MUSCLE (3.8) multiple sequence alignment

Ecym_2711          ------------------------------------------------------------
AAL184W            ------------------------------------------------------------
KLTH0C04070g       ------------------------------------------------------------
Kwal_27.10328      -------------------------------------------------------MSKLH
TDEL0B00670        ------------------------------------------------------------
TBLA0B03190        ------------------------------------------------------------
KNAG0G03360        ------------------------------------------------------------
SAKL0D01738g       MYEHLVYDSLTTSFFFYSGRHCHVRTYYGNSDTMEKENKKIFEIEMSIETNPVISALTHR
ZYRO0G13970g       ------------------------------------------------------------
KLLA0D01661g       ------------------------------------------------------------
Kpol_1069.3        ------------------------------------------------------------
TPHA0I00190        ------------------------------------------------------------
CAGL0J06666g       ------------------------------------------------------------
NDAI0E00360        ------------------------------------------------------------
Smik_13.26         ------------------------------------------------------------
Suva_13.36         ------------------------------------------------------------
YML108W            ------------------------------------------------------------
Skud_13.33         ------------------------------------------------------------
NCAS0B01100        ------------------------------------------------------------
KAFR0A02760        ------------------------------------------------------------
                                                                               

Ecym_2711          ------MRAMSADNFYRMMILLEEAIPE--------SKDENIKA------------NATH
AAL184W            ---------MATDNFYRMMILLEEPHKQ-------HSTDGRKIE------------NASH
KLTH0C04070g       ---------MSDERNYRMLVLVEDVLEQAGEKNEQETKGEGAP-------------KATH
Kwal_27.10328      TRKRETKSKMSDERAYRMLVLVEDPVKSEGTVDGEKEENTDAP-------------KATH
TDEL0B00670        --------MGGNDNFYHMIIFLEESIENGQEGNSVDNGEDKQDV------------KSSH
TBLA0B03190        --------MSSNSVAYRMMVLLEEDMEPIEDDINLKSESSSNDNTEKVTTTKNTEPKKSH
KNAG0G03360        -------MVQQGDDTYRMLILVEEPLEDDVPTTEVTSEDGSQPI------------KSTH
SAKL0D01738g       IKGHVHSSVMSGDNGYRMLMLLEEAIPD------SSQENNENTT------------KTSH
ZYRO0G13970g       --------MSGPENSYRMLVLLEEPVSG------SKPEDE----------------KKVH
KLLA0D01661g       --------MSATENVYRMLILLEEPISE-------SAGDTKKKQ------------NATH
