDDEDD
ENDNTVVPSRDDG--LLRCSEIWDRI--------TAHPKYSDIDIDGLCSELMAKAKC--
SERG----------VVINADDVQVAL-------NKHMS-
>KLLA0A01760g
--------MSTSTAKRPFDNKRAGSPDDGTDSDS------------------GGNNSGSS
PASKRRE----RKPG-----RKP-LETEAKDKRTAQNRAAQRAFRERRERKMKELEDKVS
QLESLNKQSELETKFLRNQVTNLLSELKR-YNPELPKKRDSILLDYLAK----QRKASI-
------------------------------------------------DSNPDFSAAANK
AANSKDSSTAISSSNFQFEFPWKM--------------------------------DPSK
IPSPSSDST---SPSAS-TSILDNANNKSVSSTNLNHSR---------------------
--------------------------------------------------------SSIS
NSSSSPSNVNGLSSRKHSNTLNLYQTQSNVTSE---FDFDSQFDES--VSSFCSKLSM-A
CGTKSNPIPKASPVSTPS-SSDLLKPKSNSNVNITNHNNNKINSKDLSSSAPLHDSASAS
ALNNHDSVNAVSNQFSVDKQYNDSSHSQATPNGLDNDSSVSAWQQPSFGQLGF-------
--------RTDQLFDLDLDSASPITKQKDNNYSTTTNNTNSPAKA---------------
-----------DGMYWNFNTPLSNMVSRNMQNPEIPFIDTGLAFPDYD------------
---------------------DPLLDILKEEQENEQVEGD------------------S-
-DPIQALINEEPSMPLCHDPAANAGASVSETDKLSNQEEI--------------------
--VQDIIPSNDGK--LLKCSEVWDRI--------TAHPRYSDLDIDGLCLELRTKAKC--
SEKG----------VVVNAEDVQKAL-------ISHMQ-
>Kpol_1023.97
--------MTSVTVKRPLDESLTALSPNDNNSSILN----------------ASTDVDAS
TVANANK----KKVG-----RKLLGDHEVKNKRTAQNRAAQRAFRERKERKMKELEDKVH
ELEKVKQQNDVESEFLRNQLTLMIDELKK-YRPE--KSSDIKVLEYLAK----HEENGS-
------------------------------------------------------------
--TEKIKKNIQRKEDFSFEYPPPP------------PHSQTQGSSADTNVTYNKQNTDQR
LPSPGSS-----SGSSP-NMLMLNNKKQSILNNRITTPSSSTS-----------------
-----------------------SSSGWMDNVFYKDDAQNLPHFDTSSTSTNTAFRDSPV
NNSINSIKLEDNLKNNNNSALTVGYDSDLFSND---FNFDDHFDQQ--VSSFCVKMNQ-A
CGTKQNPVPKTMAESNKS-QKTPPSEGNP--------------STTPNESSNDSSLSIAK
FDDPNFLFDSPSN---------------DFTNTLDIPSVDSSNANSNFGQLGF-------
-----HGLSNDITFNSNDSNWNDFISLKTDSMTSVPTTSSVATND---------------
----------------HPINISKPSEENSPRKEVLPFIDTSIAFPETK------------
ADFDAFDNQMFFRDDGFNESLNISDDIVGAESDDEQDNNN-----------------DN-
-DLISKNLVCEEVKE---------------------------------------------
--HDMVIPTSDGK--LLKCSEVWDRI--------TAHPRYSDIDIDGLCQELMHNAKC--
SDKG----------VVVDSKDVQKAL-------SNHMS-
>ZYRO0D12584g
--------MSTTSAKRPLEPTVSLDFAED-----------------------EADDSPTS
DEPRKKG----GKPG-----RKP-LDSEAKSKRTAQNRAAQRAFRERKEKKMKELEDKVH
ALEELNQQSLVETEFLRSQLVTLVTELKR-YRPE--NPNDSQVLQYLAK----TENSKS-
---------------------------------------------------DDSSQNKKD
SESKEIEESVRRKMSFTFAFPWKNEFNNDHRNSEDKGNLSSHGEQQRSKQQHDNNNILMQ
FPSPGSS-----SKSSS-QSSSSLKPKNGLSTPSNGDGIRKGSTGNNSSINQTNGSISSS
