MUSCLE (3.8) multiple sequence alignment

TBLA0B00570        ---------------------------------------------MFEAPLNI---HSKV
TPHA0J00510        ---------------------------------------------MFELPVSSN--ITIN
Kpol_1037.11       ---------------------------------------------MFEVPTIDS--TKRS
KNAG0E00910        ---------------------------------------------MFELPVLLGSFSESQ
KLLA0C05852g       ---------------------------------------------MFQLPVID---RSSR
ACL020W            MVSSFVVSFFKSKFVASRCLISDNPKKPSLESSRLVLQPLWDALTMFESPIVS---YSKR
Ecym_3049          ---------------------------------------------MFESPIIS---YNSK
CAGL0J11792g       ---------------------------------------------MFEVPITY---NCRR
Smik_13.106        ---------------------------------------------MFEVPITL---TNKK
YML043C            ---------------------------------------------MFEVPITL---TNRK
Skud_13.105        ---------------------------------------------MFEVPITL---TNKK
Suva_13.117        ---------------------------------------------MFEVPITL---TNKK
SAKL0E01980g       ---------------------------------------------MFELPVVR---TNKK
KLTH0C10582g       ---------------------------------------------MFELPLVR---NTKR
Kwal_56.22527      ---------------------------------------------MFELPLAR---NSNR
KAFR0L00420        ---------------------------------------------MFEIPVNV---NSKT
NDAI0D00890        ---------------------------------------------MFELPIIY---NNKR
NCAS0H00900        ---------------------------------------------MFDLPTQI---SNKR
ZYRO0C07172g       ---------------------------------------------MFELPLVI---TSKR
TDEL0G04240        ---------------------------------------------MFEQPVAL---TTRR
                                                                **: *          

TBLA0B00570        LANERKIRYQYINTF--TKRYSQLYGDTIPSSSLESNRSRTPITLPTPEASAHEHSD---
TPHA0J00510        AFNLKKLRYQYINDI--NAKHNE----L------------SKNELPTPVTSENDTGGEDL
Kpol_1037.11       VVNFKKLRYQYMNHMYERNRYNK-----------------NGQGLPTPVSSENEMNA---
KNAG0E00910        SLVRKKLRYRYRNEI--KNQYKR----IKIH---------DENGQLTPESSHTELDD---
KLLA0C05852g       NRKRRKIRYQYINSL--KRKYDQ-LNYNQSEASVSSEADNVTNGILTPENSESSEAE---
ACL020W            SKQQRALKYKYVSCV--RRKYEQ----LNGLSDSDKQAHIDSACFPTPDNSAAEAS----
Ecym_3049          DRKRRKLKYKYINSL--KRKYEH----LVGTQGGSKGSTKDTSGLPTPGNSAAEAS----
CAGL0J11792g       LNVERRVRYQYINIL--SRKYHA----KRRSKRRR-----QANSLPTPENSAVENDQ---
Smik_13.106        FAQRRKLKYQYINHT--SRRFEK----IVKKST-------TALSLPTPENSAAENNE---
YML043C            FAQRRKLKYQYINYI--SRRFDR----ISKKST-------TTDSLPTPENSAAENN----
Skud_13.105        FAQRRKLKYQYINHL--SRRFDK----VAKTTN-------TTDSLPTPENSAVENNDDDY
Suva_13.117        FAQRRKLKYQYINHI--SRRFDR----ITKKSN-------TTDSLPTPENSAAENNDEDY
SAKL0E01980g       IRSKRKLRYQYINTL--NKKHEQ----LNPKK--------QTVGLPTPESSAAETS----
KLTH0C10582g       VRTVRKLRYQYINTL--YQEYRK----VQSFAN-------ANSTLPTPENSAAEEAS---
Kwal_56.22527      VRTVRKLRYQYINSL--SQEHRR----IQDSAA-------AHATLPTPENSAAEDAS---
KAFR0L00420        LSNERKLRYRYINQF--TRRFER--------KD-------DRNGMITPETSEDE------
NDAI0D00890        TATERKIRYTYINQL--SKKYNRTQNRHNNNNN-------NNGILPTPESSATESHD---
NCAS0H00900        IANERKIRYTYINQL--SRKYNR----QDA----------ESSSLPTPENSASESHE---
ZYRO0C07172g       TRTSRKLKYQYINNL--SKKYDG----INGISN-------GQTELPTPENSATETSE---
TDEL0G04240        LRNAKKLRYQYVNNL--SAKFNR----LERIT--------NTNGLPTPENSAAESSE---
                       . :.* * .       .                         **  *  .      

TBLA0B00570        -----------------------------------SNTNYNDDSDSISNTNTLSDDEYN-
TPHA0J00510        DGDSEHNLTSEDAE-------VAQERRIRRWKSIMGEAIDDDEDDNNHDDDVDNEFEDN-
Kpol_1037.11       --SEDE---------------VSHKRVRKRWRRIVGESVSSDEEEEEEEEDEQEQEG---
KNAG0E00910        --HESRSRVC-----------RGRKRRLYDLRDREEHGFESDSSEAQDEVGDLPEKEEE-
KLLA0C05852g       --AADL---------------EKKHRRKRRLQSVLGNALDSSDEELDGDEDGTDEN----
ACL020W            --DGDALEGDVDTAA------RRLKRKRLRLQSILGHATLDAEEGDLGSEEEDDLNGGS-
Ecym_3049          --DGDGREEDELSR-------LRRRKRRIRLQSILGHAADEDEDEAEAEGAVGSEDDDG-
CAGL0J11792g       --SESQLP-------------SREQIKEKKMKL--GEDYSDSEAETSSEGEDTTKDDNE-
Smik_13.106        --EDDGERNGEGGAYRRLILQQRKRRRERHWKSVVGEIYSSTETESDSQEDAEEDEECN-
YML043C            --DEEEGQNSEAGTYRRSVLQQKKRRRERHWRSVVGEIYSTTESETDSQEEETEEGGEH-
Skud_13.105        DYDEDEEQIDEADVYRRSILQQTKRRRERHWKSVVGELYSSTETESDSQQEEIQENDGR-
Suva_13.117        D-DDEEERNYESDAGESSIRQQTKRRRERHWKSVIGELYSSTETESDSQEEDDQEGDQV-
SAKL0E01980g       --DTDELEDSQS---------KRTKRRKRRLQSILGHAVSSSDEDDISEEENDNDYEEC-
KLTH0C10582g       --DGDHNSADAT---------SRRRRRKRRLLSVLGHAETDTELSDMEAEEGSHEADQA-
Kwal_56.22527      --DGDQDSEDAG---------SRRRRRKRRILSVLGHIDSESELSDVDMSTESHHSELQ-
KAFR0L00420        ----------------------LQQRKKRDWLHVIGEYGSDDDERSGGQQDDEEEEEEV-
NDAI0D00890        --DDDATTSDDL---------IKRKRLRRRWKSVIGEAYSDTDLDDDDDDEEEEEDVDVE
NCAS0H00900        --STGEDEE------------VRRRRLKRRWKNVIGEAVSDTDEDEDGEEEREDEGPE--
ZYRO0C07172g       --NEEVGQ-------------QKRRRIRKRLKSIIGESYSDLESDEEQPVEEVD------
TDEL0G04240        --NEEALQ-------------RKKKRIRRRLKSAAGESYSDSESDEVDNNHDNEVVEDE-
                                                             .                 