Kpol_1069.3        -------MAGGAESNYRMLILLEEGMENLDEEQTQQDRTEEPKES-----------KKMH
TPHA0I00190        --------MAGESAPYRMLVLLEEPLEENIETLTRDGDVKEVNEHNVEKGETQ---SKSH
CAGL0J06666g       -----------MSNLYRMMVLLEEPMEE-------DITISDSKEEK----------KVMH
NDAI0E00360        --------MSSTNNMYRLMILLEEEIGEPDLKDGSIDEATETETKDVHNSDEEKNVKKMH
Smik_13.26         ---------MSRNNTYRMLVLLEDDAKV-------NKEDEKFLKGKP---------GKMH
Suva_13.36         ---------MAKNNTYRMLVLLEDDTKI-------NKEDEKFLKGKP---------GKMH
YML108W            ---------MSKSNTYRMLVLLEDDTKI-------NKEDEKFLKGKP---------GKMH
Skud_13.33         ---------MSKSNAYRMLVLLEDDTKI-------SKEDEKFLKGKP---------GKMH
NCAS0B01100        ---------MSKDNMYRMLVLLEEEMEEPELFDNDTTDSKATEP------------KKTH
KAFR0A02760        --------MAGSDNRYRMLVLLEEESEEVIEKF-EDNDNGEQPKQES---------TKSH
                               .  *.:::::*:                                   *

Ecym_2711          DFVDEVVLPMQVDELDVLNKWFDKFDEEICLPNEGYIKYEISSDGLIVLMVSQER-SSIV
AAL184W            DFVDELLLPIQVDDLEVLNTWFDKFDEEICIPNEGHIKYEISSDGLIVLILDKEI-SEVI
KLTH0C04070g       EFVDELILPFEIDDMDKLNEWFDKFDADICIPNEGFIKYEISSDGLVVLLLDRSK-EDVV
Kwal_27.10328      EFVDELILPFEIDDMDTLNEWFDKFDAEICIPNEGFIKYEISSDGLVVLLLDRSR-EEVV
TDEL0B00670        EFVDELVLPFQVDEIDALNEWFDKFDEKLCIPNEGHIKYEITSDGMMVLLLDKEL-EHLV
TBLA0B03190        EFIDELILPFHVDELDILNEWFDKFDEQICIPNEGHIKYEITSDGLIILILDNDI-KHVV
KNAG0G03360        EYIDELHLPFGLDELDALNEWFDKFDEEICIPNEGHIKYEISSDGLIVLMLGKEI-EHVY
SAKL0D01738g       EFVDELVLPIQVDEMDLLNDWFDKFDEQICIPNEGYIKYEISSDGLIVLILNKER-EEVV
ZYRO0G13970g       EFMDELVLPFNVDEIDQLNSWFDKFDEQICIPNEGHIKYEITSDGIIVLILDKEM-EPLV
KLLA0D01661g       EFVDELPLPIQVDEMDLLNSWFDKFDEKICIPNEGHIKYEISSDGLIVLILDKSI-EHIV
Kpol_1069.3        EFVDELVLPFQVDEIDSLNDWFDKFDEEICIPNEGHIKYEITSDGIIVLILDKEI-ENVL
TPHA0I00190        EFVDELILPFNVDELDMLNEWFDKFDDEVCIPNEGHIKYEITSDGLIVLMLDKEI-EHVV
CAGL0J06666g       EFMDELTLPFQIDEIDLLNKWFDKFDDEICIPNEGHIKYEITSDGLIVLILDKELGEEFV
NDAI0E00360        EFIEELILPFGTEELDLLNEWFDKFDEEICIPNEGHIKYEITSDGLIVLLLDKEI-EDVV
Smik_13.26         EFVDELILPFDVDELDELNIWFDKFDAEICIPNEGHIKYEISSDGLIVLMLDKEI-EEVI
Suva_13.36         EFVDELMLPFQVDELDELNVWFDKFDAEICIPNEGHIKYEISSDGLIVLMLDKEI-EDVV
YML108W            EFVDELILPFNVDELDELNTWFDKFDAEICIPNEGHIKYEISSDGLIVLMLDKEI-EEVV
Skud_13.33         EFVDELILPFEIDELDELNIWFDKFDAEICIPNEGHIKYEISSDGLIVLMLDKEI-QEVV
NCAS0B01100        EFIEELLLPFEVSELDALNKWFDKFDEEICIPNEGHIKYEISSDGLIVLLLDKEI-ENVI
KAFR0A02760        EFIEELILPFETSELDTLNEWFDKFDEEICIPNEGNIKYEISSDGLVVLLIDKQI-ENVV
                   ::::*: **:  .::: ** ****** .:*:**** *****:***:::*::...  . . 