NGFTPGS----------------TSTGWMDNVFYNDDA------------------RQLP
QFYQSNNNNENSRLFEDNTTMPGDYDSVTFSNQ---FNFNDKFDEQ--VSEFCTKLGQ-V
CGTKDCPIPQKQKSSYSS-PAVPKSPIVF-------------------------------
----SNTWDTPSE-----------------------------------------------
-----------DPQQQLPTLEENLSDPSIRQTNAYSNTDGGDGDD---------------
-------------------EGIVVSMNSPEKNSELPFIDTSLAFPEEQ------------
------------DLFREQQPDNMFAEFIEHDPQRDTTNGN----------EGNTSPDQD-
-EFLASGMVQEEPAVTTGEVKDNTNDNVKDGKIQDEGKEAPN------------------
--SDVVVPSSDGK--LLKCSEVWDRI--------TSHPKYSDMDIDGLCQELMAKAKC--
SERG----------VVVQAEDVQYAL-------NNRVE-
>TDEL0A03920
MERALPPLISRTSTRSNTSSMSAMSASTVKR---------------------PLEQSSSP
MAPAAKG----SKPG-----RKP-LDEETKNKRTAQNRAAQRAFRERKEKKMKELEDKVQ
SLEQANRDTVVESEFLRSQLLTLVNELKK-YRPA--KANDLQVLDYLAK----HERTEP-
------------------------------------------------------------
-TDKEIEQSVQKKMDFTFAFPWKD--------------------------RKEAEAQAQH
FPSPGSSMLSSSSASVN-SAASPSNKRRSTASRSTSTST---------------------
-----------------------STTGWMDNVFYSDDA------------------QKLP
QFAIKGDSTADP----------------LFSNE---FNFDDQFDEQ--VSQFCTKMNK-A
CGTRECPIPGFTPQMASP-QVASPQIL---------------------------------
----TNSWDTVAS--------------------------------PAFGQQSL-------
-------------------------------------APSKKQLT---------------
--------------------------KTPPSQPELPFIDPTMAFPTDD------------
--------DEGLFFRTHRDENSLFAELLDEVEP-----------------------TDN-
-NFVNENLINEEPSTTTAVAEETRPKPKT-------------------------------
--ETDVVPSRDGK--LLKCSEVWDRI--------TTHPKYSAIDIDGLCGELMTKAKC--
SEKG----------VVVQAEDVQRVL-------DKHMDV
>SAKL0G04950g
--------MSTVAATAPAATTSAASAAAAAAAVHK-----------------RPLDNEPT
AQAKRKGTKPASKPG-----RKP-LGTEAKNKRTAQNRAAQRAFRERKERKMKELEDKVT
HLETVREQNEVETEFLRSQLMTLISELKK-YRPE--QSMDTQVLEYLAK----REEEKK-
-------------------------------------DNSQDRSGGSANTSEEGADVSHS
SSESHIRDNIQKKMDFTFEFPWKD------------------------------NAGRTQ
FPSPGS------------SSVSSNHKPSFSSNAPFNATNNTP------------------
-----------------------STSSASLDMFYQD--------------------DALP
KFTSSSLERGNN-------SGTIADAGFSITND---FDFESHFDEQ--VSEFCTRMNQ-A
CGTRDSPVPQTLSNQS---SSTTTPITMTTTTRHDTATAPAPAPALAPEEPNAASSSPQA
GLNLTNTWET-----------------------------------PSFGNLGF-------
-------GGDGDSHGNGDGHGHGNGDDSNKWLFTSDLGPSPGAAA---------------
------------------------ANTPSNSADILPFIDTSIAFPTEQ------------
-------NELVFRDTAANNSSTVFDEFLEEDPVVHQLTTE--------------------
-ESVYDVFSNDYGAKKGKPFSPEENKGNYTTLPLSQESSNPLV-----------------