TBLA0B00570        --------SDSTGTTNEETKFFNRYDRPQESFEVWNTSIDTLNSKTKLKSNGRIPINRNK
TPHA0J00510        ------------GPTDEEKKYFLRYDKPQESFEKWES----------NNLKRQRHVNKNF
Kpol_1037.11       ---------------DEEKKYFSRYDKPEDSFERWAS-----------NTKHRKSINRKM
KNAG0E00910        ------------EIGHEERKYFKNHEKPEDLYEVWHV----------ATERRKVPIQRQF
KLLA0C05852g       ---------------DPETQFYESHIKPQHTFEVWNV-----------NTALRTPIQRKK
ACL020W            ------------TAKDYEKQFFARYYKPEYTYELWAT-----------SPKNRVPIRRKM
Ecym_3049          ------YEDGYLDEKDPEKIFYSKYYVPEETYEVWTT-----------SINNRIPIQRRS
CAGL0J11792g       ---------FANDMNKFEKLFYRKYEKPEHSFEVWYDG-------NSVNTKKKHELKKTH
Smik_13.106        -------TEGKEEDIDEERKFWKKYEKPEESFEVWRT----------VSSQNKSPINKQK
YML043C            ------DTGIDKEDSDEERKFWKKYEKPEKSFEIWRT----------VSSQNKQPINKQK
Skud_13.105        ------ETGRKNGDTDEERKFWKKHEKPERSFEIWQT----------ASLQNKGPINRRK
Suva_13.117        ----EHETRLKEEDTDEERKFWKKYEKPEKSFEVWQT----------VSSHNKSPINKQK
SAKL0E01980g       ---------------DYEKHVKNKYYKPQETYELWTT-----------GPENRVPLNTTS
KLTH0C10582g       ---------------DSEKEFFTRHEKPQETFEVWNT-----------DRQKAVPMNTAT
Kwal_56.22527      ---------------ESEKEFFSHHEKPQDTYETWNT-----------DRRKAVSMTTAT
KAFR0L00420        -------IDEDYNLNNEERKFFKKIDKPQETYEHWPS------------HRKKTRIQRDI
NDAI0D00890        DEMSDHHESAHHIHENEERKFFKKYEKPQETFEIWQT-----------NNLKRVPINKSM
NCAS0H00900        ---------------NQERRFFKTHEKPQESYEIWST-----------DNNKRMPLQKKF
ZYRO0C07172g       ---------------NEERKFYRKYEKPQLTFEKWQC-----------DPRKRTPIQRNR
TDEL0G04240        -------------EEDQERKFLNNYELPQESFEKWQD-----------DPSKRVPIQRSK
                                    *         *:  :* *                    :    

TBLA0B00570        ISFNRLNRVKKFTNKKLEARLQHCTKRLKTHIKAISEGYETSYRD-----KQTTSFNNIH
TPHA0J00510        ITYYRFKKTRKQIDKKYKVKTMHLNKNVKNNFELMIDGFEPINDNNISRNRNLQNYNKHH
Kpol_1037.11       MSYKKYNKLTKYSRKKIQVPLIRSNRKLQENFLSVIDGYELIDDNI----NLKENFTMVN
KNAG0E00910        VSYNRLQTIERRAKRKMEVPLLHVSRVRSSEFSAEIDGYDVVSRGD-----ETTHFENKH
KLLA0C05852g       ITYNAVKKLEKAATKSVTKKLNYQTKKLNMYFQALKFGFDVYPKP------QLSKQKTMH
ACL020W            LSYQAFKQIENYSNQRMKATLSLSTKKAAAYHEVMRLGYETCPKE------EVTNYQKLH
Ecym_3049          MSYHVFRTIEKYAHKKVAASLALSSKKLTGFFEVIRSGYETCPRE------RITNYQKVH
CAGL0J11792g       IHYTRLNRVERIAKKRVEKNVVHMPLVNKRYFDIKSEGYEVLEPLV-----DIDSYLLKH
Smik_13.106        MTYHTFKKIEKNSLRKMEVPLLHCTKESKLHFQSLSKGLEPLQPST----SEVRNYRTKH
YML043C            MTYHNFKKIEKIPLRKMEIPLLHCTKENKLYFQSISRGLEPLKTST----SEVRNYRTRH
Skud_13.105        MTYHKFQKIQKNSLRKVQIPLLHCTKENRLYFRSLSKGLEPLQTPT----STIRNYQTRH
Suva_13.117        ITYHNYKKIEKNSLRKMEIPLLHCTKENKLYFQLLAKGLEPLQSPT----SAARNYQTRH
SAKL0E01980g       MTYKQYKKIHKAAHRRVTRTLSYSSKNSAAFFSAIYNGYEPYETS------QLENYQTTH
KLTH0C10582g       LSYDTCKQIEKHAQKRVSAGMAHISKNANFHFQAMKDGYETVAET-------PESHHLVH
Kwal_56.22527      LSYAENKLIEARAQRRVIERIGHFSRIARSHFNSIKRGYEIYSRP-------SQVHQTTH
KAFR0L00420        LTYHRYNKVSRYVERKMANSLVHVSSKNRYHFKCKIDGMEIVEPLH----KGATNFQLKQ
NDAI0D00890        ITYTKLKKIEKQAKRKITVPLLHASKINKLCFEAMSEGLELVTPLV-----TIENFSLQH
NCAS0H00900        ISFSKLNKIEKSTKRRMQGSLLHSSKFNNICFESISQGQELVTPLH-----TPESFTLKH
ZYRO0C07172g       INYNRMNRIQRHGLRRMETSLAVASRTNKTFFHATTQGYQLFDPTY----GRANTFQLKH
TDEL0G04240        ISFTKYQRLRRHAKRKMNTSIDLASKRNKIYMDTISEGFEMVDPVD----GKPDTFQMKH
                   : :   .       .                      * :                   :

TBLA0B00570        IENLINLLYYNICEKNFNQAYHIFSLIIRLPNIDIRNFWNLGSIILLKKVSIQ----ESL
TPHA0J00510        LSLLTDLMYSNIFKQKWDIAYKCFTFLLRIPDVDIRRVWNLGSIILQNIDTT-----KLI
Kpol_1037.11       VKLLTDLMYESIFKENWKIAYRCFTLLIRLPKTSIRKIWNLGSMIIENLEGIN----KTI
KNAG0E00910        IQLLVTLLHRHISTENWNLAYKVFALLIRMPRVDIRAVWNLGVAILARRDST-----TAI
KLLA0C05852g       LAHLNQLLYTNVLNQNWEIAYRCFSILIRLEDVDVRSLWSIGSEILNSLGDTQ----SNE
ACL020W            LNHLVGLLYSNIISENWGTAYRCFALLIRMKSVDLRSIWNLGSHILSHLNFD-----MHE
Ecym_3049          LHHLVDLLYINILRGDFDTAYRCFSLLIRMNFVDLRSMWNLGSKILEHYNLD-----DQE