Ecym_2711          NQVKNFVAKNPLDNVLEEPLTD--------
AAL184W            GLVRDFVAANQLDEDSSSDAK---------
KLTH0C04070g       AQVRKFVEAESGDEIN--------------
Kwal_27.10328      AEVRKFVQSERASDVN--------------
TDEL0B00670        NDVKTFVEENSS------------------
TBLA0B03190        EQVKDFVQNNQ-------------------
KNAG0G03360        EQIKSFIETHQ-------------------
SAKL0D01738g       DKVRRFVEEHQVQDEEA-------------
ZYRO0G13970g       SQVRSFVEKHGNREDDDDEKEDD-------
KLLA0D01661g       QEVTSFVEQNVPESEKEQDE----------
Kpol_1069.3        DKVKEFVQSNHDSK----------------
TPHA0I00190        SKVKEFVSANQMLASDEEEQEYQKSAETGF
CAGL0J06666g       GKVKTFVEQNNVEDEDEEDA----------
NDAI0E00360        GEIKKFIETNQ-------------------
Smik_13.26         EKVKQFVEDNK-------------------
Suva_13.36         EKVKRFVEENI-------------------
YML108W            EKVKKFVEENN-------------------
Skud_13.33         EKVKNFVEDNN-------------------
NCAS0B01100        SEVKKFIDDNQDLNESE-------------
KAFR0A02760        EKVKEFVNNNQ-------------------
                     :  *:                       

FASTA FORMAT for MUSCLE Version 3.6

>Ecym_2711
------------------------------------------------------------
------MRAMSADNFYRMMILLEEAIPE--------SKDENIKA------------NATH
DFVDEVVLPMQVDELDVLNKWFDKFDEEICLPNEGYIKYEISSDGLIVLMVSQER-SSIV
NQVKNFVAKNPLDNVLEEPLTD--------
>AAL184W
------------------------------------------------------------
---------MATDNFYRMMILLEEPHKQ-------HSTDGRKIE------------NASH
DFVDELLLPIQVDDLEVLNTWFDKFDEEICIPNEGHIKYEISSDGLIVLILDKEI-SEVI
GLVRDFVAANQLDEDSSSDAK---------
>KLTH0C04070g
------------------------------------------------------------
---------MSDERNYRMLVLVEDVLEQAGEKNEQETKGEGAP-------------KATH
EFVDELILPFEIDDMDKLNEWFDKFDADICIPNEGFIKYEISSDGLVVLLLDRSK-EDVV
AQVRKFVEAESGDEIN--------------
>Kwal_27.10328
-------------------------------------------------------MSKLH
TRKRETKSKMSDERAYRMLVLVEDPVKSEGTVDGEKEENTDAP-------------KATH
EFVDELILPFEIDDMDTLNEWFDKFDAEICIPNEGFIKYEISSDGLVVLLLDRSR-EEVV
AEVRKFVQSERASDVN--------------
>TDEL0B00670
------------------------------------------------------------
--------MGGNDNFYHMIIFLEESIENGQEGNSVDNGEDKQDV------------KSSH
EFVDELVLPFQVDEIDALNEWFDKFDEKLCIPNEGHIKYEITSDGMMVLLLDKEL-EHLV
NDVKTFVEENSS------------------
>TBLA0B03190
------------------------------------------------------------
--------MSSNSVAYRMMVLLEEDMEPIEDDINLKSESSSNDNTEKVTTTKNTEPKKSH
EFIDELILPFHVDELDILNEWFDKFDEQICIPNEGHIKYEITSDGLIILILDNDI-KHVV
EQVKDFVQNNQ-------------------
>KNAG0G03360
------------------------------------------------------------
-------MVQQGDDTYRMLILVEEPLEDDVPTTEVTSEDGSQPI------------KSTH
EYIDELHLPFGLDELDALNEWFDKFDEEICIPNEGHIKYEISSDGLIVLMLGKEI-EHVY
EQIKSFIETHQ-------------------
>SAKL0D01738g
MYEHLVYDSLTTSFFFYSGRHCHVRTYYGNSDTMEKENKKIFEIEMSIETNPVISALTHR
IKGHVHSSVMSGDNGYRMLMLLEEAIPD------SSQENNENTT------------KTSH