--SDDVVPSRDGK--LLKCGEIWDRI--------TSHPKYSDLDIDGLCMELRTKAKC--
SEKG----------VVVNADDVQKAL-------AKHMS-
>KLTH0G03784g
----------MSTVKRQ-----------------------------------LEASTPPA
DLPKRKG----SKPG-----RKP-LDTEAKNKRTAQNRAAQRAFRERKERKMRELEEQVE
RLEKVREQSEMESEFLRSQLQMLIAEIQK-YRPQ--QSSDSQVLKYLAE----AEERCKA
APVEKRTGRNAARSSISTSNRDDSENASRSRSRSTSLSEHNTLDTSRPQRYSENSSPADQ
DEAAKINANVQRKMNFTFEYPKDM------------------------------PPANGA
FPSPSGS-----TSTTS-NHSFSHRPFSQLSNTPRTSS----------------------
-----------------------GSLDFLGDSASNT--------------------QSLP
KFPTSESGNGD-------------------------FDFNTHFDEQ--VSVFCTQMNE-V
CGTRECPLPQALPPSTAA-SVTPRPISPI-----QEEQPELSKPAQAKIPAADAFLKQAQ
QQQPPNAWDS-----------------------------------PQFGHSGF-------
--------------------GMGTEDPTNRWLFPDFSSGNMSSTV---------------
-------------------------RAPSAKIDSVPFIDTSMAFPTDQ------------
-----------PDALLPQNSDDVLNQFFEEDPIVSQLTTE----------ESNYDPFKPD
LQPSADSETSKHSVSSCSNDSDPSRAESNASTALTEPNYTIDKTSVPSAVLAAE------
--DADVVPARDGL--LLKCSEIWDRI--------TAHPKYSDIDIDGLCMELRTKAKC--
SEKG----------VVVNSDDVQSAL-------AKHMS-
>Kwal_47.18631
----------MTTVKRE-----------------------------------LETPTAAE
ELHKRKG----SKPG-----RKP-LDTEAKNKRTAQNRAAQRAFRERKERKMRELEEQVE
RLERVREQSELESEFLRSQLQKLLAEIQK-YRPR--QSSDSQVLNFLAKAEERRKSSQEA
AAAAAAAATTAATTTGDSASRHSSDSLSNSRSRSTSITAQDGTGVPSHLRGSSNSSPADP
DEAAKINANVQRKMNFTFAYAKDP-------------------TTSTGNANHSSTSGSAA
FPSPSGS--------VS-TSSSHNRPFSLSSNTPRTSS----------------------
-----------------------GSLDFLGYNSNNN--------------------QSLP
KFVPSEPAKTE-------------------------FDFNSHFDEQ--VSEFCTRMNE-V
CGTRECPVAPALPPSTAMAHTTPSSAQPQ---------PDSLTRRPSQELSEKHLQNQLS
PQAASSVWDT-----------------------------------PQFGHSGF-------
--------------------GSDLEDPTNRWMFAGFNAATEGGVI---------------
-------------------------RTTSATADSLPFIDTSMAFPTDP------------
-----------QEDLLAPNPDDVLDQFFEEDPIVSQLTTE----------ESAYDQFKS-
-PPYAPYDMSKTSASASSNDSANSSADSNASTALTDPNYTTYKPGAPTPATSTAMAATTF
LSEDAVVPARDGT--LLKCSEVWDRI--------TSHPKYSDIDIDGLCLELRTKAKC--
SEKG----------VVVNIDDVQRAL-------TKHMS-
>KNAG0B03680
--------MAATVASAMVTPEVHADRGRDR----------------------DLEVVDSG
AEPLKKR----THTA-----SKP-LDKEARMKRTEQNRAAQRAFRERKERKMKELEAKVD
KLTRIQKQNEVESEFLRGQLVTLVHELKK-YRPE--TSNDSKVLEYLAK----HDNVPP-
------------------------------------------------------------
-NQQGQAPAARDRGDFSFEFPWKG----------------------------------RT
APEFDNSTTQETTTATP-SPVSPGTKDQQG------------------------------
-----------------------KPTDWLDEV------------------------LSST