CAGL0J11792g       IEILTQILFSSVSQGNWDIAYRTFSLLIRIPEVDIRNIWGLGTRILMERGQTT----RSL
Smik_13.106        IITLTNLLHLNVSRHNWSLAYKIFATLIRIPGVQIKSIWGIGVEILNNSPNLS----TSL
YML043C            IVTLTDLLHLNVSRHNWSLAYKIFATLIRIPGVQIKSLWGIGVEILDNLSNSS----SGL
Skud_13.105        IITLTNLLHINVSRHNWSLAYRIFATLIRIPEVQMKSIWGFGVKILDNLPDSS----SSL
Suva_13.117        IITLTNLLHLNVSRHNWPLAYKIFATLIRIPNVQIKSIWGIGVKILDNSPNLS----SSL
SAKL0E01980g       IRNLTNLLHVNVMEQNWEIAYRCFSILIRLPGVDIRSIWGIGVRILKEIDRK-----RSE
KLTH0C10582g       IAQLNELLHTNIMKGKWDTAYRCFSLLIRLPGIDIRSVWGPGARILRELASNDKGLGTSE
Kwal_56.22527      ITHLNELLHINVMEGQWETAFRCFSILIRLPGVDIRSMWGLGVRILRELSSTDKNVASSD
KAFR0L00420        IETLTNLLYLNVNRGNWEIAYKIFAMLIRIPKVDIRSVWNVGNRILYEKDKL-----RSL
NDAI0D00890        IEKLTTLLYLNVSRENWDIAYRIFTLLIRIKKLDIRSIWGIGVRILSEKSPT-----KTL
NCAS0H00900        IENLTNLLHINVMKGKWEVAYKIFALMVRIPKVDIRSIWGIGVKILSQRAAT-----TTL
ZYRO0C07172g       IGTLTSLLHINVLKRKWELAYKCFALLIRIPGVDVRTLWGLGERILAERQPT-----RSL
TDEL0G04240        ISILTTLLHLHVSRREWDAAYTCFALLIRVPKVDIRNIWGIGDLILREREPI-----KSL
                   :  *  ::.  :   .:  *:  *: ::*:   .:. .*. *  *:              

TBLA0B00570        NFLNWIHSIYSS--NQKYNNSINYK-TAPA-FTQSSRNHTGKFTTSFLWMTLSLIHTKF-
TPHA0J00510        DFLQWLSNVYSN-KNRSFVQGINYR-NDQTNFNGGSRRLTPLYTKTLLWHKLTLSSD---
Kpol_1037.11       EFLKLFNNIHSRYKKKIFNQTVNYR-EAPV-FNDGSRNKTPIYIKTLLWKEITTTST---
KNAG0E00910        DFLEWMHSVYSN--KHRFIQNVNHR-LPPA-FRSGSRTHTAQYTTTWLWLSLRAAT----
KLLA0C05852g       AYLEWLAHVFPS--RVQFNQGTNYS-LDPV-FRCGSRTHTPTFVLTWLWTRLFIAT----
ACL020W            KFLEWMGTVFTS--HSVFSQNKVNL-IDPV-FRSGSRAHTPNFMLAWLWLVLRGATA---
Ecym_3049          RFLEWMSTVLTS--NSAFPQNSKNQ-LDPV-FRSGSRTHIPNFVLSWLWLVLENAVK---
CAGL0J11792g       EFLKWMSTVYSS--KQNFVQSHCHR-KAPV-FRSGSRTHTPKYALTWLWNCLIKVTELI-
Smik_13.106        DFLQWMCQIYSS--KLRFVQSTNYRSIVPP-FQTGSRTHTSKFATTYLWSSLITCQ----
YML043C            DFLQWMCQIYSS--KSRFVQNINYRSIVPP-FQTGSRTHTAKFAITYLWSSLINCQK---
Skud_13.105        DFLQWMCQIYSS--KARFVQNINHRSIVPP-FQTGSRTHTAKFATTYLWASLINCQ----
Suva_13.117        DFLQWMCQVYSS--KSRFVQNVNYRSVVPP-FQTGSRTHTSKFAITYLWSCLISCQ----
SAKL0E01980g       EFLEWMSSVFST--KNNFNQGTNHA-MDPV-FRSGSKTHTPKFVTSWLWETLMGCTS---
KLTH0C10582g       EFLGWLSGIFSS--RSNFNQTMNFL-MDPV-FRCGSKTHAAKFVVAWLWELLFASCP---
Kwal_56.22527      EFLGWLSGIYTS--RSNFNHTMNFL-MDPV-FRTGSKKHTAKFVSAWLWEMLFAACP---
KAFR0L00420        EFLEWMSSVYST--RVTFIQGINYR-FDPV-FRSGSKNHTPKYTLQWLWNSLLEYTE---
NDAI0D00890        DFLNWMNSVYSS--RLNFIQGINYR-MDPV-FKSGSRTHTPKYTLTWLWKSLIQYSTKKI
NCAS0H00900        DFLVWMNSVYSS--RINYIQGMTHR-VDPV-FRSGSKTHSSKFTITWLWKSLIYCT----
ZYRO0C07172g       EFLQWMSSVYST--KLPFADDVNYR-MAPV-FTKGSKTHTPKYTTTWLWECLIRYA----
TDEL0G04240        EFLSWMSSVYSS--RSAFAEDVNHR-TPPV-FTKGSKTHVPKFATTWMWESLIQCTK---
                    :*  :  : .   .  :             *  .*.     :    :*  :        

TBLA0B00570        ---SDLTSRNIKEIVEE-----LNYLKKKLKKFVEKLSEMVLAPPFIEDSEIWYIYSLSH
TPHA0J00510        ---SETCESE-------------------IDSLIEQIAEMVVIPPYSEDNEIWYIFALCH
Kpol_1037.11       ---SSRTSSN-------------------YNELIEYLSELTLIPPFMEDSEIWYIYGIVH
KNAG0E00910        ---EQAQEGAPTTL-------------EPLELLTDKTSELLLTPPYMDDSEVWFIYCSCY
KLLA0C05852g       ---SGSSAVDKE---------------KFLQSLIDRLDEMVLSPPYMDDSEIWYIFGLTH
ACL020W            ---DEVLDST-----------------RSMAWLLEKVSELVLRPPYMDDAEIWFLYAMCY
Ecym_3049          ---ERVFSSG-----------------HDINWLLDKISELVLRPPYMDDAEVWFIYAMCY
CAGL0J11792g       ---SIEEEKGVNTNEEENDNGSKQSAMDKLTELIDKISEMVLVPPYLDDPEIWFIYSMCH
Smik_13.106        ---KSMELPDINDKRYD-------MENDLLQDLIDRISEWVLTPPFMEDAEVWFIYASCH
YML043C            ---SMEPSSNIIDKPFD-------TENDLLQELIDKISEWVLTPPFMEDAEVWFIYASCH
Skud_13.105        ---KSIEPSTINDKHYD-------MENDRLQELIDKISEWVLTPPFMEDAEVWFIYASCH
Suva_13.117        ---KSIESSNATDNQYD-------MENSRLEELIDQISEWVLIPPFMEDAEVYFIYASCH
SAKL0E01980g       ---KDENNGNRDV--------------NKLQFLTEKISELVLTPPYMDDPKIWFIYALCH
KLTH0C10582g       ---DGTEHPSAEDASN-----------RKLSHLLERLSEMVLIPPYMEDPEVWFIFAVCH
Kwal_56.22527      ---DKLEERQADNGSGN----------RKLIQLLEKLSEMVLIPPYMEDPEIWFIYALCH