EFVDELVLPIQVDEMDLLNDWFDKFDEQICIPNEGYIKYEISSDGLIVLILNKER-EEVV
DKVRRFVEEHQVQDEEA-------------
>ZYRO0G13970g
------------------------------------------------------------
--------MSGPENSYRMLVLLEEPVSG------SKPEDE----------------KKVH
EFMDELVLPFNVDEIDQLNSWFDKFDEQICIPNEGHIKYEITSDGIIVLILDKEM-EPLV
SQVRSFVEKHGNREDDDDEKEDD-------
>KLLA0D01661g
------------------------------------------------------------
--------MSATENVYRMLILLEEPISE-------SAGDTKKKQ------------NATH
EFVDELPLPIQVDEMDLLNSWFDKFDEKICIPNEGHIKYEISSDGLIVLILDKSI-EHIV
QEVTSFVEQNVPESEKEQDE----------
>Kpol_1069.3
------------------------------------------------------------
-------MAGGAESNYRMLILLEEGMENLDEEQTQQDRTEEPKES-----------KKMH
EFVDELVLPFQVDEIDSLNDWFDKFDEEICIPNEGHIKYEITSDGIIVLILDKEI-ENVL
DKVKEFVQSNHDSK----------------
>TPHA0I00190
------------------------------------------------------------
--------MAGESAPYRMLVLLEEPLEENIETLTRDGDVKEVNEHNVEKGETQ---SKSH
EFVDELILPFNVDELDMLNEWFDKFDDEVCIPNEGHIKYEITSDGLIVLMLDKEI-EHVV
SKVKEFVSANQMLASDEEEQEYQKSAETGF
>CAGL0J06666g
------------------------------------------------------------
-----------MSNLYRMMVLLEEPMEE-------DITISDSKEEK----------KVMH
EFMDELTLPFQIDEIDLLNKWFDKFDDEICIPNEGHIKYEITSDGLIVLILDKELGEEFV
GKVKTFVEQNNVEDEDEEDA----------
>NDAI0E00360
------------------------------------------------------------
--------MSSTNNMYRLMILLEEEIGEPDLKDGSIDEATETETKDVHNSDEEKNVKKMH
EFIEELILPFGTEELDLLNEWFDKFDEEICIPNEGHIKYEITSDGLIVLLLDKEI-EDVV
GEIKKFIETNQ-------------------
>Smik_13.26
------------------------------------------------------------
---------MSRNNTYRMLVLLEDDAKV-------NKEDEKFLKGKP---------GKMH
EFVDELILPFDVDELDELNIWFDKFDAEICIPNEGHIKYEISSDGLIVLMLDKEI-EEVI
EKVKQFVEDNK-------------------
>Suva_13.36
------------------------------------------------------------
---------MAKNNTYRMLVLLEDDTKI-------NKEDEKFLKGKP---------GKMH
EFVDELMLPFQVDELDELNVWFDKFDAEICIPNEGHIKYEISSDGLIVLMLDKEI-EDVV
EKVKRFVEENI-------------------
>YML108W
------------------------------------------------------------
---------MSKSNTYRMLVLLEDDTKI-------NKEDEKFLKGKP---------GKMH
EFVDELILPFNVDELDELNTWFDKFDAEICIPNEGHIKYEISSDGLIVLMLDKEI-EEVV
EKVKKFVEENN-------------------
>Skud_13.33
------------------------------------------------------------
---------MSKSNAYRMLVLLEDDTKI-------SKEDEKFLKGKP---------GKMH
EFVDELILPFEIDELDELNIWFDKFDAEICIPNEGHIKYEISSDGLIVLMLDKEI-QEVV
EKVKNFVEDNN-------------------
>NCAS0B01100
------------------------------------------------------------
---------MSKDNMYRMLVLLEEEMEEPELFDNDTTDSKATEP------------KKTH
EFIEELLLPFEVSELDALNKWFDKFDEEICIPNEGHIKYEISSDGLIVLLLDKEI-ENVI
SEVKKFIDDNQDLNESE-------------
>KAFR0A02760
------------------------------------------------------------
--------MAGSDNRYRMLVLLEEESEEVIEKF-EDNDNGEQPKQES---------TKSH
EFIEELILPFETSELDTLNEWFDKFDEEICIPNEGNIKYEISSDGLVVLLIDKQI-ENVV
EKVKEFVNNNQ-------------------