ELYAKQQQQQLQGNRSESPFLAGYDDSLTVSNE---ITFDTQFDEQ--VSDFCVRMNE-A
CGSKTNPVPKSKKGSVFSNSVLSPPSLLN-------------------------------
--SLSNTWGT--------------------------------------------------
---------------DRTDAGSATSETTSPRLTESSSSTVTTNND---------------
--------------------------LKLDADFEIPFINTSLAFPTDD------------
GAVPQTVDDNIFFRDTQHEQRSALDDFLEEEELTDNQQQQ-----------------QH-
-EEKINLLINEVPFSIEADKEVPFSIEPNEDG----------------------------
--DPQVVPSKDGK--LLKCSEIWDRI--------TAHPKYSDLDIDGLCGELMTKAKC--
SERG----------VVVNADDVKDAL-------NRHIA-
>NDAI0C01060
-----MTTVGTTTGKRQLDLIDQQQQQQQQFETQNANNTRPKDSTENA----TTNPMKKQ
DLDNKTN----TEQSNGNSKKKQLLDPEARNKRTAQNRAAQRAFRERKERKMKELEEKVA
NLTKIQKQNEIESEFLRSQLITLVNELKK-YKPN--NENASKVLNYISN----SNSNSN-
------------------------------------------------------------
-PDLNLNSKFSPMESDASAMKRST-------------------GSVSSGDSNSRTMTSMD
APSMSTT-----TSVQS-NPLNLKPHNNMTLNDILPPATTVASTSTLDAN----------
-----------------------PSSTLFDSLLANDDLFTQQLMSFANNANNNN--NNND
SVTTLDNSNTQQQNLQQPQITPPIEDSNLISNS---FDFNDKFDEQ--VSDFCGKMSM-A
CGTRSNPIPKSKSNVSTPQSIMNSNNKSPISPLNDSTLAKSNVITTSNIFDHQSNTPQAI
NSNLTNTWGIPSA-----------------------------------------------
---------SPNSNDSSPNNIVPTQDNSNVNMNFGQLGFMMDSPQ---------------
----------FQNIDLSLPIENDKFSASNFKKPSLPFINPTLAFPNDD-----------L
FNKNNSNNDNNNNTTTTHDESDLLSQFLANDYSNTISTNN----LMNSDDDEDEDDDDYE
KKLVANNLINEEPSSTNKNNNLTSTSKEQENNDF--------------------------
--DDFIVPSRDGG--LLRCSEIWDRI--------TAHPKYSELDIDGLCSELMTKAKC--
SERG----------VVVNAEDVQMAL-------TKHMS-
>NCAS0H02560
--------MSTTTAKRPLELDPNSRLQFAQSKEQQQEL--------------ERYSTEDA
GSRKKQEVSGTSNAAATTNMTKKQLDIEAKNKRTAQNRAAQRAFRERKERKMKELEEKVN
NLTKIQKQNEIESEFLRGQLITLVNELKK-YRDP--NPNESKVLEYLSQ----HNGNNK-
------------------------------------------------------------
--------------DFTFQFPETS-----------------NLNKKVTIPSPDGSFERQQ
QKKPSTSSISSNDDSSS-SNLMQTINTPSMSTTTSVSSNQNQNLTGTTNNK---------
-----------------------TSLEWFDNMFNNDDLFN----------------QQLL
SLSNTANANKNTTTTATNTSLLQLDDPNLITNN---FDVTDKFDEQ--VSDFCGKMNM-A
CGTRYDPVPKSKSNTSTPQNNNSSLLSPP------------SNSKQIANQSNLFNLNTPP
NLNITNTFDF--------------------------------------------------
-------NSPLDSPQQQNQAFGQLGMPNSPQFLSAFELPTENSIQ---------------
------------------KQPQQQQPMASKKSPTLPFINSSLAFPTDD---------IFN
NTISNNNNNSNTNGPLFNESSSLLSDFIRNEDGNVSDSDN-----------DADSDFDN-
-DLINKNLINQEISNPVLAPAPTSVPASTAATAAPEDEDD--------------------
--DEFIVPSRDGG--LLRCSEIWDRI--------SAHPKYSDLDIDGLCSELMTKAKC--