KAFR0L00420        ---QLFENDD-----------------ENIDKLIDKIAEMVLIPPFMDDPEIWFIYSMCH
NDAI0D00890        ISGNNNSNESLEDGSSSELDIDINIDRNNLLDLIEKISEMVLIPPFMEDSEVWFIYSLCH
NCAS0H00900        ---DTDNDEDIDSDYGG-------FGRDKLQILIEKVSELVLIPPFMEDAEVWFIYALCH
ZYRO0C07172g       ---NGLEDLEMDSKSAA----------ENFQSLMDRISEMVLGPPYMDDPEVWFIYALCH
TDEL0G04240        ---NSLETGELEQIESN----------DGLQDLIERISEMVLAPPYMDASEVWFIYGLCH
                      .                            : :   *  : **: :  ::::::   :

TBLA0B00570        LILARMLMFET----RNNDISQT----SVEKDITKNEIISNIQHCKSHLQKV--RENQND
TPHA0J00510        LVKADNLSEKLYFMSRRNPEVDEMDTYPYDTEIYNNKITICINNCKKYLRKA--TQDK-N
Kpol_1037.11       LQRANELSMNL-----EHYIDNS----SSSKDIANNEVVQNIKLAQKFLKKA--KELS-K
KNAG0E00910        FVKADILSRNI----HSDLTHNVHAFSSSTMDLRRNEVVQSITRCQKTLHTA--EEKSDQ
KLLA0C05852g       LVMASELSSKF----RQSKDILL----GSRADIARNQVIQHINNAKNCLQMC--KANS-N
ACL020W            FIQADKLSAQL----ASHEGIKL---HGSKLDIAKTQVTQYICSVKNCLESC--REKG-N
Ecym_3049          FIKADKLSLQL----KQEGSLNG--LKGSQLDIARNQVIENIHHVKNHLRIC--EEKG-G
CAGL0J11792g       MVHADYLSGKF------NCQRLS----GSRRDIARNQVTQHIHYVKTYLQNC--SQKG-N
Smik_13.106        LLKADILSRQF----ANDNKTSD--LIGLDRDIKINQVIKHIHYVKVFLQTC--SDKG-G
YML043C            LLKADTLSRQF----VNDNKNND--LIGLDRDIKINQVIKHIHYVRTFLKIC--LDKG-G
Skud_13.105        LLKADILSRQF----VNDGTKGD--LIGLDRDIKINQVIKHIHYVKVFLQTC--LDKG-G
Suva_13.117        LLKADLLSRQF----VNDNRNND--LVGLNKDIKINQVIKNIHYVKVFLQTC--LDKG-G
SAKL0E01980g       IVEADHLSQQF----IENEHIKN----GSRRDIARNQVIQHITNAKNFLQTC--QEKG-G
KLTH0C10582g       LVSADQLSQRF----ISTKLRTS----ELERDISRNQVTQHITNAHMCIRTC--EAKKEE
Kwal_56.22527      LVSADELSQRF----TFTYSEST----ELERDISRNQVTQHITNAHNCIRTC--EAKGDD
KAFR0L00420        MVKADFLSSKF------DTHSV-----GSMRDISMNQVIQHINDVKRYLNVCKEKSQG-Q
NDAI0D00890        MVLADDLSSKF------NPLISN----GSRGDIERNQVIQHIQKTKSYLQTS--MNKG-D
NCAS0H00900        MVKADQLSLNF------NLNQSN----GSARDIARNEVIQNIQLVKTFLQTA--MSKG-H
ZYRO0C07172g       MVKADTLSQQF------DPRLT-----GSARDIASNQVIQHIQNTKSHLQQC--SSKG-G
TDEL0G04240        LIKADILSNQF------DGRLA-----GSARDIASNQVIQHIQRTKSCLQTC--LSKG-D
                   :  *  *                        ::  .::   *   .  :           

TBLA0B00570        --------YNFKFQKIEIELKDMEKKLYDTSS--DEEILNEEEFLDNEDVLDNEENNFNH
TPHA0J00510        --------FDYPARTIETKLKTIETRTFD------------------------------F
Kpol_1037.11       --------IEVPERQITLMIKNIEGRMIH-------------------------------
KNAG0E00910        ARHRAHAYWELPTGYIKRQLQQIEKRLTAQSTPRDQPSSPAHYENYGLGDTELAEDQADI
KLLA0C05852g       --------YEFPENVIEHQLVQLERSLYTDELSVNCTDESAKSSDEDGIEHSYPNEDSNL
ACL020W            --------FTYPERIIQEQLLEFERRLYA-----GTHKEQTDGNSFDTYESDTGEQNDNP
Ecym_3049          --------FQYPKRVIEAQLVEFEKRLYP---ESSTHINYPGYETFPLEESDTEDNLVSI
CAGL0J11792g       --------FEYPKQFIQSRLEEFEKRMYEDESKPENMKLQESYDNTSYSNEDDEENPFQI
Smik_13.106        --------FTVPNRLIESQLKGFESRLYG-----EAQDLREREMDDDYNSIDDNSVNNSF
YML043C            --------FAVPSRLIENQLKSFESRLYG-----EAQDIQERDVANVYDSIDNSSVENSF
Skud_13.105        --------FTIPNRLIEIQLKNFELRLYG-----ETQDVQEREIVDGYDETDISSVENSF
Suva_13.117        --------FTIPNRLIENQLKSFESRLYG-----EAQDIHERRMVDDYDNTDNSSADNSF
SAKL0E01980g       --------FQFPKQHIEKQLSNFENRLYQ----------RTEDLLNNFDSDSSASNEFNR
KLTH0C10582g       --------FSFPRRIIEEQLACFEKRLYQ-----NSGESTASDLGSGFELDNSPENLDTQ
Kwal_56.22527      --------FFFPRRIIEEQLAFFERRLYE-----HVGDSTTSEQDSPHEMTFEPHNFDTQ
KAFR0L00420        --------YESNEMIITKQLKAFEVRLYK---------EPVFPLEPENDLDGDNEEEVDE
NDAI0D00890        --------FEYPEKYILKQLSIYEQRLYASDPTSNNNNVTDEDVDMQLQDIPNPYSNNTN
NCAS0H00900        --------FEYPERFITRQLNTFEERLYS------KDETNSKDKDNNESDNGSSMDNGNI
ZYRO0C07172g       --------FTFPKRYIARQLAAFEARLYG--------KIDAYDMDEEEDEDNDAHSPSDE
TDEL0G04240        --------FKYPKRYIERQLEEFEKRL-------DRQEDTPDDSDHEVESLHDKLDTQSI
                                  *   :   *                                    

TBLA0B00570        EINFEHKNNQLMTPSYDEPIYKYNLDDEFSGQTHLDS-ENEMTQSHFESN-----KYNSS
TPHA0J00510        ESMPE-------------------------------------------------------
Kpol_1037.11       ------------------------------------------------------------
KNAG0E00910        DAFPI---------------EEDNSFLQALDTQPL--------------------SDNFL
KLLA0C05852g       PDVGP----------LDTQQYEIENLIPEVESAEFTVPAPI--------------RFGYE
ACL020W            TMVSE-------TDFHDPNFRNFKPDVAEDDDTAFGE-LPTRFEVD---------SDYDS
Ecym_3049          NFLQD--------RFDAQVIQDFNVQQPIDEDGPFVE-QPVHFGMG---------SDYSE
CAGL0J11792g       DESNS-FLGNLVEEGIDPVIKTHWEPTMNMDALKFNY-N----------------STDDS
Smik_13.106        RDVYE-----TNAEFLDTQLMDLSPENNQLGEIPY--------------------SDEDS
YML043C            GDVYE-----TNAEFLDTQLMDLSPEDNGLDEMHY--------------------SDEDS
Skud_13.105        GDVYE-----TNAEFLDTQLMDLSPEDNEMAENHH--------------------SDEES
Suva_13.117        GDVYE-----TNAEFLDTQLMDLSPVENEMAENHY--------------------SDEDS
SAKL0E01980g       QDFQD----------VNPIVYEEENVFGELGDAQFD-------------------IDTYS
KLTH0C10582g       NVLGP---------GMSPMIDEEENFFGSAEQVHFG-------------------FDSDS
Kwal_56.22527      DLPSP----------GMSSFVEEENYFGTAERVHFG-------------------FDSDS
KAFR0L00420        SNVFE----------DSANYFEFDDTQEQLNDLDTQQ-YFHD-------------TDDSS
NDAI0D00890        NATTN-----INNSIAEDYIFSDFSFDKDLEDLDTQDPKIYGREEDEEHYENNL-VQSDS
NCAS0H00900        QLVPE---TNPIPPAEDEYVFSDFSFTNAAHDLDTQALEPMIHEEDLMEEDPFSQIQSDS
ZYRO0C07172g       SGMYP--------ENLDTQLID---------------------------------SEASL
TDEL0G04240        E------------------------------------------------------SDDDS
                                                                               

TBLA0B00570        SD
TPHA0J00510        --
Kpol_1037.11       --
KNAG0E00910        --
KLLA0C05852g       SD
ACL020W            SE
Ecym_3049          SE
CAGL0J11792g       SE
Smik_13.106        SE
YML043C            SE
Skud_13.105        SE
Suva_13.117        SE
SAKL0E01980g       SE
KLTH0C10582g       ST
Kwal_56.22527      SS
KAFR0L00420        SS
NDAI0D00890        SE
NCAS0H00900        SE
ZYRO0C07172g       SD
TDEL0G04240        S-
                     

FASTA FORMAT for MUSCLE Version 3.6

>TBLA0B00570
---------------------------------------------MFEAPLNI---HSKV
LANERKIRYQYINTF--TKRYSQLYGDTIPSSSLESNRSRTPITLPTPEASAHEHSD---
-----------------------------------SNTNYNDDSDSISNTNTLSDDEYN-
--------SDSTGTTNEETKFFNRYDRPQESFEVWNTSIDTLNSKTKLKSNGRIPINRNK
ISFNRLNRVKKFTNKKLEARLQHCTKRLKTHIKAISEGYETSYRD-----KQTTSFNNIH
IENLINLLYYNICEKNFNQAYHIFSLIIRLPNIDIRNFWNLGSIILLKKVSIQ----ESL
NFLNWIHSIYSS--NQKYNNSINYK-TAPA-FTQSSRNHTGKFTTSFLWMTLSLIHTKF-
---SDLTSRNIKEIVEE-----LNYLKKKLKKFVEKLSEMVLAPPFIEDSEIWYIYSLSH
LILARMLMFET----RNNDISQT----SVEKDITKNEIISNIQHCKSHLQKV--RENQND
--------YNFKFQKIEIELKDMEKKLYDTSS--DEEILNEEEFLDNEDVLDNEENNFNH
EINFEHKNNQLMTPSYDEPIYKYNLDDEFSGQTHLDS-ENEMTQSHFESN-----KYNSS
SD
>TPHA0J00510
---------------------------------------------MFELPVSSN--ITIN
AFNLKKLRYQYINDI--NAKHNE----L------------SKNELPTPVTSENDTGGEDL
DGDSEHNLTSEDAE-------VAQERRIRRWKSIMGEAIDDDEDDNNHDDDVDNEFEDN-
------------GPTDEEKKYFLRYDKPQESFEKWES----------NNLKRQRHVNKNF
ITYYRFKKTRKQIDKKYKVKTMHLNKNVKNNFELMIDGFEPINDNNISRNRNLQNYNKHH
LSLLTDLMYSNIFKQKWDIAYKCFTFLLRIPDVDIRRVWNLGSIILQNIDTT-----KLI
DFLQWLSNVYSN-KNRSFVQGINYR-NDQTNFNGGSRRLTPLYTKTLLWHKLTLSSD---
---SETCESE-------------------IDSLIEQIAEMVVIPPYSEDNEIWYIFALCH
LVKADNLSEKLYFMSRRNPEVDEMDTYPYDTEIYNNKITICINNCKKYLRKA--TQDK-N
--------FDYPARTIETKLKTIETRTFD------------------------------F
ESMPE-------------------------------------------------------
--
>Kpol_1037.11
---------------------------------------------MFEVPTIDS--TKRS
VVNFKKLRYQYMNHMYERNRYNK-----------------NGQGLPTPVSSENEMNA---
--SEDE---------------VSHKRVRKRWRRIVGESVSSDEEEEEEEEDEQEQEG---
---------------DEEKKYFSRYDKPEDSFERWAS-----------NTKHRKSINRKM
MSYKKYNKLTKYSRKKIQVPLIRSNRKLQENFLSVIDGYELIDDNI----NLKENFTMVN
VKLLTDLMYESIFKENWKIAYRCFTLLIRLPKTSIRKIWNLGSMIIENLEGIN----KTI
EFLKLFNNIHSRYKKKIFNQTVNYR-EAPV-FNDGSRNKTPIYIKTLLWKEITTTST---
---SSRTSSN-------------------YNELIEYLSELTLIPPFMEDSEIWYIYGIVH