SERG----------VVVNAEDVQLAL-------TKHMS-
>KAFR0C05400
------MSALTASTKRPLESTTST----------------------------DNDTDDKN
AIPKKNN----ASKS-----SRTELDQEAKLKRTAQNRAAQRAFRERKERKMKELEAKVD
HLSNIQKQNEIESEFLRSQLITLVKELKK-YRPE--TANDSQVLNYLAK----HENGNF-
------------------------------------------------------------
------NENLSKKSNFSFAFPWDD------------------NNATTDKSDNLNTTTNNN
IPSPDNSPVTASNDKKN-YPSSVSSIEPLNQNNNNNISSLSPSLDDNDGIS---------
-----------------------PSINWLDNMLHTEDLFN----------------EQLS
SFSNTPISRNDSNESKNPMT-----DSQLISNE---FNFEDQFDEK--VTDFCIKMNQ-V
CGTRSNPIPKKSTSNLPSTESTPLFTNTF-------------------------------
------------------------------------------------------------
----------------------DSPSFGQLNIQNIESTNSDNTNN---------------
-------------------------DTTPDDNGIFSFLNPSLAFPSST------------
------------------SPENSLSDGSINNNIDNNNNSS-------------LNNFRD-
-TSIFDDFLKHEAEPSVEDLINEEIDD---------------------------------
--INDVVPSKDKN--LLRCSEVWDRI--------TAHPKYSDIDIDGLCGELMAKAKC--
SEKG----------VVVNAEDVQSAL-------SKHLS-
>Suva_13.155
--------MSISAAKRSLDLVSSSS------LAQSDDSVSHHDEVENDHIHDDMHDNDDN
DQPRRKG----SKTS-----KKQDLDPETKLKRTAQNRAAQRAFRERKERKMKELEKKVH
SLESIQQENEVEATFLRDQLVTLVSELKK-YRPE--TRNDSKVLEYLAR----RDPNLH-
----------------------------------------------PPNSNTNNNSEPIV
TPNDDIQKNVKQKMNFTFQYPLDN-------------------------DDNDGKNMEKQ
LPSPNDP-----NHSAH-VPIAPTQKKLSDATDSSTATLDSFSNNNDVL-----------
-NITPNSS---------------SSMDWLDNVMYTN--------------------KFVA
GGDQKNASNESK-------SKPKGVDSNMFSND---FNFENQFDEQ--VSEFCSKMNQ-A
CGTKQCPIPKKSVHQLDK-EVFASSSVLS----------------------------ANS
PVL-TNTWDSHSN----------------VTTNTPANITTNGSSSSSFGQPGF-------
-------DLNTNHYATNDKYTDNSDNNKTNNYNDILPFISESPFD--------------M
NQVTNFFSPGTNNTTNANTTNSHNPSLQQSTKDDIPFINTSLAFPDDNPTNIQLQPLSQS
QHQNKFDYDMFFRDSSKEGN-NLFEEFLEEDDDDDDDDGN--DGNDNDGEAVNASDDES-
-NLIKNKLINEEPQQQSQCHLSTPKNGSEVLQNKNSSNSEDVNDN---------------
--DNEVVPSKEGS--LLRCSEIWDRI--------TTHPKYSDIDVDGLCSELMAKAKC--
SERG----------VVINAEDVQLAL-------NKHMN-
>Skud_13.147
--------MSVSTAKRSLDLASPGS------LAEFDDSAAHHDEIENEHRHDSTRDDDDN
EQPKKKG----TKIS-----KKQDLDPETKQKRTAQNRAAQRAFRERKERKMMELEKKVQ
GLENIQQQNEVEATFLRDQLVTLVNELKK-YRPE--TRNDSKVLEYLAS----RDPNLP-
---------------------------------------------TSNNSTNSSSNRPII
TPSEEIQENVRQKMNFTFQYALDN----------------------------DSKNLEKQ
LPSPNDP-----SHSAP-IPTTQAQKKSSDATDSSTATLDSLSNSHDVL-----------
-NNTPNSS---------------SSMDWLDNVIYTN--------------------RFVA