LQRANELSMNL-----EHYIDNS----SSSKDIANNEVVQNIKLAQKFLKKA--KELS-K
--------IEVPERQITLMIKNIEGRMIH-------------------------------
------------------------------------------------------------
--
>KNAG0E00910
---------------------------------------------MFELPVLLGSFSESQ
SLVRKKLRYRYRNEI--KNQYKR----IKIH---------DENGQLTPESSHTELDD---
--HESRSRVC-----------RGRKRRLYDLRDREEHGFESDSSEAQDEVGDLPEKEEE-
------------EIGHEERKYFKNHEKPEDLYEVWHV----------ATERRKVPIQRQF
VSYNRLQTIERRAKRKMEVPLLHVSRVRSSEFSAEIDGYDVVSRGD-----ETTHFENKH
IQLLVTLLHRHISTENWNLAYKVFALLIRMPRVDIRAVWNLGVAILARRDST-----TAI
DFLEWMHSVYSN--KHRFIQNVNHR-LPPA-FRSGSRTHTAQYTTTWLWLSLRAAT----
---EQAQEGAPTTL-------------EPLELLTDKTSELLLTPPYMDDSEVWFIYCSCY
FVKADILSRNI----HSDLTHNVHAFSSSTMDLRRNEVVQSITRCQKTLHTA--EEKSDQ
ARHRAHAYWELPTGYIKRQLQQIEKRLTAQSTPRDQPSSPAHYENYGLGDTELAEDQADI
DAFPI---------------EEDNSFLQALDTQPL--------------------SDNFL
--
>KLLA0C05852g
---------------------------------------------MFQLPVID---RSSR
NRKRRKIRYQYINSL--KRKYDQ-LNYNQSEASVSSEADNVTNGILTPENSESSEAE---
--AADL---------------EKKHRRKRRLQSVLGNALDSSDEELDGDEDGTDEN----
---------------DPETQFYESHIKPQHTFEVWNV-----------NTALRTPIQRKK
ITYNAVKKLEKAATKSVTKKLNYQTKKLNMYFQALKFGFDVYPKP------QLSKQKTMH
LAHLNQLLYTNVLNQNWEIAYRCFSILIRLEDVDVRSLWSIGSEILNSLGDTQ----SNE
AYLEWLAHVFPS--RVQFNQGTNYS-LDPV-FRCGSRTHTPTFVLTWLWTRLFIAT----
---SGSSAVDKE---------------KFLQSLIDRLDEMVLSPPYMDDSEIWYIFGLTH
LVMASELSSKF----RQSKDILL----GSRADIARNQVIQHINNAKNCLQMC--KANS-N
--------YEFPENVIEHQLVQLERSLYTDELSVNCTDESAKSSDEDGIEHSYPNEDSNL
PDVGP----------LDTQQYEIENLIPEVESAEFTVPAPI--------------RFGYE
SD
>ACL020W
MVSSFVVSFFKSKFVASRCLISDNPKKPSLESSRLVLQPLWDALTMFESPIVS---YSKR
SKQQRALKYKYVSCV--RRKYEQ----LNGLSDSDKQAHIDSACFPTPDNSAAEAS----
--DGDALEGDVDTAA------RRLKRKRLRLQSILGHATLDAEEGDLGSEEEDDLNGGS-
------------TAKDYEKQFFARYYKPEYTYELWAT-----------SPKNRVPIRRKM
LSYQAFKQIENYSNQRMKATLSLSTKKAAAYHEVMRLGYETCPKE------EVTNYQKLH
LNHLVGLLYSNIISENWGTAYRCFALLIRMKSVDLRSIWNLGSHILSHLNFD-----MHE
KFLEWMGTVFTS--HSVFSQNKVNL-IDPV-FRSGSRAHTPNFMLAWLWLVLRGATA---
---DEVLDST-----------------RSMAWLLEKVSELVLRPPYMDDAEIWFLYAMCY
FIQADKLSAQL----ASHEGIKL---HGSKLDIAKTQVTQYICSVKNCLESC--REKG-N
--------FTYPERIIQEQLLEFERRLYA-----GTHKEQTDGNSFDTYESDTGEQNDNP
TMVSE-------TDFHDPNFRNFKPDVAEDDDTAFGE-LPTRFEVD---------SDYDS
SE
>Ecym_3049
---------------------------------------------MFESPIIS---YNSK
DRKRRKLKYKYINSL--KRKYEH----LVGTQGGSKGSTKDTSGLPTPGNSAAEAS----
--DGDGREEDELSR-------LRRRKRRIRLQSILGHAADEDEDEAEAEGAVGSEDDDG-
------YEDGYLDEKDPEKIFYSKYYVPEETYEVWTT-----------SINNRIPIQRRS
MSYHVFRTIEKYAHKKVAASLALSSKKLTGFFEVIRSGYETCPRE------RITNYQKVH
LHHLVDLLYINILRGDFDTAYRCFSLLIRMNFVDLRSMWNLGSKILEHYNLD-----DQE
RFLEWMSTVLTS--NSAFPQNSKNQ-LDPV-FRSGSRTHIPNFVLSWLWLVLENAVK---
---ERVFSSG-----------------HDINWLLDKISELVLRPPYMDDAEVWFIYAMCY
FIKADKLSLQL----KQEGSLNG--LKGSQLDIARNQVIENIHHVKNHLRIC--EEKG-G
--------FQYPKRVIEAQLVEFEKRLYP---ESSTHINYPGYETFPLEESDTEDNLVSI
NFLQD--------RFDAQVIQDFNVQQPIDEDGPFVE-QPVHFGMG---------SDYSE
SE
>CAGL0J11792g
---------------------------------------------MFEVPITY---NCRR
LNVERRVRYQYINIL--SRKYHA----KRRSKRRR-----QANSLPTPENSAVENDQ---
--SESQLP-------------SREQIKEKKMKL--GEDYSDSEAETSSEGEDTTKDDNE-
---------FANDMNKFEKLFYRKYEKPEHSFEVWYDG-------NSVNTKKKHELKKTH
IHYTRLNRVERIAKKRVEKNVVHMPLVNKRYFDIKSEGYEVLEPLV-----DIDSYLLKH
IEILTQILFSSVSQGNWDIAYRTFSLLIRIPEVDIRNIWGLGTRILMERGQTT----RSL
EFLKWMSTVYSS--KQNFVQSHCHR-KAPV-FRSGSRTHTPKYALTWLWNCLIKVTELI-
---SIEEEKGVNTNEEENDNGSKQSAMDKLTELIDKISEMVLVPPYLDDPEIWFIYSMCH
MVHADYLSGKF------NCQRLS----GSRRDIARNQVTQHIHYVKTYLQNC--SQKG-N
--------FEYPKQFIQSRLEEFEKRMYEDESKPENMKLQESYDNTSYSNEDDEENPFQI
DESNS-FLGNLVEEGIDPVIKTHWEPTMNMDALKFNY-N----------------STDDS
SE
>Smik_13.106
---------------------------------------------MFEVPITL---TNKK
FAQRRKLKYQYINHT--SRRFEK----IVKKST-------TALSLPTPENSAAENNE---
--EDDGERNGEGGAYRRLILQQRKRRRERHWKSVVGEIYSSTETESDSQEDAEEDEECN-
-------TEGKEEDIDEERKFWKKYEKPEESFEVWRT----------VSSQNKSPINKQK
MTYHTFKKIEKNSLRKMEVPLLHCTKESKLHFQSLSKGLEPLQPST----SEVRNYRTKH
IITLTNLLHLNVSRHNWSLAYKIFATLIRIPGVQIKSIWGIGVEILNNSPNLS----TSL
DFLQWMCQIYSS--KLRFVQSTNYRSIVPP-FQTGSRTHTSKFATTYLWSSLITCQ----
---KSMELPDINDKRYD-------MENDLLQDLIDRISEWVLTPPFMEDAEVWFIYASCH
LLKADILSRQF----ANDNKTSD--LIGLDRDIKINQVIKHIHYVKVFLQTC--SDKG-G
--------FTVPNRLIESQLKGFESRLYG-----EAQDLREREMDDDYNSIDDNSVNNSF
RDVYE-----TNAEFLDTQLMDLSPENNQLGEIPY--------------------SDEDS
SE
>YML043C
---------------------------------------------MFEVPITL---TNRK
FAQRRKLKYQYINYI--SRRFDR----ISKKST-------TTDSLPTPENSAAENN----
--DEEEGQNSEAGTYRRSVLQQKKRRRERHWRSVVGEIYSTTESETDSQEEETEEGGEH-
------DTGIDKEDSDEERKFWKKYEKPEKSFEIWRT----------VSSQNKQPINKQK
MTYHNFKKIEKIPLRKMEIPLLHCTKENKLYFQSISRGLEPLKTST----SEVRNYRTRH
IVTLTDLLHLNVSRHNWSLAYKIFATLIRIPGVQIKSLWGIGVEILDNLSNSS----SGL
DFLQWMCQIYSS--KSRFVQNINYRSIVPP-FQTGSRTHTAKFAITYLWSSLINCQK---
---SMEPSSNIIDKPFD-------TENDLLQELIDKISEWVLTPPFMEDAEVWFIYASCH
LLKADTLSRQF----VNDNKNND--LIGLDRDIKINQVIKHIHYVRTFLKIC--LDKG-G
--------FAVPSRLIENQLKSFESRLYG-----EAQDIQERDVANVYDSIDNSSVENSF
GDVYE-----TNAEFLDTQLMDLSPEDNGLDEMHY--------------------SDEDS
SE
>Skud_13.105
---------------------------------------------MFEVPITL---TNKK
FAQRRKLKYQYINHL--SRRFDK----VAKTTN-------TTDSLPTPENSAVENNDDDY
DYDEDEEQIDEADVYRRSILQQTKRRRERHWKSVVGELYSSTETESDSQQEEIQENDGR-
------ETGRKNGDTDEERKFWKKHEKPERSFEIWQT----------ASLQNKGPINRRK
MTYHKFQKIQKNSLRKVQIPLLHCTKENRLYFRSLSKGLEPLQTPT----STIRNYQTRH
IITLTNLLHINVSRHNWSLAYRIFATLIRIPEVQMKSIWGFGVKILDNLPDSS----SSL
DFLQWMCQIYSS--KARFVQNINHRSIVPP-FQTGSRTHTAKFATTYLWASLINCQ----
---KSIEPSTINDKHYD-------MENDRLQELIDKISEWVLTPPFMEDAEVWFIYASCH
LLKADILSRQF----VNDGTKGD--LIGLDRDIKINQVIKHIHYVKVFLQTC--LDKG-G
--------FTIPNRLIEIQLKNFELRLYG-----ETQDVQEREIVDGYDETDISSVENSF
GDVYE-----TNAEFLDTQLMDLSPEDNEMAENHH--------------------SDEES
SE
>Suva_13.117
---------------------------------------------MFEVPITL---TNKK
FAQRRKLKYQYINHI--SRRFDR----ITKKSN-------TTDSLPTPENSAAENNDEDY
D-DDEEERNYESDAGESSIRQQTKRRRERHWKSVIGELYSSTETESDSQEEDDQEGDQV-
----EHETRLKEEDTDEERKFWKKYEKPEKSFEVWQT----------VSSHNKSPINKQK
ITYHNYKKIEKNSLRKMEIPLLHCTKENKLYFQLLAKGLEPLQSPT----SAARNYQTRH
IITLTNLLHLNVSRHNWPLAYKIFATLIRIPNVQIKSIWGIGVKILDNSPNLS----SSL
DFLQWMCQVYSS--KSRFVQNVNYRSVVPP-FQTGSRTHTSKFAITYLWSCLISCQ----
---KSIESSNATDNQYD-------MENSRLEELIDQISEWVLIPPFMEDAEVYFIYASCH
LLKADLLSRQF----VNDNRNND--LVGLNKDIKINQVIKNIHYVKVFLQTC--LDKG-G
--------FTIPNRLIENQLKSFESRLYG-----EAQDIHERRMVDDYDNTDNSSADNSF
GDVYE-----TNAEFLDTQLMDLSPVENEMAENHY--------------------SDEDS
SE
>SAKL0E01980g
---------------------------------------------MFELPVVR---TNKK
IRSKRKLRYQYINTL--NKKHEQ----LNPKK--------QTVGLPTPESSAAETS----
--DTDELEDSQS---------KRTKRRKRRLQSILGHAVSSSDEDDISEEENDNDYEEC-
---------------DYEKHVKNKYYKPQETYELWTT-----------GPENRVPLNTTS
MTYKQYKKIHKAAHRRVTRTLSYSSKNSAAFFSAIYNGYEPYETS------QLENYQTTH
IRNLTNLLHVNVMEQNWEIAYRCFSILIRLPGVDIRSIWGIGVRILKEIDRK-----RSE
EFLEWMSSVFST--KNNFNQGTNHA-MDPV-FRSGSKTHTPKFVTSWLWETLMGCTS---
---KDENNGNRDV--------------NKLQFLTEKISELVLTPPYMDDPKIWFIYALCH
IVEADHLSQQF----IENEHIKN----GSRRDIARNQVIQHITNAKNFLQTC--QEKG-G
--------FQFPKQHIEKQLSNFENRLYQ----------RTEDLLNNFDSDSSASNEFNR
QDFQD----------VNPIVYEEENVFGELGDAQFD-------------------IDTYS
SE
>KLTH0C10582g
---------------------------------------------MFELPLVR---NTKR
VRTVRKLRYQYINTL--YQEYRK----VQSFAN-------ANSTLPTPENSAAEEAS---
--DGDHNSADAT---------SRRRRRKRRLLSVLGHAETDTELSDMEAEEGSHEADQA-
---------------DSEKEFFTRHEKPQETFEVWNT-----------DRQKAVPMNTAT
LSYDTCKQIEKHAQKRVSAGMAHISKNANFHFQAMKDGYETVAET-------PESHHLVH
IAQLNELLHTNIMKGKWDTAYRCFSLLIRLPGIDIRSVWGPGARILRELASNDKGLGTSE
EFLGWLSGIFSS--RSNFNQTMNFL-MDPV-FRCGSKTHAAKFVVAWLWELLFASCP---
---DGTEHPSAEDASN-----------RKLSHLLERLSEMVLIPPYMEDPEVWFIFAVCH
LVSADQLSQRF----ISTKLRTS----ELERDISRNQVTQHITNAHMCIRTC--EAKKEE
--------FSFPRRIIEEQLACFEKRLYQ-----NSGESTASDLGSGFELDNSPENLDTQ
NVLGP---------GMSPMIDEEENFFGSAEQVHFG-------------------FDSDS
ST
>Kwal_56.22527
---------------------------------------------MFELPLAR---NSNR
VRTVRKLRYQYINSL--SQEHRR----IQDSAA-------AHATLPTPENSAAEDAS---
--DGDQDSEDAG---------SRRRRRKRRILSVLGHIDSESELSDVDMSTESHHSELQ-