GGDGSKLEVKNV-------------DSNMFSNN---FNFENQFDEQ--VSEFCSKMNQ-V
CGTRQCPIPKKPVSTLDQ-EVFASSSILS----------------------------ANS
PAL-TNTWESHSN----------------ITANTPANITTNDTSLSGFGQLGFELTTSRH
AAEENSTGNTDNDNNSGDSSNNKNNNNNNNNNNNSNNNKNNNNNGDDGGVIPFISDSPFD
MNQVTNFFSPGSTNNINIAASSANPSLSQNTKDDVPFINAGLAFPDENPTNIQLQPFSES
QSQNKFDYDMFFRDSSRAGN-SLFEEFLEEEEDDDDDDNN-------NEKATNASDDES-
-SLIRNQLINEEPQPLNQNSLSSLNNEKETSPKTNSGGTQNANDSDGNDN----------
--DNDVVPSKEGS--LLRCSEIWDRI--------TTHPKYSDIDVDGLCSELMAKAKC--
SERG----------VVINAEDVQLAL-------NKHMN-
>Smik_13.144
--------MSVSTAKRSLDLVSSGS------LAEFDDSKPHHEEIENEHTSNGTRDNDDN
EQPKRKG----TKTS-----KKQDLDPETKQKRTAQNRAAQRAFRERKERKMKELEKKVQ
SLESIQQQNEVEATFLRDQLVTLVNELKK-YRPE--TRNDSKVLEYLAK----RDPNLH-
---------------------------------------------SSSIKANHNNSRPII
TPNDEIQENVKQKMNFTFQYPLDN-------------------------DSDENKNKERQ
LPSPNDP-----NHSVS-IPIAQKQKKSSNTTDSSSATLDSLSNSNDVL-----------
-NNTPNSS---------------SSMDWLDNVIYTN--------------------KFVS
GDDGCKRETKNV-------------DSNLFSND---FNFENQFDEQ--VSEFCSKMNQ-V
CGTRQCPIPKKPVSTLDK-EVFASSSILS----------------------------ANS
PSL-TNTWESHSN------------ITVNTPANVIGNDTSIDTSFSSFGQLGF-------
-------GVAANHHDVNNDNTSSTGNKNGSNKNSTNNDDVLPFIS----------ESPFD
MDQVTNFFCPGPTNTINNVAASANSNFLQNSKDDIPFINANLAFPDENSTNIQLQPISES
QSQNKFDYDMFFRDSSKEGN-NLFEEFLEEDDDDDDDGNK---------KAYNTSDDES-
-SLIKNQLINEEPQSTLKNESESAQRKDSYVQEAIDNNNGNGN-----------------
--DNDVVPSKEGS--LLRCSEIWDRI--------TTHPKYSDIDVDGLCSELMAKAKC--
SERG----------VVINAEDVQLAL-------NKHMN-
>YML007W
--------MSVSTAKRSLDVVSPGSLAEFEGSKSRHDEIENEHRRT------GTRDGEDS
EQPKKKG----SKTS-----KKQDLDPETKQKRTAQNRAAQRAFRERKERKMKELEKKVQ
SLESIQQQNEVEATFLRDQLITLVNELKK-YRPE--TRNDSKVLEYLAR----RDPNLH-
---------------------------------------------FSKNNVNHSNSEPID
TPNDDIQENVKQKMNFTFQYPLDN-----------------------DNDNDNSKNVGKQ
LPSPNDP-----SHSAP-MPINQTQKKLSDATDSSSATLDSLSNSNDVLNNTPNSS----
-----------------------TSMDWLDNVIYTN--------------------RFVS
GDDGSNSKTKNL-------------DSNMFSND---FNFENQFDEQ--VSEFCSKMNQ-V
CGTRQCPIPKKPISALDK-EVFASSSILS-----------------------------SN
SPALTNTWESHSN-----------ITDNTPANVIATDATKYENSFSGFGRLGF-------
-------DMSANHYVVNDNSTGSTDSTGSTGNKNKKNNNNSDDVL------PFISESPFD
MNQVTNFFSPGSTGIGNNAASNTNPSLLQSSKEDIPFINANLAFPDDNSTNIQLQPFSES
QSQNKFDYDMFFRDSSKEGN-NLFGEFLEDDDDDKKAANM--------------SDDES-
-SLIKNQLINEEPELPKQYLQSVPGNESEISQKNGSSLQNADKINNGNDNDN--------
--DNDVVPSKEGS--LLRCSEIWDRI--------TTHPKYSDIDVDGLCSELMAKAKC--
SERG----------VVINAEDVQLAL-------NKHMN-