---------------ESEKEFFSHHEKPQDTYETWNT-----------DRRKAVSMTTAT
LSYAENKLIEARAQRRVIERIGHFSRIARSHFNSIKRGYEIYSRP-------SQVHQTTH
ITHLNELLHINVMEGQWETAFRCFSILIRLPGVDIRSMWGLGVRILRELSSTDKNVASSD
EFLGWLSGIYTS--RSNFNHTMNFL-MDPV-FRTGSKKHTAKFVSAWLWEMLFAACP---
---DKLEERQADNGSGN----------RKLIQLLEKLSEMVLIPPYMEDPEIWFIYALCH
LVSADELSQRF----TFTYSEST----ELERDISRNQVTQHITNAHNCIRTC--EAKGDD
--------FFFPRRIIEEQLAFFERRLYE-----HVGDSTTSEQDSPHEMTFEPHNFDTQ
DLPSP----------GMSSFVEEENYFGTAERVHFG-------------------FDSDS
SS
>KAFR0L00420
---------------------------------------------MFEIPVNV---NSKT
LSNERKLRYRYINQF--TRRFER--------KD-------DRNGMITPETSEDE------
----------------------LQQRKKRDWLHVIGEYGSDDDERSGGQQDDEEEEEEV-
-------IDEDYNLNNEERKFFKKIDKPQETYEHWPS------------HRKKTRIQRDI
LTYHRYNKVSRYVERKMANSLVHVSSKNRYHFKCKIDGMEIVEPLH----KGATNFQLKQ
IETLTNLLYLNVNRGNWEIAYKIFAMLIRIPKVDIRSVWNVGNRILYEKDKL-----RSL
EFLEWMSSVYST--RVTFIQGINYR-FDPV-FRSGSKNHTPKYTLQWLWNSLLEYTE---
---QLFENDD-----------------ENIDKLIDKIAEMVLIPPFMDDPEIWFIYSMCH
MVKADFLSSKF------DTHSV-----GSMRDISMNQVIQHINDVKRYLNVCKEKSQG-Q
--------YESNEMIITKQLKAFEVRLYK---------EPVFPLEPENDLDGDNEEEVDE
SNVFE----------DSANYFEFDDTQEQLNDLDTQQ-YFHD-------------TDDSS
SS
>NDAI0D00890
---------------------------------------------MFELPIIY---NNKR
TATERKIRYTYINQL--SKKYNRTQNRHNNNNN-------NNGILPTPESSATESHD---
--DDDATTSDDL---------IKRKRLRRRWKSVIGEAYSDTDLDDDDDDEEEEEDVDVE
DEMSDHHESAHHIHENEERKFFKKYEKPQETFEIWQT-----------NNLKRVPINKSM
ITYTKLKKIEKQAKRKITVPLLHASKINKLCFEAMSEGLELVTPLV-----TIENFSLQH
IEKLTTLLYLNVSRENWDIAYRIFTLLIRIKKLDIRSIWGIGVRILSEKSPT-----KTL
DFLNWMNSVYSS--RLNFIQGINYR-MDPV-FKSGSRTHTPKYTLTWLWKSLIQYSTKKI
ISGNNNSNESLEDGSSSELDIDINIDRNNLLDLIEKISEMVLIPPFMEDSEVWFIYSLCH
MVLADDLSSKF------NPLISN----GSRGDIERNQVIQHIQKTKSYLQTS--MNKG-D
--------FEYPEKYILKQLSIYEQRLYASDPTSNNNNVTDEDVDMQLQDIPNPYSNNTN
NATTN-----INNSIAEDYIFSDFSFDKDLEDLDTQDPKIYGREEDEEHYENNL-VQSDS
SE
>NCAS0H00900
---------------------------------------------MFDLPTQI---SNKR
IANERKIRYTYINQL--SRKYNR----QDA----------ESSSLPTPENSASESHE---
--STGEDEE------------VRRRRLKRRWKNVIGEAVSDTDEDEDGEEEREDEGPE--
---------------NQERRFFKTHEKPQESYEIWST-----------DNNKRMPLQKKF
ISFSKLNKIEKSTKRRMQGSLLHSSKFNNICFESISQGQELVTPLH-----TPESFTLKH
IENLTNLLHINVMKGKWEVAYKIFALMVRIPKVDIRSIWGIGVKILSQRAAT-----TTL
DFLVWMNSVYSS--RINYIQGMTHR-VDPV-FRSGSKTHSSKFTITWLWKSLIYCT----
---DTDNDEDIDSDYGG-------FGRDKLQILIEKVSELVLIPPFMEDAEVWFIYALCH
MVKADQLSLNF------NLNQSN----GSARDIARNEVIQNIQLVKTFLQTA--MSKG-H
--------FEYPERFITRQLNTFEERLYS------KDETNSKDKDNNESDNGSSMDNGNI
QLVPE---TNPIPPAEDEYVFSDFSFTNAAHDLDTQALEPMIHEEDLMEEDPFSQIQSDS
SE
>ZYRO0C07172g
---------------------------------------------MFELPLVI---TSKR
TRTSRKLKYQYINNL--SKKYDG----INGISN-------GQTELPTPENSATETSE---
--NEEVGQ-------------QKRRRIRKRLKSIIGESYSDLESDEEQPVEEVD------
---------------NEERKFYRKYEKPQLTFEKWQC-----------DPRKRTPIQRNR
INYNRMNRIQRHGLRRMETSLAVASRTNKTFFHATTQGYQLFDPTY----GRANTFQLKH
IGTLTSLLHINVLKRKWELAYKCFALLIRIPGVDVRTLWGLGERILAERQPT-----RSL
EFLQWMSSVYST--KLPFADDVNYR-MAPV-FTKGSKTHTPKYTTTWLWECLIRYA----
---NGLEDLEMDSKSAA----------ENFQSLMDRISEMVLGPPYMDDPEVWFIYALCH
MVKADTLSQQF------DPRLT-----GSARDIASNQVIQHIQNTKSHLQQC--SSKG-G
--------FTFPKRYIARQLAAFEARLYG--------KIDAYDMDEEEDEDNDAHSPSDE
SGMYP--------ENLDTQLID---------------------------------SEASL
SD
>TDEL0G04240
---------------------------------------------MFEQPVAL---TTRR
LRNAKKLRYQYVNNL--SAKFNR----LERIT--------NTNGLPTPENSAAESSE---
--NEEALQ-------------RKKKRIRRRLKSAAGESYSDSESDEVDNNHDNEVVEDE-
-------------EEDQERKFLNNYELPQESFEKWQD-----------DPSKRVPIQRSK
ISFTKYQRLRRHAKRKMNTSIDLASKRNKIYMDTISEGFEMVDPVD----GKPDTFQMKH
ISILTTLLHLHVSRREWDAAYTCFALLIRVPKVDIRNIWGIGDLILREREPI-----KSL
EFLSWMSSVYSS--RSAFAEDVNHR-TPPV-FTKGSKTHVPKFATTWMWESLIQCTK---
---NSLETGELEQIESN----------DGLQDLIERISEMVLAPPYMDASEVWFIYGLCH
LIKADILSNQF------DGRLA-----GSARDIASNQVIQHIQRTKSCLQTC--LSKG-D
--------FKYPKRYIERQLEEFEKRL-------DRQEDTPDDSDHEVESLHDKLDTQSI
E------------------------------------------------------SDDDS
S-